HHsearch alignment for GI: 254781062 and conserved domain: PRK00451

>PRK00451 glycine dehydrogenase subunit 1; Validated.
Probab=99.91  E-value=3.5e-23  Score=165.75  Aligned_cols=324  Identities=15%  Similarity=0.180  Sum_probs=216.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHH---HHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCCCCC
Q ss_conf             99999999999999999982879765433468768---987654322344432013443454011000010000122223
Q gi|254781062|r   61 MANAVTDKYEKARDKVRRFINASSVKEIIFTRSAT---ESINLVSYGWGARHISTGDEIVLSVMEHHSNIIPWYFLRQRR  137 (406)
Q Consensus        61 ~~~~~~~~~~~aR~~ia~~lga~~~~~v~ft~~~T---e~~n~~~~~~~~~~~~~gd~Vi~s~~eh~s~~~~~~~~~~~~  137 (406)
T Consensus       106 ~sQG~Lq~l~e~Q~~l~eLtGmd~~-nasl~dga~a~~ea~~ma~------r~~~r~~vlv~~s~hP~~~~v~~t~a~~~  178 (449)
T PRK00451        106 ISQGTLQAIFEYQTMICELTGMDVA-NASMYDGATALAEAALMAV------RITGRNKVLVSGAVHPEYREVLKTYLKGQ  178 (449)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCC-CCCCCCHHHHHHHHHHHHH------HHCCCCEEEECCCCCCCHHHHHHHHCCCC
T ss_conf             1139999999999999998598746-7787747789999999998------64268739977987842799998630157


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCC--CCCCCCCCHHHH
Q ss_conf             222222222222210257887510233443322222222333333321000234444310123320--001110000110
Q gi|254781062|r  138 GASLVWVPIDNQGFFHIDEFKNRLTERTKLIAITHMSNVLGTVIPIKEICRIAHERNIPVLVDGSQ--GSVHNFVDVQDI  215 (406)
Q Consensus       138 G~~v~~i~~~~~g~id~~~l~~~i~~~t~lv~i~~~~~~tG~~~pi~~I~~~~~~~g~~~~vD~aq--~~g~~~id~~~~  215 (406)
T Consensus       179 g~~vv~v~~~~~g~~Dl~~L~~~~~~~~A~vmi~~Pn-t~G~~edi~~i~~~vh~~g~l~~~-~~n~~aLg~l~-~PGe~  255 (449)
T PRK00451        179 GIEVVEVPYPEDGVTDLEALEAAVDDDTAAVVVQYPN-FFGVIEDLEEIAEIAHAGGALFIV-VVDPVSLGLLK-PPGEY  255 (449)
T ss_pred             CCEEEEECCCCCCCCCHHHHHHHCCCCEEEEEEECCC-CCCCCCCHHHHHHHHHHCCCEEEE-EECHHHHHCCC-CCCCC
T ss_conf             8427984577566668899986417875899985588-777531699999999865974999-71678860767-84434


Q ss_pred             CCCCCC-----CCCCCCCCCCCCCHHHCCCCCCCCCEEECCCCEEEEEEECCC---CCCCCCHHCCCCCCCCCH---HHH
Q ss_conf             011222-----343222354443100025666310012114530343320245---300331000001221202---456
Q gi|254781062|r  216 DCDWYI-----ITGHKLYGPSGIGGLYSKESRLNEMDPFMGGSEMIADVTQDM---VTYADLPYRFEPGTPPIS---QAI  284 (406)
Q Consensus       216 ~~D~~~-----~S~hK~~Gp~G~G~l~~~~~~~~~~~p~~~g~~~~~~~~~~~---~~~~~~~~r~e~Gt~~~~---~~~  284 (406)
T Consensus       256 GaDIvvg~~q~lg~p~~fGGP~~G~~a~~~~l~r~lPgriVG~t~D~~G~~~y~LtLqtREQhIrReKAtSnIctnq~l~  335 (449)
T PRK00451        256 GADIVVGEGQPLGIPLSFGGPYLGFFATRKKLVRQMPGRLVGETVDVDGKRGFVLTLQAREQHIRREKATSNICTNQALC  335 (449)
T ss_pred             CCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCHHHCCCCCCCCCCCCCHHHH
T ss_conf             54068624766677866789987870556500102898766721367886120113455322234555546666422788


Q ss_pred             HHHHH--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCEEEEEECCCCHHHHHHHHHHCCCEEEECC
Q ss_conf             64210--1233222222222222222222222222221013226852158679998089999999999987896999752
Q gi|254781062|r  285 ALGVA--LDYVEKIDRKSIFSYERELARYVRSRLKEVRGMQLVNESLEDSPIISFRLGNIHPYDLALFLDGEGIAIRAGT  362 (406)
Q Consensus       285 al~~a--l~~~~~~g~~~i~~~~~~l~~~l~~~L~~~~g~~i~~~~~~~~~iv~~~~~~~~~~~v~~~L~~~gI~v~~G~  362 (406)
T Consensus       336 a~~a~~Yi~~lG~~GLk~va~~a~~nAnyl~~~L~~~~~~~~~~~~~~-f~Efv~~~~-~~a~~i~k~L~~~gi~~--g~  411 (449)
T PRK00451        336 ALAATIYMSLLGKEGLREVAEQNHQKAHYLAERLAEIGGVEVLFNGPF-FNEFVVRLP-KPAEEVNEALLEKGILG--GY  411 (449)
T ss_pred             HHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCEECCCCCCE-EEEEEEECC-CCHHHHHHHHHHCCCCC--CC
T ss_conf             999999999759766999999999999999999873798341689980-258999789-88999999999769978--98


Q ss_pred             HHHHHHHH-HCCCCCEEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             11278899-72899579999358889999999999999999
Q gi|254781062|r  363 HCANPLLK-FLGIDSLCRASLAMYNTYEEADKFIETLKKSI  402 (406)
Q Consensus       363 ~ca~~~~~-~~g~~~~iRiS~~~~nt~edid~~i~~l~~~i  402 (406)
T Consensus       412 ----~lt~~~p~~~~~lmi~~TEt~sk~dlD~~v~al~eil  448 (449)
T PRK00451        412 ----DLGRYYPELGNSLLVAVTELRTKEDIDALVEALGEVL  448 (449)
T ss_pred             ----CCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             ----8544277889979997078999999999999999986