RPSBLAST alignment for GI: 254781060 and conserved domain: COG4152

>gnl|CDD|33903 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 300
 Score = 45.6 bits (108), Expect = 1e-05
 Identities = 49/238 (20%), Positives = 99/238 (41%), Gaps = 33/238 (13%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
            LEI+ +       D + +  ++ +V P E+  ++GPNG+GK+T   ++ G    E T G
Sbjct: 2   ALEIEGVTKSF--GDKKAVDNISFEVPPGEIFGLLGPNGAGKTTTFRMILGL--LEPTEG 57

Query: 61  DILYKGESILDWSIVERASKGIFLAFQ---YPVEIPGIIMMQFLKIALNEQRKARNEKEL 117
           +I + G  +    I  R     +L  +   YP       +    ++    + + + + + 
Sbjct: 58  EITWNGGPL-SQEIKNRIG---YLPEERGLYPKMTVEDQLKYLAELKGMPKAEIQKKLQA 113

Query: 118 LIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSG 177
            +        +I  +    +  L +       G ++KI  I  + + EP L ILDE  SG
Sbjct: 114 WLERL-----EIVGKKTKKIKELSK-------GNQQKIQFISAV-IHEPELLILDEPFSG 160

Query: 178 LDIDALKIAAQGVNALRSQDRSFLIITH----YQRLLNYIKPDTIHVLHNGKIIKTGD 231
           LD   +++    +  L+ +  + +  +H     + L      D + +L  G+ +  G 
Sbjct: 161 LDPVNVELLKDAIFELKEEGATIIFSSHRMEHVEELC-----DRLLMLKKGQTVLYGT 213