HHsearch alignment for GI: 254781064 and conserved domain: COG4841

>COG4841 Uncharacterized protein conserved in bacteria [Function unknown].
Probab=98.13  E-value=4.6e-06  Score=55.01  Aligned_cols=88  Identities=20%  Similarity=0.383  Sum_probs=64.7

Q ss_pred             EEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCEEE--EHHHHCCCCCCCCEECCCCEEEEECHHHHHHHCC--CE
Q ss_conf             6526899999999997179986189999847987871132--0011002101222012468399997877320069--89
Q gi|254781064|r    5 VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYM--VDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLG--TE   80 (116)
Q Consensus         5 i~IT~~A~~~i~~l~~~~~~~~~~lRi~v~~gGC~G~~Y~--l~~~~~~~~~~D~~~~~~g~~i~id~~s~~~L~g--~~   80 (116)
T Consensus         3 i~vtd~A~~wfk~E~~l~--~g~~vrffvRyGG~~~~~~GFS~gv~~e~PkE~g~~q~~Dgltffiee~DlWYF~d~d~~   80 (95)
T COG4841           3 IEVTDQALKWFKEELDLE--EGNKVRFFVRYGGCSSLQQGFSLGVAKEVPKEIGYKQEYDGLTFFIEEKDLWYFDDHDLK   80 (95)
T ss_pred             EEECHHHHHHHHHHCCCC--CCCEEEEEEEECCCCCCCCCCCEEEECCCCHHHCHHEEECCEEEEEECCCEEEECCCCEE
T ss_conf             587079888888743877--898789999976711236872313421283231522044570899945726887288679


Q ss_pred             EEEECCCCCCEEEE
Q ss_conf             97631774451289
Q gi|254781064|r   81 IDFKTEKLYSGFVF   94 (116)
Q Consensus        81 IDy~~~~~~~~F~~   94 (116)
T Consensus        81 v~y~~~~Dei~fs~   94 (95)
T COG4841          81 VDYSPDTDEISFSY   94 (95)
T ss_pred             EECCCCCCCCEEEC
T ss_conf             96167877504631