RPSBLAST alignment for GI: 254781060 and conserved domain: cd03221

>gnl|CDD|72980 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth. EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.. Length = 144
 Score = 44.7 bits (106), Expect = 2e-05
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 148 FSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALRSQDRSFLIITHYQ 207
            SGGEK    + ++ L  P+L +LDE  + LD+++++       AL+    + ++++H +
Sbjct: 71  LSGGEKMRLALAKLLLENPNLLLLDEPTNHLDLESIEALE---EALKEYPGTVILVSHDR 127

Query: 208 RLLNYIKPDTIHVLHNGK 225
             L+ +    I  L +GK
Sbjct: 128 YFLDQVATKIIE-LEDGK 144