BLAST/PSIBLAST alignment of GI: 254781064 and GI: 116252322 at iteration 1
>gi|116252322|ref|YP_768160.1| HesB nitrogen fixation family protein [Rhizobium leguminosarum bv. viciae 3841] Length = 130
>gi|115256970|emb|CAK08064.1| putative HesB nitrogen fixation family protein [Rhizobium leguminosarum bv. viciae 3841] Length = 130
 Score =  147 bits (372), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 88/113 (77%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I++MT+ A  R+K IV NS   A+G+R+ +KKGGCAG+EY +DLVT+ P   DDLIE+DG
Sbjct: 5   IMSMTDGAAARVKAIVENSGPDAKGVRVGIKKGGCAGMEYTIDLVTE-PNAKDDLIERDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            KVW++ ++ LY+LGTE+ F+T  L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  AKVWVEPSAALYLLGTEMGFETTTLRSGFTFTNPNQTSACGCGESVELKPADL 116