RPSBLAST alignment for GI: 254781060 and conserved domain: COG4161

>gnl|CDD|33907 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism]. Length = 242
 Score = 41.9 bits (98), Expect = 2e-04
 Identities = 49/229 (21%), Positives = 99/229 (43%), Gaps = 28/229 (12%)

Query: 16  TEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWS-- 73
            + +  + L     E + ++GP+G+GKS+L  +L+     E+     L    +  D+S  
Sbjct: 15  HQALFDITLDCPEGETLVLLGPSGAGKSSLLRVLN---LLEMPRSGTLNIAGNHFDFSKT 71

Query: 74  ----IVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKI 129
                +    + + + FQ     P + + + L  A         ++ L       +  K+
Sbjct: 72  PSDKAIRDLRRNVGMVFQQYNLWPHLTVQENLIEAPCRVLGLSKDQAL------ARAEKL 125

Query: 130 TAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQG 189
              L +     + PL+L  SGG+++   I +  ++EP + + DE  + LD +   I AQ 
Sbjct: 126 LKRLRLKPYADRYPLHL--SGGQQQRVAIARALMMEPQVLLFDEPTAALDPE---ITAQI 180

Query: 190 VNALRSQDRSFL---IITHYQRLLNYIKPDTIHVLH--NGKIIKTGDYS 233
           V+ ++    + +   I+TH    +   +     V++  NG I++ GD S
Sbjct: 181 VSIIKELAETGITQVIVTHE---VEVARKTASRVVYMENGHIVEQGDAS 226