RPSBLAST alignment for GI: 254781060 and conserved domain: COG1122

>gnl|CDD|31319 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 235
 Score = 88.8 bits (220), Expect = 1e-18
 Identities = 62/238 (26%), Positives = 112/238 (47%), Gaps = 25/238 (10%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           M+E +NL  +        ++ ++L++E  E V ++GPNGSGKSTL  LL+G    + T+G
Sbjct: 3   MIEAENLSFR-YPGRKAALKDVSLEIEKGERVLLIGPNGSGKSTLLKLLNGL--LKPTSG 59

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLK------IALNEQRKARNE 114
           ++L  G        +    + + L FQ P +       Q         +A   +      
Sbjct: 60  EVLVDGLDTSSEKSLLELRQKVGLVFQNPDD-------QLFGPTVEDEVAFGLENLGLPR 112

Query: 115 KELLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDET 174
           +E+       +V +    +G+   + + P NL  SGG+K+   I  +  + P + +LDE 
Sbjct: 113 EEI-----EERVAEALELVGLEELLDRPPFNL--SGGQKQRVAIAGVLAMGPEILLLDEP 165

Query: 175 DSGLDIDALKIAAQGVNALRSQ-DRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGD 231
            +GLD    +   + +  L+ +  ++ +I+TH   L+     D + VL +GKI+  GD
Sbjct: 166 TAGLDPKGRRELLELLKKLKEEGGKTIIIVTHDLELVLEYA-DRVVVLDDGKILADGD 222