RPSBLAST alignment for GI: 254781060 and conserved domain: cd03225

>gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 211
 Score =  107 bits (268), Expect = 4e-24
 Identities = 64/229 (27%), Positives = 110/229 (48%), Gaps = 24/229 (10%)

Query: 3   EIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDI 62
           E+KNL     D     +  ++L ++  E V I+GPNGSGKSTL  LL+G      T+G++
Sbjct: 1   ELKNLSFSYPDGARPALDDISLTIKKGEFVLIVGPNGSGKSTLLRLLNGLL--GPTSGEV 58

Query: 63  LYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLK------IALNEQRKARNEKE 116
           L  G+ +   S+ E   + + L FQ P         QF        +A   +     E+E
Sbjct: 59  LVDGKDLTKLSLKEL-RRKVGLVFQNP-------DDQFFGPTVEEEVAFGLENLGLPEEE 110

Query: 117 LLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDS 176
           +       +V +    +G+     + P  L  SGG+K+   I  +  ++P + +LDE  +
Sbjct: 111 IE-----ERVEEALELVGLEGLRDRSPFTL--SGGQKQRVAIAGVLAMDPDILLLDEPTA 163

Query: 177 GLDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGK 225
           GLD    +   + +  L+++ ++ +I+TH   LL  +  D + VL +GK
Sbjct: 164 GLDPAGRRELLELLKKLKAEGKTIIIVTHDLDLLLEL-ADRVIVLEDGK 211