RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781063|ref|YP_003065476.1| hypothetical protein CLIBASIA_04825 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) >gnl|CDD|32334 COG2151, PaaD, Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only]. Length = 111 Score = 119 bits (300), Expect = 2e-28 Identities = 52/107 (48%), Positives = 73/107 (68%), Gaps = 1/107 (0%) Query: 24 IPPEDLERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVEN-DYMVKILMTLTAPGCPV 82 I E ++ DI+ ALKTV DPEI DI +LGL+Y++D+++ D +VK+ MTLT+PGCP+ Sbjct: 5 IEEEAIKVTLEDILEALKTVIDPEIGIDIVDLGLVYEVDIDDVDGLVKVKMTLTSPGCPL 64 Query: 83 AGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDLMSEEAQIATGYY 129 A + +E A+ + G+ VEV +T PPWTPD MSEEA+ A G Sbjct: 65 AEVIADQVEAALEEIPGVEDVEVELTLSPPWTPDRMSEEARRALGIT 111 >gnl|CDD|110847 pfam01883, DUF59, Domain of unknown function DUF59. This family includes prokaryotic proteins of unknown function. The family also includes PhaH from Pseudomonas putida. PhaH forms a complex with PhaF, PhaG, and PhaI, which hydroxylates phenylacetic acid to 2-hydroxyphenylacetic acid. So members of this family may all be components of ring hydroxylating complexes. Length = 76 Score = 91.1 bits (227), Expect = 7e-20 Identities = 34/73 (46%), Positives = 51/73 (69%) Query: 35 DIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKWIENAV 94 I+ ALKTV DPE+P DI +LGL+Y++D+++D VK+ MTLT PGCP+A + + A+ Sbjct: 4 AILEALKTVIDPELPVDIVDLGLVYEVDIDDDGNVKVKMTLTTPGCPLADLIALDVREAL 63 Query: 95 GAVEGISGVEVSI 107 + G+ VEV + Sbjct: 64 LELPGVEDVEVEL 76 >gnl|CDD|29471 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions.. Length = 63 Score = 30.6 bits (69), Expect = 0.12 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 8/46 (17%) Query: 90 IENAVGAVEGISGVEVS-------ITFDPPWTPDLMSEEAQIATGY 128 IE A+ + G+ VEV + +DP +P+ + EA GY Sbjct: 16 IEKALEKLPGVESVEVDLETGKATVEYDPEVSPEEL-LEAIEDAGY 60 >gnl|CDD|38591 KOG3381, KOG3381, KOG3381, Uncharacterized conserved protein [Function unknown]. Length = 161 Score = 29.5 bits (66), Expect = 0.26 Identities = 20/73 (27%), Positives = 31/73 (42%), Gaps = 12/73 (16%) Query: 19 SPESTIPPEDLERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVE--------NDYMVK 70 E ED E I + I + + DPE P + +L ++ + VE + V+ Sbjct: 26 EDELLPDSEDAEEIFDLI----RDIRDPEHPLTLEQLNVVSEEGVEVDDPNVGDEESYVR 81 Query: 71 ILMTLTAPGCPVA 83 I T T P C +A Sbjct: 82 ITFTPTIPHCSMA 94 >gnl|CDD|32952 COG3138, AstA, Arginine/ornithine N-succinyltransferase beta subunit [Amino acid transport and metabolism]. Length = 336 Score = 28.3 bits (63), Expect = 0.67 Identities = 7/19 (36%), Positives = 12/19 (63%) Query: 95 GAVEGISGVEVSITFDPPW 113 G V GIS +E ++ + P+ Sbjct: 68 GTVVGISAIEAAVGLNDPF 86 >gnl|CDD|34313 COG4697, COG4697, Uncharacterized protein conserved in archaea [Function unknown]. Length = 319 Score = 27.6 bits (61), Expect = 1.1 Identities = 18/97 (18%), Positives = 30/97 (30%), Gaps = 10/97 (10%) Query: 22 STIPPEDLERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCP 81 S+ P E IS+ L DP +P E G I+ + ++ + + Sbjct: 168 SSNPAEKGRDISDKATFGLLLRIDPGVPQIDTESGAIFGMALDGEGLYI----------G 217 Query: 82 VAGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDLM 118 +G + G V V P P + Sbjct: 218 ASGANHTGVYRYRAGDGGGFAVPVPELGREPRFPRRI 254 >gnl|CDD|37623 KOG2412, KOG2412, KOG2412, Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification]. Length = 591 Score = 26.2 bits (57), Expect = 2.4 Identities = 7/42 (16%), Positives = 11/42 (26%) Query: 1 MKQKNPDTENNIADKIALSPESTIPPEDLERISNDIIAALKT 42 + D I++ PE DL + L Sbjct: 1 EGIPLEEPCPKSVDGISIDPEPNWNFPDLVAEIASVEKKLNG 42 >gnl|CDD|31518 COG1327, COG1327, Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]. Length = 156 Score = 26.0 bits (57), Expect = 3.0 Identities = 6/28 (21%), Positives = 13/28 (46%) Query: 24 IPPEDLERISNDIIAALKTVYDPEIPCD 51 + E +E + I L++ + E+P Sbjct: 79 VSSEQIEEAVSHIERQLRSSGEREVPSK 106 >gnl|CDD|37186 KOG1975, KOG1975, KOG1975, mRNA cap methyltransferase [RNA processing and modification]. Length = 389 Score = 25.7 bits (56), Expect = 3.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Query: 79 GCPVAGDMPKWIENAVGAVEGISGVEVSI 107 GC GD+ KW + +G GI EVSI Sbjct: 125 GCGKGGDLLKWDKAGIGEYIGIDIAEVSI 153 >gnl|CDD|145557 pfam02479, Herpes_IE68, Herpesvirus immediate early protein. This regulatory protein is expressed from an immediate early gene in the cell cycle of herpesvirus. The protein is known by various names including IE-68, US1, ICP22 and IR4. Length = 132 Score = 25.4 bits (56), Expect = 4.2 Identities = 11/41 (26%), Positives = 12/41 (29%), Gaps = 11/41 (26%) Query: 77 APGCPVAGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDL 117 G P A + GA PPW PDL Sbjct: 3 EYGPPSAPAGLRSYSRGPGAFCA-----------PPWRPDL 32 >gnl|CDD|173858 cd08493, PBP2_DppA_like, The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction. Length = 482 Score = 24.8 bits (55), Expect = 7.3 Identities = 10/28 (35%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Query: 51 DIFELGLIYKIDVENDYMVKILMTLTAP 78 + LI ++ +DY VK TLT P Sbjct: 109 SMGLGSLIKSVEAVDDYTVKF--TLTRP 134 >gnl|CDD|144525 pfam00958, GMP_synt_C, GMP synthase C terminal domain. GMP synthetase is a glutamine amidotransferase from the de novo purine biosynthetic pathway. This family is the C-terminal domain specific to the GMP synthases EC:6.3.5.2. In prokaryotes this domain mediates dimerization. Eukaryotic GMP synthases are monomers. This domain in eukaryotes includes several large insertions that may form globular domains. Length = 93 Score = 24.3 bits (54), Expect = 9.7 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Query: 24 IPPEDLERISNDIIAALK----TVYD 45 +P E LERISN I + VYD Sbjct: 57 LPYEVLERISNRITNEVPGVNRVVYD 82 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.314 0.136 0.404 Gapped Lambda K H 0.267 0.0732 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,671,057 Number of extensions: 82021 Number of successful extensions: 186 Number of sequences better than 10.0: 1 Number of HSP's gapped: 185 Number of HSP's successfully gapped: 18 Length of query: 129 Length of database: 6,263,737 Length adjustment: 83 Effective length of query: 46 Effective length of database: 4,470,190 Effective search space: 205628740 Effective search space used: 205628740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 52 (23.8 bits)