RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781061|ref|YP_003065474.1| putative iron-sulfur cluster assembly protein [Candidatus Liberibacter asiaticus str. psy62] (428 letters) >1vh4_A SUFD protein; structural genomics, protein binding protein; 1.75A {Escherichia coli} (A:) Length = 435 Score = 221 bits (563), Expect = 2e-58 Identities = 92/397 (23%), Positives = 165/397 (41%), Gaps = 13/397 (3%) Query: 30 AFRRRLLCDFRTQGLLPTRKIENWHYTDLKNILKVLPTNKNSIATLQKKYKPLV--ADSI 87 ++ L GL PTRK ENW YT L+ ++ + ++ L DS+ Sbjct: 29 PQAQQHLQQLLRTGL-PTRKHENWKYTPLEGLIN-SQFVSIAGEISPQQRDALALTLDSV 86 Query: 88 QLSISQQPSSSILKEKNIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKVV 147 +L L + I +++ L + + ++ L+ + Sbjct: 87 RLVFVDGRYVPALSDATEGSGYEVSI---NDDRQGLPDAIQAEVFLHLTESLAQSVTHIA 143 Query: 148 IPDECQLNVPLELQAIQCG------GQMHLRYPISFGMNSRTTVVERYTTLTNDNSFVSS 201 + + PL L I G H R+ + + TV+E + +L + F + Sbjct: 144 VKRGQRPAKPLLLMHITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSLNDARHFTGA 203 Query: 202 IADIKVGEGADITWVIVLDQGIEDTHLGQLRVILEKKSSLKVFVLNIGQGLSRRELSIDV 261 I V A + + + + H ++L + ++ +G + R S + Sbjct: 204 RFTINVAANAHLQHIKLAFENPLSHHFAHNDLLLAEDATAFSHSFLLGGAVLRHNTSTQL 263 Query: 262 KGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQGAVHVSS 321 GE S + + + D +L H S + + IV +K VF G ++V+ Sbjct: 264 NGENSTLRINSLAMPVKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLINVAQ 323 Query: 322 EAQGSNARMTANTLLFSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGIS 381 A ++ +MT N LL KP+LEI+ADDV+C HGAT+ I+ E ++YL +RGI+ Sbjct: 324 HAIKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRSRGIN 383 Query: 382 KNQACSMLSHAFMSEIVEDLNDQVLQFSIEEILSSWL 418 + A M+ +AF +E+ E L D+ L+ + + L Sbjct: 384 QQDAQQMIIYAFAAELTEALRDEGLKQQVLARIGQRL 420 >1v6t_A Hypothetical UPF0271 protein PH0986; TIM-barrel, lactam utilization protein, structural genomics; 1.70A {Pyrococcus horikoshii OT3} (A:) Length = 255 Score = 29.0 bits (65), Expect = 1.3 Identities = 18/143 (12%), Positives = 45/143 (31%), Gaps = 33/143 (23%) Query: 1 MGNLTAVETMLLQSCDEACQKYYRNQSVVA----------------FRRRLLCD--FRTQ 42 + N E L ++ E + ++ +V + D + Sbjct: 114 LYNAMVKEEDLARAVIEGILDFDKDLILVTLSNSRVADIAEEMGLKVAHEVFADRAYNPD 173 Query: 43 GLLPTRKIENWHYTD----LKNILKVLPTNKNSIATLQKKYKPLVADSIQLSISQQPSS- 97 G L R D + ++ ++ I + ++ L D+I + P + Sbjct: 174 GTLVPRGRPGAVIEDKEEIAERVISMVKDGG--IRAINGEWVDLKVDTICVH-GDNPKAV 230 Query: 98 -------SILKEKNIEVLPFSHI 113 +L+E+ ++++P Sbjct: 231 EITSYIRKVLEEEGVKIVPMKEF 253 >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688) Length = 258 Score = 27.5 bits (61), Expect = 3.2 Identities = 7/33 (21%), Positives = 15/33 (45%), Gaps = 7/33 (21%) Query: 29 VAFRRRLLCDFRTQGLLPTRKIENWHYTDLKNI 61 + +R+R L Q I++W +L+ + Sbjct: 26 MKYRKRQLVTREAQ-------IKDWVENELEAL 51 >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} (A:327-444) Length = 118 Score = 27.4 bits (61), Expect = 3.5 Identities = 12/45 (26%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Query: 383 NQACSMLSHAFMSEIVEDLNDQVLQFSIEEILSSWLKNNSANMVM 427 Q +LS F S LN L E++L N S + ++ Sbjct: 35 AQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLG---PNASPDGLI 76 >3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A (A:139-214) Length = 76 Score = 26.2 bits (58), Expect = 9.3 Identities = 7/48 (14%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Query: 354 DDVQCGHGATISDI--NPEHLYYLMARGISKNQACSMLSHAFMSEIVE 399 ++ + ++ + N + L YL G+ + L + S + Sbjct: 6 EEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYS 53 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.318 0.133 0.379 Gapped Lambda K H 0.267 0.0699 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 3,005,872 Number of extensions: 128370 Number of successful extensions: 250 Number of sequences better than 10.0: 1 Number of HSP's gapped: 247 Number of HSP's successfully gapped: 5 Length of query: 428 Length of database: 4,956,049 Length adjustment: 91 Effective length of query: 337 Effective length of database: 1,879,794 Effective search space: 633490578 Effective search space used: 633490578 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 56 (25.4 bits)