HHsearch alignment for GI: 254781062 and conserved domain: PRK06460

>PRK06460 hypothetical protein; Provisional.
Probab=99.89  E-value=2.7e-23  Score=166.42  Aligned_cols=288  Identities=17%  Similarity=0.140  Sum_probs=182.7

Q ss_pred             HHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             99999828797654334687689876543223444320134434540110000100001222232222222222222102
Q gi|254781062|r   74 DKVRRFINASSVKEIIFTRSATESINLVSYGWGARHISTGDEIVLSVMEHHSNIIPWYFLRQRRGASLVWVPIDNQGFFH  153 (406)
Q Consensus        74 ~~ia~~lga~~~~~v~ft~~~Te~~n~~~~~~~~~~~~~gd~Vi~s~~eh~s~~~~~~~~~~~~G~~v~~i~~~~~g~id  153 (406)
T Consensus        52 ~~la~LEg~~~--a~~-~~SGmaAi~~~l~~~----l~~Gdhiv~~~~~Yg~t~~l~~~~l~~~Gv~v~~~d~~-----~  119 (375)
T PRK06460         52 EKIAELEEAEM--GVA-FSSGMGAISTTLLTL----LKPGSSVLIHRDMFGRSYRFFTDFLRNWGVKVEVARPG-----E  119 (375)
T ss_pred             HHHHHHHCCCE--EEE-ECCHHHHHHHHHHHH----HCCCCEEEECCCCCCCHHHHHHHHHHHCCEEEEEECCC-----C
T ss_conf             99999819980--899-535999999999997----28999899717875867999999987378677973899-----9


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCC-
Q ss_conf             5788751023344332222222233333332100023444431012332000111000011001122234322235444-
Q gi|254781062|r  154 IDEFKNRLTERTKLIAITHMSNVLGTVIPIKEICRIAHERNIPVLVDGSQGSVHNFVDVQDIDCDWYIITGHKLYGPSG-  232 (406)
Q Consensus       154 ~~~l~~~i~~~t~lv~i~~~~~~tG~~~pi~~I~~~~~~~g~~~~vD~aq~~g~~~id~~~~~~D~~~~S~hK~~Gp~G-  232 (406)
T Consensus       120 ~~~~~~~~~~~Tklv~~EspsNP~l~v~Di~~i~~ia~~~gi~~vVDNT~atP~~-~~Pl~~GaDivvhS~TKyi~GhsD  198 (375)
T PRK06460        120 ENILEKIKNKRYDVVFVETISNPLLRVIDIPELSKACKENGALLIVDSTFATPIN-QKPLVQGADIVIHSASKFIAGHND  198 (375)
T ss_pred             HHHHHHHCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHCCCEEEEECCCCCCCC-CCHHHHCCCEEEEECCCCCCCCCC
T ss_conf             9999973476760899988999876405858999999874993897567414122-881451798899955643467887


Q ss_pred             --CCHHHCCCCCCCCCEEECCCCEEEEEEECCCCCCCCCHHCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             --310002566631001211453034332024530033100000122120245664210123322222222222222222
Q gi|254781062|r  233 --IGGLYSKESRLNEMDPFMGGSEMIADVTQDMVTYADLPYRFEPGTPPISQAIALGVALDYVEKIDRKSIFSYERELAR  310 (406)
Q Consensus       233 --~G~l~~~~~~~~~~~p~~~g~~~~~~~~~~~~~~~~~~~r~e~Gt~~~~~~~al~~al~~~~~~g~~~i~~~~~~l~~  310 (406)
T Consensus       199 ~l~Gvv~~~~~~~~~l~~~~~~~G~~---------------------lsP~~a~l~~rGl~---TL--~lR~~~~~~nA~  252 (375)
T PRK06460        199 VIAGLAAGSYELMKKIDLMRRTLGTS---------------------LDPHAAYLTIRGIK---TL--KIRMDVINSNAQ  252 (375)
T ss_pred             EEEEEECCCHHHHHHHHHHHHHCCCC---------------------CCHHHHHHHHCCCC---CH--HHHHHHHHHHHH
T ss_conf             34034248199999999998642787---------------------88166888863699---89--999999999999


Q ss_pred             CCCCCCCCCCEE-EECCCC--------------CCCCCEEEEEECCCCHHH---HHHHHHHCCCEEEECCH------HH-
Q ss_conf             222222222101-322685--------------215867999808999999---99999878969997521------12-
Q gi|254781062|r  311 YVRSRLKEVRGM-QLVNES--------------LEDSPIISFRLGNIHPYD---LALFLDGEGIAIRAGTH------CA-  365 (406)
Q Consensus       311 ~l~~~L~~~~g~-~i~~~~--------------~~~~~iv~~~~~~~~~~~---v~~~L~~~gI~v~~G~~------ca-  365 (406)
T Consensus       253 ~lA~~L~~hp~V~~V~yPgl~s~p~h~lakk~~~g~ggl~sf~l~~-~~~~~~~f~~~L~lf~~a~SlGg~eSLi~~p~~  331 (375)
T PRK06460        253 KIAEFLQEHPKVSKVYYPGLKSHPDYGIARRVLKGYGGVVSFEIKG-SQNDALKLMKRLSVILPAQTLGGVNSTISHPAT  331 (375)
T ss_pred             HHHHHHHHCCCCCEEECCCCCCCCCHHHHHHHCCCCCCEEEEEECC-CHHHHHHHHHHCCCCEECCCCCCCCCEEECCCC
T ss_conf             9999997489817798989999947999998569997426999708-999999999828826343167876301127542


Q ss_pred             -------HHHHHHCCC-CCEEEEEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             -------788997289-9579999358889999999999999999971
Q gi|254781062|r  366 -------NPLLKFLGI-DSLCRASLAMYNTYEEADKFIETLKKSIQFF  405 (406)
Q Consensus       366 -------~~~~~~~g~-~~~iRiS~~~~nt~edid~~i~~l~~~i~~l  405 (406)
T Consensus       332 ~sh~~~~~e~~~~~Gi~~~liRlSvGl----Ed~eDLi~DL~~AL~~l  375 (375)
T PRK06460        332 MSHRTLTPEERKILGITDSMLRLSVGI----EDVEDLIEDLDRALSNL  375 (375)
T ss_pred             CCCCCCCHHHHHHCCCCCCEEEEEECC----CCHHHHHHHHHHHHHCC
T ss_conf             455318999999659793969999421----99999999999998339