HHsearch alignment for GI: 254781064 and conserved domain: COG3564

>COG3564 Uncharacterized protein conserved in bacteria [Function unknown].
Probab=95.27  E-value=0.15  Score=29.74  Aligned_cols=94  Identities=26%  Similarity=0.211  Sum_probs=62.7

Q ss_pred             CCCCEEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCEEEEHHHHC--CCCCCCCEE-CCCCEEEEECHHHHHHHC
Q ss_conf             98616526899999999997179986189999847987871132001100--210122201-246839999787732006
Q gi|254781064|r    1 MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD--NPVDGDDLI-EKDGVKVWIDSASLLYML   77 (116)
Q Consensus         1 M~~mi~IT~~A~~~i~~l~~~~~~~~~~lRi~v~~gGC~G~~Y~l~~~~~--~~~~~D~~~-~~~g~~i~id~~s~~~L~   77 (116)
T Consensus         3 ~~~~V~aT~aAl~Li~~l~~~hgp----v-mFHQSGGCCDGSsPMCYP~~~fivGd~DvlLG~i~gvPvyIs~~QyeaWK   77 (116)
T COG3564           3 MPARVLATPAALDLIAELQAEHGP----V-MFHQSGGCCDGSSPMCYPRADFIVGDNDVLLGEIDGVPVYISGPQYEAWK   77 (116)
T ss_pred             CCCCEECCHHHHHHHHHHHHHCCC----E-EEECCCCCCCCCCCCCCCCCCEEECCCCEEEEEECCEEEEECCCHHHHHH
T ss_conf             876224388899999999875498----7-88326884589987401454456647735886537877886470775210


Q ss_pred             CC--EEEEECCCCCCEEEEECCCCC
Q ss_conf             98--997631774451289888878
Q gi|254781064|r   78 GT--EIDFKTEKLYSGFVFHNPNQV  100 (116)
Q Consensus        78 g~--~IDy~~~~~~~~F~~~NPna~  100 (116)
T Consensus        78 HTqLIIDVVp-GRGGmFSLdng~E~  101 (116)
T COG3564          78 HTQLIIDVVP-GRGGMFSLDNGREK  101 (116)
T ss_pred             CCEEEEEEEC-CCCCEEECCCCCCE
T ss_conf             0178999865-98864572578513