RPSBLAST alignment for GI: 254781060 and conserved domain: COG0410

>gnl|CDD|30759 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]. Length = 237
 Score = 69.3 bits (170), Expect = 8e-13
 Identities = 50/178 (28%), Positives = 85/178 (47%), Gaps = 13/178 (7%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLE++NL A       + +RG++L+VE  E+VA++G NG+GK+TL   + G       +G
Sbjct: 3   MLEVENLSAGY--GKIQALRGVSLEVERGEIVALLGRNGAGKTTLLKTIMGL--VRPRSG 58

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
            I++ GE I      ERA  GI    +     P + + + L +    +R    ++  L  
Sbjct: 59  RIIFDGEDITGLPPHERARLGIAYVPEGRRIFPRLTVEENLLLGAYARRDKEAQERDL-- 116

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGL 178
               +V ++   L    +   +      SGGE+++  I +  +  P L +LDE   GL
Sbjct: 117 ---EEVYELFPRL---KERRNQRAGT-LSGGEQQMLAIARALMSRPKLLLLDEPSEGL 167