RPSBLAST alignment for GI: 254781060 and conserved domain: COG0444

>gnl|CDD|30793 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]. Length = 316
 Score = 90.2 bits (224), Expect = 4e-19
 Identities = 61/252 (24%), Positives = 113/252 (44%), Gaps = 36/252 (14%)

Query: 1   MLEIKNLRAKIVDTDTEI--IRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSG---HKDY 55
           +LE+KNL          +  + G++ +++  E++ I+G +GSGKS L+  + G     + 
Sbjct: 1   LLEVKNLSVSFPTDAGVVKAVDGVSFELKKGEILGIVGESGSGKSVLAKAIMGLLPKPNA 60

Query: 56  EITAGDILYKGESILDWSIVERAS---KGIFLAFQY------PVEIPGIIMMQFLKIALN 106
            I  G+IL+ G+ +L  S  E      K I + FQ       PV   G  + + L++   
Sbjct: 61  RIVGGEILFDGKDLLSLSEKELRKIRGKEIAMIFQDPMTSLNPVMTIGDQIAEVLRLHGK 120

Query: 107 EQRKARNEKELLIPDFTRKVRKITAELGINMDMLKRPLNL---GFSGGEKKIAEILQMRL 163
              K   ++         +  ++   +GI     +R L       SGG ++   I     
Sbjct: 121 GLSKKEAKE---------RAIELLELVGI--PDPERRLKSYPHELSGGMRQRVMIAMALA 169

Query: 164 LEPSLCILDETDSGLDIDALKIAAQGVNALRS----QDRSFLIITHYQRLLNYIKPDTIH 219
           L P L I DE  + LD+    + AQ ++ L+     +  + ++ITH   ++  I  D + 
Sbjct: 170 LNPKLLIADEPTTALDV---TVQAQILDLLKELQREKGTALILITHDLGVVAEIA-DRVA 225

Query: 220 VLHNGKIIKTGD 231
           V++ G+I++ G 
Sbjct: 226 VMYAGRIVEEGP 237