RPSBLAST alignment for GI: 254781060 and conserved domain: COG4608

>gnl|CDD|73178 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]. Length = 268
 Score = 64.9 bits (158), Expect = 2e-11
 Identities = 59/243 (24%), Positives = 103/243 (42%), Gaps = 65/243 (26%)

Query: 1   MLEIKNL-------RAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHK 53
           +LE+KNL       +        + + G++  ++  E + ++G +G GKSTL  L+ G  
Sbjct: 4   LLEVKNLKKYFPVGKGFGKKRYVKAVDGVSFSIKEGETLGLVGESGCGKSTLGRLILGL- 62

Query: 54  DYEITAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARN 113
             E T+G+IL++G+ I   S  ER                                    
Sbjct: 63  -EEPTSGEILFEGKDITKLSKEER------------------------------------ 85

Query: 114 EKELLIPDFTRKVRKITAELGINMDMLKR-PLNLGFSGGEKKIAEILQMRLLEPSLCILD 172
                      +V ++  ++G+  + L R P     SGG+++   I +   L P L + D
Sbjct: 86  ---------RERVLELLEKVGLPEEFLYRYPHE--LSGGQRQRIGIARALALNPKLIVAD 134

Query: 173 ETDSGLDIDALKIAAQGVNALRSQDR----SFLIITHYQRLLNYIKPDTIHVLHNGKIIK 228
           E  S LD+    + AQ +N L+        ++L I+H   ++ YI  D I V++ GKI++
Sbjct: 135 EPVSALDV---SVQAQILNLLKDLQEELGLTYLFISHDLSVVRYIS-DRIAVMYLGKIVE 190

Query: 229 TGD 231
            G 
Sbjct: 191 IGP 193