HHsearch results for GI: 254781064 and protein with PDBid: 2k4z_A

>2k4z_A DSRR; ISCA/SUFA/HESB like fold, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Allochromatium vinosum}
Probab=99.96  E-value=1.2e-29  Score=186.14  Aligned_cols=97  Identities=16%  Similarity=0.281  Sum_probs=89.1

Q ss_pred             CCEEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCEEEEHHHHCCCCCCCCEECCCCEEEEECHHHHHHHCCCEEE
Q ss_conf             61652689999999999717998618999984798787113200110021012220124683999978773200698997
Q gi|254781064|r    3 DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEID   82 (116)
Q Consensus         3 ~mi~IT~~A~~~i~~l~~~~~~~~~~lRi~v~~gGC~G~~Y~l~~~~~~~~~~D~~~~~~g~~i~id~~s~~~L~g~~ID   82 (116)
                      .||+||++|+++|++++++++.++++|||+|++|||+||+|.|+|  +.+.++|++++.+|++|+||+.|++||.|++||
T Consensus        21 ~~i~iT~~A~~~i~~~~~~~~~~~~~LRl~V~~gGCsGf~Y~l~f--d~~~e~D~~~~~~gi~vvID~~S~~~L~GstID   98 (125)
T 2k4z_A           21 MMFKLTPAAAEQVLKAAKQGGTEGMCLRLAAGRNPDGSIDYRMGF--DDLTEDDIRLTSEGVEIVIAPDYVSLLDQTTLD   98 (125)
T ss_dssp             SCEEECHHHHHHHHHHHHHSSSTTCEEEEEEEECTTSCEEEEEEE--ECCCSSSCEEECSSCEEECCTTTHHHHTTEEEE
T ss_pred             CEEEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCEEEEEE--CCCCCCCEEEEECCCEEEECHHHHHHCCCEEEE
T ss_conf             059989999999999998479988379999946888984856897--877888589981795488562365141986998


Q ss_pred             EECCCC-CCEEEEECCCCCC
Q ss_conf             631774-4512898888787
Q gi|254781064|r   83 FKTEKL-YSGFVFHNPNQVS  101 (116)
Q Consensus        83 y~~~~~-~~~F~~~NPna~~  101 (116)
                      |+++.+ +++|+|+|||+.+
T Consensus        99 yve~~~g~~gF~f~NPN~pn  118 (125)
T 2k4z_A           99 YVELEPGQFHFIFLNPRDPT  118 (125)
T ss_dssp             EEEEETTEEEEEEECSSSCS
T ss_pred             EECCCCCCCCEEEECCCCCC
T ss_conf             87278873787997959998