>TIGR01997 sufA_proteo FeS assembly scaffold SufA; InterPro: IPR011298 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] . FeS cluster assembly is a complex process involving the mobilisation of Fe and S atoms from storage sources, their assembly into [Fe-S] form, their transport to specific cellular locations, and their transfer to recipient apoproteins. So far, three FeS assembly machineries have been identified, which are capable of synthesising all types of [Fe-S] clusters: ISC (iron-sulphur cluster), SUF (sulphur assimilation), and NIF (nitrogen fixation) systems. The ISC system is conserved in eubacteria and eukaryotes (mitochondria), and has broad specificity, targeting general FeS proteins , . It is encoded by the isc operon (iscRSUA-hscBA-fdx-iscX). IscS is a cysteine desulphurase, which obtains S from cysteine (converting it to alanine) and serves as a S donor for FeS cluster assembly. IscU and IscA act as scaffolds to accept S and Fe atoms, assembling clusters and transfering them to recipient apoproteins. HscA is a molecular chaperone and HscB is a co-chaperone. Fdx is a [2Fe-2S]-type ferredoxin. IscR is a transcription factor that regulates expression of the isc operon. IscX (also known as YfhJ) appears to interact with IscS and may function as an Fe donor during cluster assembly . The SUF system is an alternative pathway to the ISC system that operates under iron starvation and oxidative stress. It is found in eubacteria, archaea and eukaryotes (plastids). The SUF system is encoded by the suf operon (sufABCDSE), and the six encoded proteins are arranged into two complexes (SufSE and SufBCD) and one protein (SufA). SufS is a pyridoxal-phosphate (PLP) protein displaying cysteine desulphurase activity. SufE acts as a scaffold protein that accepts S from SufS and donates it to SufA . SufC is an ATPase with an unorthodox ATP-binding cassette (ABC)-like component. No specific functions have been assigned to SufB and SufD. SufA is homologous to IscA , acting as a scaffold protein in which Fe and S atoms are assembled into [FeS] cluster forms, which can then easily be transferred to apoproteins targets. In the NIF system, NifS and NifU are required for the formation of metalloclusters of nitrogenase in Azotobacter vinelandii, and other organisms, as well as in the maturation of other FeS proteins. Nitrogenase catalyses the fixation of nitrogen. It contains a complex cluster, the FeMo cofactor, which contains molybdenum, Fe and S. NifS is a cysteine desulphurase. NifU binds one Fe atom at its N-terminal, assembling an FeS cluster that is transferred to nitrogenase apoproteins . Nif proteins involved in the formation of FeS clusters can also be found in organisms that do not fix nitrogen . This entry represents the SufA protein of the SUF system of iron-sulphur cluster biosynthesis. SufA acts as a scaffold in which Fe and S are assembled into FeS clusters . This system performs FeS biosynthesis even during oxidative stress and tends to be absent in obligate anaerobic and microaerophilic bacteria..

Probab=100.00  E-value=7.7e-37  Score=227.71  Aligned_cols=108  Identities=49%  Similarity=0.942  Sum_probs=102.0

Q ss_pred             CCEEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCEEEEHHHHCCCCCCCCEEC-CCCEEEEECHHHHHHHCCCEE
Q ss_conf             6165268999999999971799861899998479878711320011002101222012-468399997877320069899
Q gi|254781064|r    3 DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE-KDGVKVWIDSASLLYMLGTEI   81 (116)
Q Consensus         3 ~mi~IT~~A~~~i~~l~~~~~~~~~~lRi~v~~gGC~G~~Y~l~~~~~~~~~~D~~~~-~~g~~i~id~~s~~~L~g~~I   81 (116)
T Consensus         1 ~~~~lT~AAa~~i~~l~~~~g~~~~g~Rl~vKktGCaG~~Y~~~~V~e-p~~~D~L~et~~Gakv~v~p~a~~~i~GT~v   79 (110)
T TIGR01997         1 AVITLTDAAATHIRELVKKRGTEAVGIRLSVKKTGCAGMEYVLELVSE-PKEDDDLIETADGAKVFVAPEAVLFILGTQV   79 (110)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCEEEEEEECC-CCCCCEEEECCCCCEEEECHHHHHHCCCCEE
T ss_conf             965201578899999985038982048876655763773023001107-8888703210388658866444002048674


Q ss_pred             EEECCCCCC-EEEEECCCCCCCCCCCCCCCC
Q ss_conf             763177445-128988887876788521121
Q gi|254781064|r   82 DFKTEKLYS-GFVFHNPNQVSACGCGQSVEI  111 (116)
Q Consensus        82 Dy~~~~~~~-~F~~~NPna~~~CgCG~SF~~  111 (116)
T Consensus        80 Df~~~~L~~y~f~FnNPn~~~aCGCGES~~l  110 (110)
T TIGR01997        80 DFVKTTLRQYGFKFNNPNATSACGCGESFEL  110 (110)
T ss_pred             EEEECCCCEEEEEECCCCCCCCCCCCCCCCC
T ss_conf             5787354122227428554678876421459