BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781064|ref|YP_003065477.1| FeS assembly scaffold SufA
[Candidatus Liberibacter asiaticus str. psy62]
         (116 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781064|ref|YP_003065477.1| FeS assembly scaffold SufA [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040741|gb|ACT57537.1| FeS assembly scaffold SufA [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 116

 Score =  239 bits (610), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 116/116 (100%), Positives = 116/116 (100%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE
Sbjct: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL
Sbjct: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116


>gi|315122404|ref|YP_004062893.1| FeS assembly scaffold SufA [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495806|gb|ADR52405.1| FeS assembly scaffold SufA [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 129

 Score =  197 bits (502), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 95/115 (82%), Positives = 106/115 (92%), Gaps = 1/115 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           +D+VTMTEAAV R+K+IV NSQG AQGIRISLKKGGCAGLEYMVDLVT+ P + DDL+EK
Sbjct: 4   NDVVTMTEAAVSRVKDIVKNSQGTAQGIRISLKKGGCAGLEYMVDLVTE-PFNEDDLVEK 62

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           DGVKVWID ++LLY+LG EIDFK EKL+SGFVFHNPNQVSACGCGQSVEIKRADL
Sbjct: 63  DGVKVWIDPSALLYILGMEIDFKIEKLHSGFVFHNPNQVSACGCGQSVEIKRADL 117


>gi|222148795|ref|YP_002549752.1| FeS assembly scaffold SufA [Agrobacterium vitis S4]
 gi|221735781|gb|ACM36744.1| FeS assembly scaffold SufA [Agrobacterium vitis S4]
          Length = 128

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 71/113 (62%), Positives = 90/113 (79%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMT+AA  R+KEIV NS   A+GIR+ +KKGGCAG+EY +DLVT+ P   DDLI +DG
Sbjct: 5   VMTMTDAAAARVKEIVENSGPDAKGIRVGIKKGGCAGMEYTIDLVTE-PNPRDDLIARDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
             VW++ A++LY+LGTEIDF+T  L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  ASVWLEPAAVLYLLGTEIDFETTTLRSGFTFRNPNQTSACGCGESVELKAADL 116


>gi|150396676|ref|YP_001327143.1| FeS assembly scaffold SufA [Sinorhizobium medicae WSM419]
 gi|150028191|gb|ABR60308.1| FeS assembly scaffold SufA [Sinorhizobium medicae WSM419]
          Length = 130

 Score =  151 bits (381), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 92/113 (81%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I+++T+AA  R++ IV N+ G+A+GIR+S+KKGGCAG+EY +DLVT+ P   DDL+E +G
Sbjct: 5   IMSLTDAAANRVRSIVENAGGEAKGIRVSIKKGGCAGMEYAIDLVTE-PSSKDDLVEHEG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            KVW+   ++LY+LGT++DF+T  L SGF F+NPNQ SACGCG+SVE+K ADL
Sbjct: 64  AKVWVAPEAVLYLLGTQMDFETTTLRSGFTFNNPNQTSACGCGESVELKPADL 116


>gi|15965483|ref|NP_385836.1| hypothetical protein SMc00301 [Sinorhizobium meliloti 1021]
 gi|307302604|ref|ZP_07582360.1| FeS assembly scaffold SufA [Sinorhizobium meliloti BL225C]
 gi|307318451|ref|ZP_07597885.1| FeS assembly scaffold SufA [Sinorhizobium meliloti AK83]
 gi|15074664|emb|CAC46309.1| Putative FeS assembly scaffold [Sinorhizobium meliloti 1021]
 gi|306895791|gb|EFN26543.1| FeS assembly scaffold SufA [Sinorhizobium meliloti AK83]
 gi|306902968|gb|EFN33559.1| FeS assembly scaffold SufA [Sinorhizobium meliloti BL225C]
          Length = 130

 Score =  150 bits (379), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 92/113 (81%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++T+AA  R++ IV N+ G+A+GIRIS+KKGGCAG+EY VDLV++ P   DDLIE+ G
Sbjct: 5   VMSLTDAAASRVRSIVENAGGEAKGIRISIKKGGCAGMEYAVDLVSE-PNSKDDLIEQQG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            KVW+   ++LY+LGT++DF+T  L SGF F+NPNQ SACGCG+SVE+K ADL
Sbjct: 64  AKVWVAPEAVLYLLGTQMDFETTTLRSGFTFNNPNQTSACGCGESVELKPADL 116


>gi|241204821|ref|YP_002975917.1| FeS assembly scaffold SufA [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240858711|gb|ACS56378.1| FeS assembly scaffold SufA [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 130

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 88/113 (77%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I++MT+ A  R+K IV NS   A+G+R+ +KKGGCAG+EY +DLVT+ P   DDLIE+DG
Sbjct: 5   IMSMTDGAAARVKAIVENSGADAKGVRVGIKKGGCAGMEYTIDLVTE-PNAKDDLIERDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            +VW++ ++ LY+LGTE+ F+T  L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  ARVWVEPSAALYLLGTEMGFETTTLRSGFTFTNPNQTSACGCGESVELKPADL 116


>gi|327191052|gb|EGE58105.1| FeS assembly scaffold SufA [Rhizobium etli CNPAF512]
          Length = 130

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 65/113 (57%), Positives = 89/113 (78%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +++MTE A  R+K IV NS  +A+G+R+ +KKGGCAG+EY +DLVT+ P   DDLIE+DG
Sbjct: 5   VMSMTEGAAARVKAIVENSGPEAKGVRVGIKKGGCAGMEYTIDLVTE-PNAKDDLIERDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            +VW++ +++LY+LGTE+ F+   L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  ARVWVEPSAVLYLLGTEMGFEQTTLRSGFTFTNPNQTSACGCGESVELKPADL 116


>gi|116252322|ref|YP_768160.1| HesB nitrogen fixation family protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115256970|emb|CAK08064.1| putative HesB nitrogen fixation family protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 130

 Score =  147 bits (372), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 88/113 (77%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I++MT+ A  R+K IV NS   A+G+R+ +KKGGCAG+EY +DLVT+ P   DDLIE+DG
Sbjct: 5   IMSMTDGAAARVKAIVENSGPDAKGVRVGIKKGGCAGMEYTIDLVTE-PNAKDDLIERDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            KVW++ ++ LY+LGTE+ F+T  L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  AKVWVEPSAALYLLGTEMGFETTTLRSGFTFTNPNQTSACGCGESVELKPADL 116


>gi|209549488|ref|YP_002281405.1| FeS assembly scaffold SufA [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209535244|gb|ACI55179.1| FeS assembly scaffold SufA [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 130

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 64/113 (56%), Positives = 89/113 (78%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +++MT+ A  R+K IV NS  +A+G+R+ +KKGGCAG+EY +DLVT+ P   DDLIE+DG
Sbjct: 5   VMSMTDGAAARVKAIVENSGPEAKGVRVGIKKGGCAGMEYTIDLVTE-PNAKDDLIERDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            +VW++ +++LY+LGTE+ F+   L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  ARVWVEPSAVLYLLGTEMGFEQTTLRSGFTFTNPNQTSACGCGESVELKPADL 116


>gi|218463662|ref|ZP_03503753.1| FeS assembly scaffold SufA [Rhizobium etli Kim 5]
          Length = 130

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 64/113 (56%), Positives = 89/113 (78%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +++MT+ A  R+K IV NS  +A+G+R+ +KKGGCAG+EY +DLVT+ P   DDLIE+DG
Sbjct: 5   VMSMTDGAAARVKAIVENSGPEAKGVRVGIKKGGCAGMEYTIDLVTE-PNAKDDLIERDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            +VW++ +++LY+LGTE+ F+   L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  ARVWVEPSAVLYLLGTEMGFEQTTLRSGFTFTNPNQTSACGCGESVELKPADL 116


>gi|218672061|ref|ZP_03521730.1| FeS assembly scaffold SufA [Rhizobium etli GR56]
          Length = 130

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 64/113 (56%), Positives = 89/113 (78%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +++MT+ A  R+K IV NS  +A+G+R+ +KKGGCAG+EY +DLVT+ P   DDLIE+DG
Sbjct: 5   VMSMTDGAAARVKAIVENSGPEAKGVRVGIKKGGCAGMEYTIDLVTE-PNAKDDLIERDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            +VW++ +++LY+LGTE+ F+   L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  ARVWVEPSAVLYLLGTEMGFEQTTLRSGFTFTNPNQTSACGCGESVELKPADL 116


>gi|325293221|ref|YP_004279085.1| iron-sulfur cluster insertion protein [Agrobacterium sp. H13-3]
 gi|325061074|gb|ADY64765.1| putative iron-sulfur cluster insertion protein [Agrobacterium sp.
           H13-3]
          Length = 129

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 88/113 (77%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I+TMT AA  R+K IV NS   A+G+R+ +KKGGCAG+EY +DLVT+     DDL+E DG
Sbjct: 5   IMTMTGAAASRVKAIVENSGPDAKGVRVGIKKGGCAGMEYTIDLVTEADAK-DDLVEFDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            KVW+  +++LY+LGT++DF+  K+ SGF F+NPNQ SACGCG+SVE+K ADL
Sbjct: 64  AKVWVQPSAVLYLLGTQMDFEVTKMRSGFTFNNPNQTSACGCGESVELKPADL 116


>gi|227822096|ref|YP_002826067.1| putative HesB nitrogen fixation family protein [Sinorhizobium
           fredii NGR234]
 gi|227341096|gb|ACP25314.1| putative HesB nitrogen fixation family protein [Sinorhizobium
           fredii NGR234]
          Length = 130

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 65/113 (57%), Positives = 88/113 (77%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++T+AA  R++ IV N++G A+GIR+S+KKGGCAG+EY VDLVTD     DDLIE  G
Sbjct: 5   VMSLTDAAAGRVRSIVENARGDAKGIRLSIKKGGCAGMEYAVDLVTDANAK-DDLIEHQG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            +VW+   ++LY+LGT++DF+   L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  ARVWVAPEAVLYLLGTQMDFEVTALRSGFTFKNPNQTSACGCGESVELKPADL 116


>gi|190891946|ref|YP_001978488.1| hypothetical protein RHECIAT_CH0002356 [Rhizobium etli CIAT 652]
 gi|190697225|gb|ACE91310.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 130

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 63/113 (55%), Positives = 89/113 (78%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +++MT+ A  R+K IV N+  +A+G+R+ +KKGGCAG+EY +DLVT+ P   DDLIE+DG
Sbjct: 5   VMSMTDGAAARVKAIVENAGPEAKGVRVGIKKGGCAGMEYTIDLVTE-PNAKDDLIERDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            +VW++ +++LY+LGTE+ F+   L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  ARVWVEPSAVLYLLGTEMGFEQTTLRSGFTFTNPNQTSACGCGESVELKPADL 116


>gi|15889122|ref|NP_354803.1| hypothetical protein Atu1819 [Agrobacterium tumefaciens str. C58]
 gi|15156930|gb|AAK87588.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 129

 Score =  144 bits (364), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 87/113 (76%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I+TMT AA  R+K IV NS   A G+R+ +KKGGCAG+EY +DLVT+     DDL+E DG
Sbjct: 5   IMTMTGAAASRVKAIVDNSGPGAMGVRVGIKKGGCAGMEYTIDLVTEADAK-DDLVEFDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            KVW+  +++LY+LGT++DF+  K+ SGF F+NPNQ SACGCG+SVE+K ADL
Sbjct: 64  AKVWVQPSAVLYLLGTQMDFEVTKMRSGFTFNNPNQTSACGCGESVELKPADL 116


>gi|222086098|ref|YP_002544630.1| FeS assembly scaffold SufA [Agrobacterium radiobacter K84]
 gi|221723546|gb|ACM26702.1| FeS assembly scaffold SufA [Agrobacterium radiobacter K84]
          Length = 129

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 86/112 (76%), Gaps = 1/112 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMTE A  R+K IV NS   A+G+R+ +KKGGCAG+EY +DLV + P   DDLIE +G
Sbjct: 5   VITMTETAAARVKAIVENSGPDAKGVRVGIKKGGCAGMEYTIDLVIE-PNAKDDLIEYNG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            KVW++ +++LY+LGT++ F+T  L SGF F NPNQ SACGCG+SVE+K AD
Sbjct: 64  AKVWVEPSAVLYLLGTQMGFETTTLRSGFTFTNPNQTSACGCGESVELKPAD 115


>gi|163759510|ref|ZP_02166595.1| hypothetical protein HPDFL43_09162 [Hoeflea phototrophica DFL-43]
 gi|162283107|gb|EDQ33393.1| hypothetical protein HPDFL43_09162 [Hoeflea phototrophica DFL-43]
          Length = 130

 Score =  141 bits (356), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/114 (58%), Positives = 90/114 (78%), Gaps = 4/114 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKD 62
           ++T+T AA  R+K IV N +G A+GIR+S+KKGGCAG+EY +DL T+ NP   DD IE+D
Sbjct: 6   VMTLTPAAAERVKTIVRNEEG-AEGIRVSIKKGGCAGMEYAIDLATEINP--KDDRIERD 62

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           G  V++   ++LY+LGTE+D++  KL SGFVF+NPNQ SACGCG+SVE+K ADL
Sbjct: 63  GAAVFVAPEAVLYLLGTEMDYEVTKLRSGFVFNNPNQTSACGCGESVELKPADL 116


>gi|86357862|ref|YP_469754.1| hypothetical protein RHE_CH02247 [Rhizobium etli CFN 42]
 gi|86281964|gb|ABC91027.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 130

 Score =  141 bits (355), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 62/109 (56%), Positives = 85/109 (77%), Gaps = 1/109 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +++MTE A  R+K IV NS  + +G+R+ +KKGGCAG+EY +DLVT+ P   DDLIE+DG
Sbjct: 5   VMSMTEGAAARVKAIVENSGPETKGVRVGIKKGGCAGMEYTIDLVTE-PNAKDDLIERDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
            KVW++ +++LY+LGTE+ F+   L SGF F NPNQ SACGCG+SVE+K
Sbjct: 64  AKVWVEPSAVLYLLGTEMGFEQTTLRSGFTFTNPNQTSACGCGESVELK 112


>gi|110634127|ref|YP_674335.1| FeS assembly scaffold SufA [Mesorhizobium sp. BNC1]
 gi|110285111|gb|ABG63170.1| FeS assembly scaffold SufA [Chelativorans sp. BNC1]
          Length = 128

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 64/113 (56%), Positives = 89/113 (78%), Gaps = 2/113 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMT+AA  R++EIV   +G A GIR+ +KKGGCAG+EY +DLVT+ P   DD IE+DG
Sbjct: 6   VMTMTDAAAARVREIVETREG-AHGIRVGIKKGGCAGMEYTIDLVTE-PNPKDDHIERDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           V V++   + L++LGTE+DF+  ++ +GFVF+NPNQ SACGCG+SVE+K ADL
Sbjct: 64  VHVYVAPEAALFLLGTEMDFEVTRIRTGFVFNNPNQSSACGCGESVELKPADL 116


>gi|260460853|ref|ZP_05809103.1| FeS assembly scaffold SufA [Mesorhizobium opportunistum WSM2075]
 gi|259033430|gb|EEW34691.1| FeS assembly scaffold SufA [Mesorhizobium opportunistum WSM2075]
          Length = 126

 Score =  137 bits (345), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 63/113 (55%), Positives = 83/113 (73%), Gaps = 2/113 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMTE A  R++EIV   +  A GIR+ +KKGGCAG+EY VDLVT+ P   DD IE+DG
Sbjct: 6   VITMTEKAADRVREIVATRE-NAHGIRLGIKKGGCAGMEYTVDLVTE-PNTKDDHIERDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
             V++   + L++ GTE+DF+   L +GF FHNPNQ SACGCG+SVE+K ADL
Sbjct: 64  AHVYVAPEAALFLFGTEMDFEQTTLRTGFTFHNPNQSSACGCGESVELKPADL 116


>gi|319784068|ref|YP_004143544.1| FeS assembly scaffold SufA [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169956|gb|ADV13494.1| FeS assembly scaffold SufA [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 126

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 63/113 (55%), Positives = 84/113 (74%), Gaps = 2/113 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMTE A  R++EIV  ++  A GIR+ +KKGGCAG+EY VDLVT+ P   DD IE+DG
Sbjct: 6   VITMTEKAADRVREIV-ATRDNAHGIRLGIKKGGCAGMEYTVDLVTE-PNTKDDHIERDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
             V++   + L++ GTE+DF+   L +GF FHNPNQ SACGCG+SVE+K ADL
Sbjct: 64  AHVYVAPEAALFLFGTEMDFEQTTLRTGFTFHNPNQSSACGCGESVELKPADL 116


>gi|13470348|ref|NP_101914.1| HesB-like protein [Mesorhizobium loti MAFF303099]
 gi|14021087|dbj|BAB47700.1| HesB-like protein [Mesorhizobium loti MAFF303099]
          Length = 144

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 63/113 (55%), Positives = 83/113 (73%), Gaps = 2/113 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMTE A  R++EIV   +  A GIR+ +KKGGCAG+EY VDLVT+ P   DD IE+DG
Sbjct: 24  VITMTEKAADRVREIVATRE-NAHGIRLGIKKGGCAGMEYTVDLVTE-PNTKDDHIERDG 81

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
             V++   + L++ GTE+DF+   L +GF FHNPNQ SACGCG+SVE+K ADL
Sbjct: 82  AHVYVAPEAALFLFGTEMDFEQTTLRTGFTFHNPNQSSACGCGESVELKPADL 134


>gi|254719037|ref|ZP_05180848.1| hesb protein [Brucella sp. 83/13]
 gi|265984027|ref|ZP_06096762.1| Fe-S assembly scaffold SufA [Brucella sp. 83/13]
 gi|306840075|ref|ZP_07472861.1| FeS assembly scaffold SufA [Brucella sp. NF 2653]
 gi|264662619|gb|EEZ32880.1| Fe-S assembly scaffold SufA [Brucella sp. 83/13]
 gi|306404803|gb|EFM61096.1| FeS assembly scaffold SufA [Brucella sp. NF 2653]
          Length = 126

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 63/111 (56%), Positives = 88/111 (79%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  R++EI+  S+  A GIRI +KKGGCAG+EY ++LVT+    GDDLIEKDG
Sbjct: 6   VITLTDAAANRVREIM-TSREDALGIRIGVKKGGCAGMEYTIELVTEAKA-GDDLIEKDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            KV+I   ++L++LGT++DF+   L +GFVF+NPNQ SACGCG+SVE+K A
Sbjct: 64  AKVFIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVELKPA 114


>gi|306840452|ref|ZP_07473212.1| FeS assembly scaffold SufA [Brucella sp. BO2]
 gi|306289586|gb|EFM60801.1| FeS assembly scaffold SufA [Brucella sp. BO2]
          Length = 126

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 88/111 (79%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  R++EI+  S+  A GIR+ +KKGGCAG+EY ++LVT+    GDDLIEKDG
Sbjct: 6   VITLTDAAANRVREIM-TSREDALGIRVGVKKGGCAGMEYTIELVTEAKA-GDDLIEKDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            KV+I   ++L++LGT++DF+   L +GFVF+NPNQ SACGCG+SVE+K A
Sbjct: 64  AKVFIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVELKPA 114


>gi|189024122|ref|YP_001934890.1| HESB protein [Brucella abortus S19]
 gi|189019694|gb|ACD72416.1| HESB protein [Brucella abortus S19]
          Length = 155

 Score =  133 bits (334), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 87/111 (78%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  R+ EI+  S+  A GIR+ +KKGGCAG+EY ++LVT+    GDDLIEKDG
Sbjct: 35  VITLTDAAANRVHEIM-TSREDALGIRVGVKKGGCAGMEYTIELVTEAKA-GDDLIEKDG 92

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            KV+I   ++L++LGT++DF+   L +GFVF+NPNQ SACGCG+SVE+K A
Sbjct: 93  AKVFIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVELKPA 143


>gi|118589102|ref|ZP_01546509.1| hypothetical protein SIAM614_13658 [Stappia aggregata IAM 12614]
 gi|118438431|gb|EAV45065.1| hypothetical protein SIAM614_13658 [Stappia aggregata IAM 12614]
          Length = 125

 Score =  133 bits (334), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 87/113 (76%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  R+KE+V NS   A G+R+ +KKGGCAG+EY +++V D    GDD +E  G
Sbjct: 9   VMTLTDAAAERVKELVENSDKNAIGLRVGIKKGGCAGMEYTMEMV-DAARPGDDTVEDKG 67

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            K+++D +++L++LGTE+DF+  K  SGF+F NPN+VSACGCG+SV ++ ADL
Sbjct: 68  AKLFVDPSAVLFLLGTEMDFEVTKFRSGFIFKNPNEVSACGCGESVSLQAADL 120


>gi|23501823|ref|NP_697950.1| HesB/YadR/YfhF family protein [Brucella suis 1330]
 gi|62289880|ref|YP_221673.1| HesB/YadR/YfhF family protein [Brucella abortus bv. 1 str. 9-941]
 gi|82699807|ref|YP_414381.1| hypothetical protein BAB1_0956 [Brucella melitensis biovar Abortus
           2308]
 gi|163843208|ref|YP_001627612.1| FeS assembly scaffold SufA [Brucella suis ATCC 23445]
 gi|225852450|ref|YP_002732683.1| FeS assembly scaffold SufA [Brucella melitensis ATCC 23457]
 gi|254689183|ref|ZP_05152437.1| hesb protein [Brucella abortus bv. 6 str. 870]
 gi|254693666|ref|ZP_05155494.1| hesb protein [Brucella abortus bv. 3 str. Tulya]
 gi|254697320|ref|ZP_05159148.1| hesb protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254706856|ref|ZP_05168684.1| hesb protein [Brucella pinnipedialis M163/99/10]
 gi|254710036|ref|ZP_05171847.1| hesb protein [Brucella pinnipedialis B2/94]
 gi|254714038|ref|ZP_05175849.1| hesb protein [Brucella ceti M644/93/1]
 gi|254716904|ref|ZP_05178715.1| hesb protein [Brucella ceti M13/05/1]
 gi|254730217|ref|ZP_05188795.1| hesb protein [Brucella abortus bv. 4 str. 292]
 gi|256031531|ref|ZP_05445145.1| hesb protein [Brucella pinnipedialis M292/94/1]
 gi|256044607|ref|ZP_05447511.1| hesb protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061040|ref|ZP_05451196.1| hesb protein [Brucella neotomae 5K33]
 gi|256113487|ref|ZP_05454321.1| hesb protein [Brucella melitensis bv. 3 str. Ether]
 gi|256159666|ref|ZP_05457419.1| hesb protein [Brucella ceti M490/95/1]
 gi|256254935|ref|ZP_05460471.1| hesb protein [Brucella ceti B1/94]
 gi|256257433|ref|ZP_05462969.1| hesb protein [Brucella abortus bv. 9 str. C68]
 gi|256264056|ref|ZP_05466588.1| HESB protein [Brucella melitensis bv. 2 str. 63/9]
 gi|256369365|ref|YP_003106873.1| HesB/YadR/YfhF family protein [Brucella microti CCM 4915]
 gi|260168663|ref|ZP_05755474.1| hesb protein [Brucella sp. F5/99]
 gi|260545376|ref|ZP_05821117.1| HESB protein [Brucella abortus NCTC 8038]
 gi|260563959|ref|ZP_05834445.1| HesB protein [Brucella melitensis bv. 1 str. 16M]
 gi|260754682|ref|ZP_05867030.1| FeS assembly scaffold SufA [Brucella abortus bv. 6 str. 870]
 gi|260757906|ref|ZP_05870254.1| FeS assembly scaffold SufA [Brucella abortus bv. 4 str. 292]
 gi|260761728|ref|ZP_05874071.1| FeS assembly scaffold SufA [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883708|ref|ZP_05895322.1| FeS assembly scaffold SufA [Brucella abortus bv. 9 str. C68]
 gi|261213933|ref|ZP_05928214.1| FeS assembly scaffold SufA [Brucella abortus bv. 3 str. Tulya]
 gi|261218711|ref|ZP_05932992.1| Fe-S assembly scaffold SufA [Brucella ceti M13/05/1]
 gi|261222117|ref|ZP_05936398.1| FeS assembly scaffold SufA [Brucella ceti B1/94]
 gi|261314320|ref|ZP_05953517.1| FeS assembly scaffold SufA [Brucella pinnipedialis M163/99/10]
 gi|261317583|ref|ZP_05956780.1| Fe-S assembly scaffold SufA [Brucella pinnipedialis B2/94]
 gi|261321791|ref|ZP_05960988.1| Fe-S assembly scaffold SufA [Brucella ceti M644/93/1]
 gi|261325039|ref|ZP_05964236.1| FeS assembly scaffold SufA [Brucella neotomae 5K33]
 gi|261758137|ref|ZP_06001846.1| HESB protein [Brucella sp. F5/99]
 gi|265988617|ref|ZP_06101174.1| FeS assembly scaffold SufA [Brucella pinnipedialis M292/94/1]
 gi|265991031|ref|ZP_06103588.1| FeS assembly scaffold SufA [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994868|ref|ZP_06107425.1| FeS assembly scaffold SufA [Brucella melitensis bv. 3 str. Ether]
 gi|265998082|ref|ZP_06110639.1| FeS assembly scaffold SufA [Brucella ceti M490/95/1]
 gi|294852293|ref|ZP_06792966.1| FeS assembly scaffold SufA [Brucella sp. NVSL 07-0026]
 gi|23347757|gb|AAN29865.1| HesB/YadR/YfhF family protein [Brucella suis 1330]
 gi|62196012|gb|AAX74312.1| HesB/YadR/YfhF family protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615908|emb|CAJ10912.1| Protein of unknown function, HesB/YadR/YfhF [Brucella melitensis
           biovar Abortus 2308]
 gi|163673931|gb|ABY38042.1| FeS assembly scaffold SufA [Brucella suis ATCC 23445]
 gi|225640815|gb|ACO00729.1| FeS assembly scaffold SufA [Brucella melitensis ATCC 23457]
 gi|255999525|gb|ACU47924.1| HesB/YadR/YfhF family protein [Brucella microti CCM 4915]
 gi|260096783|gb|EEW80658.1| HESB protein [Brucella abortus NCTC 8038]
 gi|260153975|gb|EEW89067.1| HesB protein [Brucella melitensis bv. 1 str. 16M]
 gi|260668224|gb|EEX55164.1| FeS assembly scaffold SufA [Brucella abortus bv. 4 str. 292]
 gi|260672160|gb|EEX58981.1| FeS assembly scaffold SufA [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674790|gb|EEX61611.1| FeS assembly scaffold SufA [Brucella abortus bv. 6 str. 870]
 gi|260873236|gb|EEX80305.1| FeS assembly scaffold SufA [Brucella abortus bv. 9 str. C68]
 gi|260915540|gb|EEX82401.1| FeS assembly scaffold SufA [Brucella abortus bv. 3 str. Tulya]
 gi|260920701|gb|EEX87354.1| FeS assembly scaffold SufA [Brucella ceti B1/94]
 gi|260923800|gb|EEX90368.1| Fe-S assembly scaffold SufA [Brucella ceti M13/05/1]
 gi|261294481|gb|EEX97977.1| Fe-S assembly scaffold SufA [Brucella ceti M644/93/1]
 gi|261296806|gb|EEY00303.1| Fe-S assembly scaffold SufA [Brucella pinnipedialis B2/94]
 gi|261301019|gb|EEY04516.1| FeS assembly scaffold SufA [Brucella neotomae 5K33]
 gi|261303346|gb|EEY06843.1| FeS assembly scaffold SufA [Brucella pinnipedialis M163/99/10]
 gi|261738121|gb|EEY26117.1| HESB protein [Brucella sp. F5/99]
 gi|262552550|gb|EEZ08540.1| FeS assembly scaffold SufA [Brucella ceti M490/95/1]
 gi|262765981|gb|EEZ11770.1| FeS assembly scaffold SufA [Brucella melitensis bv. 3 str. Ether]
 gi|263001815|gb|EEZ14390.1| FeS assembly scaffold SufA [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094244|gb|EEZ18121.1| HESB protein [Brucella melitensis bv. 2 str. 63/9]
 gi|264660814|gb|EEZ31075.1| FeS assembly scaffold SufA [Brucella pinnipedialis M292/94/1]
 gi|294820882|gb|EFG37881.1| FeS assembly scaffold SufA [Brucella sp. NVSL 07-0026]
 gi|326408964|gb|ADZ66029.1| HESB protein [Brucella melitensis M28]
 gi|326538678|gb|ADZ86893.1| FeS assembly scaffold SufA [Brucella melitensis M5-90]
          Length = 126

 Score =  133 bits (334), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 87/111 (78%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  R+ EI+  S+  A GIR+ +KKGGCAG+EY ++LVT+    GDDLIEKDG
Sbjct: 6   VITLTDAAANRVHEIM-TSREDALGIRVGVKKGGCAGMEYTIELVTEAKA-GDDLIEKDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            KV+I   ++L++LGT++DF+   L +GFVF+NPNQ SACGCG+SVE+K A
Sbjct: 64  AKVFIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVELKPA 114


>gi|260566510|ref|ZP_05836980.1| HESB protein [Brucella suis bv. 4 str. 40]
 gi|260156028|gb|EEW91108.1| HESB protein [Brucella suis bv. 4 str. 40]
          Length = 149

 Score =  133 bits (334), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 87/111 (78%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  R+ EI+  S+  A GIR+ +KKGGCAG+EY ++LVT+    GDDLIEKDG
Sbjct: 35  VITLTDAAANRVHEIM-TSREDALGIRVGVKKGGCAGMEYTIELVTEAKA-GDDLIEKDG 92

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            KV+I   ++L++LGT++DF+   L +GFVF+NPNQ SACGCG+SVE+K A
Sbjct: 93  AKVFIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVELKPA 143


>gi|239831818|ref|ZP_04680147.1| FeS assembly scaffold SufA [Ochrobactrum intermedium LMG 3301]
 gi|239824085|gb|EEQ95653.1| FeS assembly scaffold SufA [Ochrobactrum intermedium LMG 3301]
          Length = 155

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 87/111 (78%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+ A  R++EI+ +  G A GIR+ +KKGGCAG+EY +DLVT+    GDD+IEKDG
Sbjct: 35  VMTLTDKAADRVREIIASRDG-ALGIRVGVKKGGCAGMEYTIDLVTEAKA-GDDVIEKDG 92

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            +V+I   ++L++LGT++DF+   L +GFVF+NPNQ SACGCG+SVEIK A
Sbjct: 93  ARVYIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVEIKAA 143


>gi|17987317|ref|NP_539951.1| HESB protein [Brucella melitensis bv. 1 str. 16M]
 gi|17982998|gb|AAL52215.1| hesb protein [Brucella melitensis bv. 1 str. 16M]
          Length = 147

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 87/111 (78%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  R+ EI+  S+  A GIR+ +KKGGCAG+EY ++LVT+    GDDLIEKDG
Sbjct: 27  VITLTDAAANRVHEIM-TSREDALGIRVGVKKGGCAGMEYTIELVTEAKA-GDDLIEKDG 84

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            KV+I   ++L++LGT++DF+   L +GFVF+NPNQ SACGCG+SVE+K A
Sbjct: 85  AKVFIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVELKPA 135


>gi|225627425|ref|ZP_03785462.1| FeS assembly scaffold SufA [Brucella ceti str. Cudo]
 gi|237815374|ref|ZP_04594372.1| FeS assembly scaffold SufA [Brucella abortus str. 2308 A]
 gi|297248282|ref|ZP_06932000.1| hesb protein [Brucella abortus bv. 5 str. B3196]
 gi|225617430|gb|EEH14475.1| FeS assembly scaffold SufA [Brucella ceti str. Cudo]
 gi|237790211|gb|EEP64421.1| FeS assembly scaffold SufA [Brucella abortus str. 2308 A]
 gi|297175451|gb|EFH34798.1| hesb protein [Brucella abortus bv. 5 str. B3196]
          Length = 168

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 87/111 (78%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  R+ EI+  S+  A GIR+ +KKGGCAG+EY ++LVT+    GDDLIEKDG
Sbjct: 48  VITLTDAAANRVHEIM-TSREDALGIRVGVKKGGCAGMEYTIELVTEAKA-GDDLIEKDG 105

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            KV+I   ++L++LGT++DF+   L +GFVF+NPNQ SACGCG+SVE+K A
Sbjct: 106 AKVFIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVELKPA 156


>gi|148560346|ref|YP_001258912.1| hesb protein [Brucella ovis ATCC 25840]
 gi|148371603|gb|ABQ61582.1| hesb protein [Brucella ovis ATCC 25840]
          Length = 168

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 87/111 (78%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  R+ EI+  S+  A GIR+ +KKGGCAG+EY ++LVT+    GDDLIEKDG
Sbjct: 48  VITLTDAAANRVHEIM-TSREDALGIRVGVKKGGCAGMEYTIELVTEAKA-GDDLIEKDG 105

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            KV+I   ++L++LGT++DF+   L +GFVF+NPNQ SACGCG+SVE+K A
Sbjct: 106 AKVFIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVELKPA 156


>gi|161618895|ref|YP_001592782.1| FeS assembly scaffold SufA [Brucella canis ATCC 23365]
 gi|161335706|gb|ABX62011.1| FeS assembly scaffold SufA [Brucella canis ATCC 23365]
          Length = 162

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 87/111 (78%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  R+ EI+  S+  A GIR+ +KKGGCAG+EY ++LVT+    GDDLIEKDG
Sbjct: 48  VITLTDAAANRVHEIM-TSREDALGIRVGVKKGGCAGMEYTIELVTEAKA-GDDLIEKDG 105

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            KV+I   ++L++LGT++DF+   L +GFVF+NPNQ SACGCG+SVE+K A
Sbjct: 106 AKVFIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVELKPA 156


>gi|307946854|ref|ZP_07662189.1| FeS assembly scaffold SufA [Roseibium sp. TrichSKD4]
 gi|307770518|gb|EFO29744.1| FeS assembly scaffold SufA [Roseibium sp. TrichSKD4]
          Length = 122

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 59/112 (52%), Positives = 86/112 (76%), Gaps = 1/112 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TEAA  R+KE+V NS   A G+R+ +KKGGCAG+EY +DLV +    GDD+I+  G
Sbjct: 6   VMTLTEAAAERVKELVDNSDKNALGLRVGIKKGGCAGMEYTMDLVEEAQA-GDDVIDDKG 64

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            K+++D +++L++LGTE+DF+  K  SGFVF NPN+ SACGCG+SV ++ AD
Sbjct: 65  AKLFVDPSAVLFLLGTEMDFEVTKFRSGFVFKNPNETSACGCGESVALQAAD 116


>gi|254701700|ref|ZP_05163528.1| hesb protein [Brucella suis bv. 5 str. 513]
 gi|261752250|ref|ZP_05995959.1| FeS assembly scaffold SufA [Brucella suis bv. 5 str. 513]
 gi|261742003|gb|EEY29929.1| FeS assembly scaffold SufA [Brucella suis bv. 5 str. 513]
          Length = 126

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 87/111 (78%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  R+ EI+  S+  A GIR+ +KKGGCAG+EY ++LVT+    GDDLIEKDG
Sbjct: 6   VITLTDAAANRVHEIM-TSREDALGIRVGVKKGGCAGMEYTIELVTEAKA-GDDLIEKDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            KV+I   ++L++LGT++DF+   L +GFVF+NPNQ SACGCG+SVE+K A
Sbjct: 64  AKVFIAPEAVLFLLGTQMDFEVTMLRTGFVFNNPNQTSACGCGESVELKPA 114


>gi|254704243|ref|ZP_05166071.1| hesb protein [Brucella suis bv. 3 str. 686]
 gi|261754909|ref|ZP_05998618.1| FeS assembly scaffold SufA [Brucella suis bv. 3 str. 686]
 gi|261744662|gb|EEY32588.1| FeS assembly scaffold SufA [Brucella suis bv. 3 str. 686]
          Length = 120

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 86/111 (77%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  R+ EI+  S+  A GIR+ +KKGGCAG+EY ++L T+    GDDLIEKDG
Sbjct: 6   VITLTDAAANRVHEIM-TSREDALGIRVGVKKGGCAGMEYTIELATEAKA-GDDLIEKDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            KV+I   ++L++LGT++DF+   L +GFVF+NPNQ SACGCG+SVE+K A
Sbjct: 64  AKVFIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVELKPA 114


>gi|306843835|ref|ZP_07476432.1| FeS assembly scaffold SufA [Brucella sp. BO1]
 gi|306275836|gb|EFM57556.1| FeS assembly scaffold SufA [Brucella sp. BO1]
          Length = 126

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 87/111 (78%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  R++EI+  S+  A GIR+ +KKGGCAG+EY ++LVT+    GDDLIEKD 
Sbjct: 6   VITLTDAAANRVREIM-TSREDALGIRVGVKKGGCAGMEYTIELVTEAKA-GDDLIEKDD 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            KV+I   ++L++LGT++DF+   L +GFVF+NPNQ SACGCG+SVE+K A
Sbjct: 64  AKVFIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVELKPA 114


>gi|254503725|ref|ZP_05115876.1| FeS assembly scaffold SufA [Labrenzia alexandrii DFL-11]
 gi|222439796|gb|EEE46475.1| FeS assembly scaffold SufA [Labrenzia alexandrii DFL-11]
          Length = 117

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 59/112 (52%), Positives = 86/112 (76%), Gaps = 1/112 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA  R+ E+V N+   A G+R+ +KKGGCAG+EY +DLV +    GDD+IE  G 
Sbjct: 1   MTLTDAAAERVCELVDNADKPALGLRVGIKKGGCAGMEYAMDLV-EEASPGDDVIEDKGA 59

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           K+++D +++L++LGTE+DF+  K  SGFVF NPN+VSACGCG+SV ++ ADL
Sbjct: 60  KIFVDPSAVLFLLGTEMDFEVTKFRSGFVFKNPNEVSACGCGESVSLQAADL 111


>gi|114704645|ref|ZP_01437553.1| hypothetical protein FP2506_06911 [Fulvimarina pelagi HTCC2506]
 gi|114539430|gb|EAU42550.1| hypothetical protein FP2506_06911 [Fulvimarina pelagi HTCC2506]
          Length = 151

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 88/113 (77%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++T+AA  R++ I+ N+   A G+R+ +KKGGCAG+EY V+L  D+  + +D++EKDG
Sbjct: 30  VLSITDAAASRVQAILDNAAADALGVRVGVKKGGCAGMEYTVELAKDHR-ENEDVVEKDG 88

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            +V+I   ++L++LGTE+D++   L SGFVF+NPNQ SACGCG+SVE+K ADL
Sbjct: 89  ARVYIAPEAVLFLLGTEMDYEETVLRSGFVFNNPNQTSACGCGESVELKAADL 141


>gi|153009577|ref|YP_001370792.1| FeS assembly scaffold SufA [Ochrobactrum anthropi ATCC 49188]
 gi|151561465|gb|ABS14963.1| FeS assembly scaffold SufA [Ochrobactrum anthropi ATCC 49188]
          Length = 126

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 86/111 (77%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+ A  R++EI+ +  G A GIR+ +KKGGCAG+EY +DLVT+    GDD+IEKD 
Sbjct: 6   VITLTDKAADRVREIIASRDG-ALGIRVGVKKGGCAGMEYTIDLVTEAKA-GDDVIEKDD 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            +V+I   ++L++LGT++DF+   L +GFVF+NPNQ SACGCG+SVEIK A
Sbjct: 64  ARVFIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVEIKAA 114


>gi|90417686|ref|ZP_01225598.1| iron-sulfur cluster assembly accessory protein [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337358|gb|EAS51009.1| iron-sulfur cluster assembly accessory protein [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 125

 Score =  130 bits (326), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 85/114 (74%), Gaps = 3/114 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKD 62
           +++MT+AA  R+K I  +    A G+R+ +KKGGCAG+EY +DL T+ NP   +D+IEKD
Sbjct: 6   VMSMTDAAAERVKAITSSKGEDALGLRVGIKKGGCAGMEYTIDLATEANP--NEDMIEKD 63

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           G +V +   ++L++LGTE+D++   L SGF F NPNQ SACGCG+SVE+K+ADL
Sbjct: 64  GARVLVAPEAVLFLLGTEMDYEETVLRSGFTFRNPNQTSACGCGESVELKQADL 117


>gi|254469524|ref|ZP_05082929.1| FeS assembly scaffold SufA [Pseudovibrio sp. JE062]
 gi|211961359|gb|EEA96554.1| FeS assembly scaffold SufA [Pseudovibrio sp. JE062]
          Length = 125

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 83/113 (73%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I+ ++  S     G+R+S+K GGCAG+EY +DLVT+    GDD++E  G
Sbjct: 7   VLQLTEEAAEHIRTLLEASDADPLGLRVSIKSGGCAGMEYELDLVTEAK-SGDDVVEDKG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           VKV++D A+ LY+LGTE+ F+T K  SGF F NPN+VSACGCG+SVE++ ADL
Sbjct: 66  VKVFVDPAATLYLLGTEMGFETTKFRSGFTFKNPNEVSACGCGESVELQAADL 118


>gi|328543976|ref|YP_004304085.1| HesB-like protein [polymorphum gilvum SL003B-26A1]
 gi|326413720|gb|ADZ70783.1| HesB-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 125

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 85/112 (75%), Gaps = 1/112 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  R+++++ N+     G+R+ +KKGGCAG+EY + LV +     DD+I+  G
Sbjct: 9   VMTLTKAAAERVRDLIDNADRAVLGLRVGIKKGGCAGMEYTMSLV-EQADPRDDVIDDQG 67

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            ++++D +++L++LGTE+DF+T K  SGFVF NPN+VSACGCG+SV +K AD
Sbjct: 68  ARIYVDPSAVLFLLGTEMDFETTKFRSGFVFRNPNEVSACGCGESVSLKPAD 119


>gi|312115591|ref|YP_004013187.1| iron-sulfur cluster assembly accessory protein [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311220720|gb|ADP72088.1| iron-sulfur cluster assembly accessory protein [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 122

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 84/113 (74%), Gaps = 3/113 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKD 62
           +VT+T++A  R+K I+  S+    G+R+ +KKGGCAG+EY ++   +  P++  +++E  
Sbjct: 8   VVTLTDSAAERVKAIIGRSETPVVGLRVGIKKGGCAGMEYTMEYAAEARPLE--EVVEDK 65

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           GV++ I+ +++LY+LGTE+D+KTEK  SGFVF NPNQ SACGCG+SVE+  A 
Sbjct: 66  GVRILIEPSAILYLLGTEMDYKTEKFVSGFVFKNPNQTSACGCGESVELSPAQ 118


>gi|304391542|ref|ZP_07373484.1| FeS assembly scaffold SufA [Ahrensia sp. R2A130]
 gi|303295771|gb|EFL90129.1| FeS assembly scaffold SufA [Ahrensia sp. R2A130]
          Length = 122

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 81/111 (72%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA+ R+ EIV N+   A+GIRI +K GGCAG+EY VDLVT  P  GDD I    
Sbjct: 6   VITLTDAAISRVDEIVANAD-DAKGIRIGVKNGGCAGMEYTVDLVT-APEAGDDAIPAGD 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
             V+I   ++L++LGT++DF+  KL SGFVF+NPNQ SACGCG+SV +  A
Sbjct: 64  NTVFIAPQAVLFLLGTQMDFEVTKLRSGFVFNNPNQTSACGCGESVTLIAA 114


>gi|170742453|ref|YP_001771108.1| FeS assembly scaffold SufA [Methylobacterium sp. 4-46]
 gi|168196727|gb|ACA18674.1| FeS assembly scaffold SufA [Methylobacterium sp. 4-46]
          Length = 126

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 80/111 (72%), Gaps = 1/111 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++TEAA  R++ I+ ++     GIR+ +K GGCAG+ Y ++   +    G+D++E  G
Sbjct: 7   VMSLTEAAAERVRRIIADADRPIAGIRVGVKNGGCAGMSYTMEYAEER-RPGEDVVEDRG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           V+V+ID  ++L++LGTE+DF+T KL S FVFHNPNQ SACGCG+SV I  A
Sbjct: 66  VRVFIDPKAVLFLLGTEMDFQTTKLSSQFVFHNPNQTSACGCGESVAITPA 116


>gi|323136300|ref|ZP_08071382.1| iron-sulfur cluster assembly accessory protein [Methylocystis sp.
           ATCC 49242]
 gi|322398374|gb|EFY00894.1| iron-sulfur cluster assembly accessory protein [Methylocystis sp.
           ATCC 49242]
          Length = 125

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 83/113 (73%), Gaps = 3/113 (2%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++T++ AAV R++ ++ N+   A G+R+S++KGGCAG+ Y +++    P  GD++IE D
Sbjct: 7   SVMTVSPAAVERVRGLLANASAGA-GLRVSVEKGGCAGMSYKMEIA--EPQKGDEVIETD 63

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           G +V +D+ ++LY+LGT +D KT +  S FVF NPNQ SACGCG+SVE+K AD
Sbjct: 64  GARVIVDAKAVLYLLGTTMDVKTTQFASTFVFENPNQTSACGCGESVELKPAD 116


>gi|254456455|ref|ZP_05069884.1| HesB protein [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083457|gb|EDZ60883.1| HesB protein [Candidatus Pelagibacter sp. HTCC7211]
          Length = 111

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 86/113 (76%), Gaps = 3/113 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLI 59
           M+ I+ +++ A  RIKEI+ N++  + G+R+S+K GGCAG+ Y+++   + NP   D++I
Sbjct: 1   MNPIIKLSDNAALRIKEIMSNAEKDSLGVRVSVKTGGCAGMSYVMEYTKEANP--NDEVI 58

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           E  GVKV++DSA+++Y+LGTE+D+K E+L S FVF+NPN+   CGCG+S +I+
Sbjct: 59  EDKGVKVFVDSAAVMYLLGTEMDYKKEELSSSFVFNNPNETERCGCGESFKIE 111


>gi|49475511|ref|YP_033552.1| hypothetical protein BH07400 [Bartonella henselae str. Houston-1]
 gi|49238317|emb|CAF27541.1| hypothetical protein BH07400 [Bartonella henselae str. Houston-1]
          Length = 125

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 84/111 (75%), Gaps = 3/111 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +V +TEAAV R+KEI+  +   A+GI I +KKGGCAG+EY + LV +  +D D ++E +G
Sbjct: 6   VVNLTEAAVDRVKEIM--NTKDARGILIGIKKGGCAGMEYTITLVKEEILDAD-VVEFNG 62

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            +V+I   ++L++LGT++D++   L SGFVF NPNQVSACGCG+SVE++ A
Sbjct: 63  ARVFIAHDAVLFLLGTQVDYEVTTLRSGFVFKNPNQVSACGCGESVELRPA 113


>gi|220923249|ref|YP_002498551.1| FeS assembly scaffold SufA [Methylobacterium nodulans ORS 2060]
 gi|219947856|gb|ACL58248.1| FeS assembly scaffold SufA [Methylobacterium nodulans ORS 2060]
          Length = 126

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 79/111 (71%), Gaps = 1/111 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TEAA  RIK I+  +     G+R+ +K GGCAG+ Y ++   +    G+D++E  G
Sbjct: 7   VMTLTEAAADRIKRIIAEADRPIAGVRVGVKNGGCAGMSYTMEYAEEQ-RPGEDVVEDRG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           V+V++D  ++L++LGTE+DF+T KL S FVF+NPNQ SACGCG+SV I  A
Sbjct: 66  VRVFVDPKAVLFLLGTEMDFQTTKLASQFVFNNPNQTSACGCGESVAITPA 116


>gi|296445842|ref|ZP_06887794.1| iron-sulfur cluster assembly accessory protein [Methylosinus
           trichosporium OB3b]
 gi|296256670|gb|EFH03745.1| iron-sulfur cluster assembly accessory protein [Methylosinus
           trichosporium OB3b]
          Length = 122

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 79/112 (70%), Gaps = 2/112 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+++AA  R++ ++   +  + G+RISL+K GCAG+ Y ++L    P  GD++IE+ G
Sbjct: 3   VMTLSDAAAERVRGLLAGHENPSAGLRISLEKSGCAGMAYKMELAA--PAPGDEVIEEKG 60

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            +V +D A++LY+LGT +D +T    S FVF NPNQ SACGCG+SVE+  A+
Sbjct: 61  ARVIVDGAAVLYLLGTRMDVETSMFSSSFVFQNPNQTSACGCGESVELHPAE 112


>gi|319899008|ref|YP_004159101.1| hypothetical protein BARCL_0844 [Bartonella clarridgeiae 73]
 gi|319402972|emb|CBI76525.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 125

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 82/109 (75%), Gaps = 3/109 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I+++TE+A+ RIK I+      A GI + +KKGGCAG+EY + LVT+   D D ++E DG
Sbjct: 6   IISLTESAIDRIKVIM--ETKNAHGILVGIKKGGCAGMEYTIALVTEEMHDAD-VVEVDG 62

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
            +V+I   ++L++LGT++D++   L SGFVF+NPNQVSACGCG+SVEI+
Sbjct: 63  ARVFIARDAVLFLLGTQMDYEVTTLRSGFVFNNPNQVSACGCGESVEIR 111


>gi|158425233|ref|YP_001526525.1| HesB protein [Azorhizobium caulinodans ORS 571]
 gi|158332122|dbj|BAF89607.1| HesB protein [Azorhizobium caulinodans ORS 571]
          Length = 142

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 79/111 (71%), Gaps = 1/111 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TEAA  R+++I+  +      +R+ +K GGCAG+ Y +D  T+  +  D+++E  G
Sbjct: 26  VMRITEAAAARVRQIMARTDPPPVAVRVGVKNGGCAGMSYTMDYATEI-LPTDEVVEDKG 84

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           VKV ID  ++L++LGTE+DFKT+KL S FVF+NPNQ SACGCG+SV I  A
Sbjct: 85  VKVIIDPKAVLFLLGTEMDFKTDKLASQFVFNNPNQTSACGCGESVAITPA 135


>gi|240850706|ref|YP_002972106.1| putative FeS assembly scaffold SufA [Bartonella grahamii as4aup]
 gi|240267829|gb|ACS51417.1| putative FeS assembly scaffold SufA [Bartonella grahamii as4aup]
          Length = 121

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 82/111 (73%), Gaps = 3/111 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TEAAV R+K I+      AQGI + +KKGGCAG+EY + LV +  +D D ++E +G
Sbjct: 6   VINLTEAAVDRVKAIM--DAKDAQGILVGIKKGGCAGMEYTITLVKEKGIDAD-VVEVNG 62

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            +V++   ++L++LGT++D++   L SGFVF NPNQVSACGCG+SVE++ A
Sbjct: 63  ARVFVAHDAVLFLLGTQMDYEVTTLRSGFVFKNPNQVSACGCGESVELRPA 113


>gi|92117846|ref|YP_577575.1| HesB/YadR/YfhF [Nitrobacter hamburgensis X14]
 gi|91800740|gb|ABE63115.1| HesB/YadR/YfhF [Nitrobacter hamburgensis X14]
          Length = 134

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 80/113 (70%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T+AA  R+KE+   +  +  G+R+ +KKGGCAG  Y V+   D     D+++E  G
Sbjct: 21  VMRLTDAAAARVKELAARADSEIVGLRVGIKKGGCAGQSYTVEYAHDI-KSTDEVVEDKG 79

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           VKV +D  ++LY+LGTE+D+K EK+ + F+F+NPNQVSACGCG+SV++  A +
Sbjct: 80  VKVLVDPKAVLYLLGTEMDYKAEKMQAQFIFNNPNQVSACGCGESVQLTPAKI 132


>gi|154253695|ref|YP_001414519.1| iron-sulfur cluster assembly accessory protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154157645|gb|ABS64862.1| iron-sulfur cluster assembly accessory protein [Parvibaculum
           lavamentivorans DS-1]
          Length = 119

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 78/113 (69%), Gaps = 3/113 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           +T+TE A  R+KEI+  S GK  G+RI +K GGCAG+EY ++   D  P+D  +++E   
Sbjct: 9   ITLTEIAAARMKEIMAASSGKYIGVRIGVKNGGCAGMEYTMEYAEDVKPLD--EVVEDRD 66

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           VK+ ID  ++L++LGTE+D+  EK  +GF F+NPNQ  ACGCG+SV I  A L
Sbjct: 67  VKILIDPKAILFLLGTEMDYSEEKFSAGFRFNNPNQTDACGCGESVSITPATL 119


>gi|188583651|ref|YP_001927096.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           populi BJ001]
 gi|179347149|gb|ACB82561.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           populi BJ001]
          Length = 126

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 80/112 (71%), Gaps = 1/112 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+ A  R+K I+ +++    G+R+ +K GGCAG+ Y ++   +    G+D+IE  G
Sbjct: 6   VITLTDRAADRLKAIMADAEKPIAGLRVGVKNGGCAGMSYTMEYAEERKA-GEDVIEDRG 64

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           V V+ID  ++L++LGTE+DF+T KL S FVF+NPNQ SACGCG+SV I  A+
Sbjct: 65  VTVFIDPKAVLFLLGTEMDFQTTKLSSQFVFNNPNQTSACGCGESVAITPAN 116


>gi|163868482|ref|YP_001609691.1| hypothetical protein Btr_1332 [Bartonella tribocorum CIP 105476]
 gi|161018138|emb|CAK01696.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 121

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 83/111 (74%), Gaps = 3/111 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++T+AAV R+K I+      A+GI + +KKGGCAG+EY + LV +  +D D ++E +G
Sbjct: 6   VISLTQAAVNRVKAIM--DAKDARGILVGIKKGGCAGMEYTITLVKEEGIDAD-VVEVNG 62

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            +V+I   ++L++LGT++D++   L SGFVF NPNQVSACGCG+SVE++ A
Sbjct: 63  ARVFIAHDAVLFLLGTQMDYEVTTLRSGFVFKNPNQVSACGCGESVELRPA 113


>gi|75675851|ref|YP_318272.1| HesB/YadR/YfhF [Nitrobacter winogradskyi Nb-255]
 gi|74420721|gb|ABA04920.1| HesB/YadR/YfhF [Nitrobacter winogradskyi Nb-255]
          Length = 134

 Score =  115 bits (287), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 51/114 (44%), Positives = 80/114 (70%), Gaps = 3/114 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKD 62
           ++ +T+AA  R+KE+   +  +  G+R+ +K GGCAG  Y V+   D  P D  +++E  
Sbjct: 21  VMRLTDAAATRVKELAARADSEIVGLRVGIKNGGCAGQSYTVEYAHDIRPTD--EVVEDK 78

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           GVK+ +D  ++LY+LGTE+D+K EK+ + FVF+NPNQVSACGCG+SV++  A +
Sbjct: 79  GVKILVDPKAVLYLLGTEMDYKAEKMQAQFVFNNPNQVSACGCGESVQLTPAKI 132


>gi|85716310|ref|ZP_01047283.1| HesB/YadR/YfhF [Nitrobacter sp. Nb-311A]
 gi|85696826|gb|EAQ34711.1| HesB/YadR/YfhF [Nitrobacter sp. Nb-311A]
          Length = 131

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 80/116 (68%), Gaps = 3/116 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIE 60
             ++ +T+AA  R+KE+   +  +  G+R+ +K GGCAG  Y V+   D  P D  +++E
Sbjct: 16  PQVMRLTDAAAARVKELAARADSEIVGLRVGIKNGGCAGQSYTVEYAHDIRPTD--EVVE 73

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
             GVK+ +D  ++LY+LGTE+D+K EK+ + FVF+NPNQVSACGCG+SV++  A +
Sbjct: 74  DKGVKILVDPKAVLYLLGTEMDYKAEKMQAQFVFNNPNQVSACGCGESVQLTPAKV 129


>gi|146340504|ref|YP_001205552.1| Iron-sulfur cluster assembly protein [Bradyrhizobium sp. ORS278]
 gi|146193310|emb|CAL77326.1| Iron-sulfur cluster assembly protein [Bradyrhizobium sp. ORS278]
          Length = 129

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 84/116 (72%), Gaps = 3/116 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIE 60
             ++ +T+AA  RI+E+   ++ +  G+R+ +K GGCAG  Y V+   D  P D  +++E
Sbjct: 16  PQVMRLTDAAATRIRELTQRAESEIIGLRVGVKNGGCAGQSYTVEYAHDIRPTD--EVVE 73

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
             GVK+ +D  ++L++LGTE+D++T+K+ + FVF+NPNQ+SACGCG+SV++K A++
Sbjct: 74  DKGVKILVDPKAVLFLLGTEMDYQTDKMQAQFVFNNPNQISACGCGESVQLKPAEV 129


>gi|86750105|ref|YP_486601.1| HesB/YadR/YfhF [Rhodopseudomonas palustris HaA2]
 gi|86573133|gb|ABD07690.1| HesB/YadR/YfhF [Rhodopseudomonas palustris HaA2]
          Length = 134

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 82/113 (72%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TEAA  R+K+++  + G+  G+R+ +K GGCAG  Y V+   D     D++IE  G
Sbjct: 21  VMRLTEAAATRVKDLMSRADGEIVGLRVGIKNGGCAGQSYTVEYARDLQAT-DEVIEDKG 79

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           VK+ ID  ++L++LGTE+D+K +K+ + FVF+NPNQ+SACGCG+SVE+  A++
Sbjct: 80  VKILIDPKAVLFLLGTEMDYKADKMQAQFVFNNPNQISACGCGESVELVPANV 132


>gi|299133791|ref|ZP_07026985.1| iron-sulfur cluster assembly accessory protein [Afipia sp. 1NLS2]
 gi|298591627|gb|EFI51828.1| iron-sulfur cluster assembly accessory protein [Afipia sp. 1NLS2]
          Length = 135

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 81/114 (71%), Gaps = 3/114 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKD 62
           ++ +TEAA  R++E+   +  +  G+R+ +K GGCAG+EY V+   D  P D  +++E  
Sbjct: 22  VMRLTEAAANRVRELSSRADSEIIGLRVGIKNGGCAGMEYTVEYAHDVRPTD--EVVEDK 79

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           GVK+ +D  +++++LGTE+DFK +K+ + FVF+NPNQ SACGCG+SV++  A +
Sbjct: 80  GVKILVDPKAVMFLLGTEMDFKVDKMAAQFVFNNPNQTSACGCGESVQLTPAKI 133


>gi|163853381|ref|YP_001641424.1| FeS assembly scaffold SufA [Methylobacterium extorquens PA1]
 gi|218532239|ref|YP_002423055.1| FeS assembly scaffold SufA [Methylobacterium chloromethanicum CM4]
 gi|240140798|ref|YP_002965278.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           extorquens AM1]
 gi|254563308|ref|YP_003070403.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           extorquens DM4]
 gi|163664986|gb|ABY32353.1| FeS assembly scaffold SufA [Methylobacterium extorquens PA1]
 gi|218524542|gb|ACK85127.1| FeS assembly scaffold SufA [Methylobacterium chloromethanicum CM4]
 gi|240010775|gb|ACS42001.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           extorquens AM1]
 gi|254270586|emb|CAX26589.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           extorquens DM4]
          Length = 126

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 78/108 (72%), Gaps = 1/108 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+ A  R+K I+ +++    G+R+ +K GGCAG+ Y ++   +    G+D+IE  G
Sbjct: 6   VITLTDRAADRLKAIMADAETPIAGLRVGVKNGGCAGMSYTMEYAEERKA-GEDVIEDRG 64

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V V+ID  ++L++LGTE+DF+T KL S FVF+NPNQ SACGCG+SV I
Sbjct: 65  VTVFIDPKAVLFLLGTEMDFQTTKLSSQFVFNNPNQTSACGCGESVAI 112


>gi|91976933|ref|YP_569592.1| FeS assembly scaffold SufA [Rhodopseudomonas palustris BisB5]
 gi|91683389|gb|ABE39691.1| FeS assembly scaffold SufA [Rhodopseudomonas palustris BisB5]
          Length = 134

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 82/113 (72%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TEAA  R+K+++  +  +  G+R+ +K GGCAG  Y V+   D   + D++IE  G
Sbjct: 21  VMRLTEAAATRVKDLMSRADSEIVGLRVGIKNGGCAGQSYTVEYAHDIKSN-DEMIEDKG 79

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           VK+ ID  +++++LGTE+D+K+EK+ + FVF+NPNQ+SACGCG+SVE+  A +
Sbjct: 80  VKILIDPKAVMFLLGTEMDYKSEKMQAQFVFNNPNQISACGCGESVELVPAKI 132


>gi|121601819|ref|YP_988921.1| putative FeS assembly scaffold SufA [Bartonella bacilliformis
           KC583]
 gi|120613996|gb|ABM44597.1| putative FeS assembly scaffold SufA [Bartonella bacilliformis
           KC583]
          Length = 119

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 81/110 (73%), Gaps = 3/110 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGD-DLIEKD 62
           ++++TEAA+ R+K I+      A GI I +KKGGCAG+EY + LV +   D   D++E +
Sbjct: 6   VISLTEAAINRVKNIM--ETKDAHGILIGVKKGGCAGMEYTITLVKEEVRDTSADIVEIN 63

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           G +V+I   ++L++LGT++D++   L SGF+F+NPNQ+SACGCG+SVEI+
Sbjct: 64  GARVFIARDAVLFLLGTQLDYEETALRSGFIFNNPNQISACGCGESVEIR 113


>gi|39935536|ref|NP_947812.1| hypothetical protein RPA2470 [Rhodopseudomonas palustris CGA009]
 gi|192291127|ref|YP_001991732.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris TIE-1]
 gi|39649389|emb|CAE27911.1| Protein of unknown function, HesB/YadR/YfhF [Rhodopseudomonas
           palustris CGA009]
 gi|192284876|gb|ACF01257.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 123

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 50/114 (43%), Positives = 82/114 (71%), Gaps = 3/114 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKD 62
           ++ +T+AA  R+KE++  +  +  G+R+ +K GGCAG  Y V+   D  P   D++IE  
Sbjct: 10  VMRLTDAAAGRVKELMVRADSEILGLRVGIKNGGCAGQSYTVEYAHDIKP--NDEVIEDK 67

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           GVK+ +D  ++L++LGTE+D+K +++ + FVF+NPNQ+SACGCG+SVE+K A +
Sbjct: 68  GVKILVDPKAVLFLLGTEMDYKADRMQAQFVFNNPNQISACGCGESVELKPASI 121


>gi|209885132|ref|YP_002288989.1| iron-sulfur cluster assembly accessory protein [Oligotropha
           carboxidovorans OM5]
 gi|209873328|gb|ACI93124.1| iron-sulfur cluster assembly accessory protein [Oligotropha
           carboxidovorans OM5]
          Length = 135

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 79/112 (70%), Gaps = 3/112 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKD 62
           ++ +TEAA  R++E+   +  +  G+R+ +K GGCAG+EY V+   D  P D  +++E  
Sbjct: 22  VMRLTEAAASRVRELASRADSEIIGLRVGIKNGGCAGMEYTVEYAHDVRPTD--EVVEDK 79

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           GVK+ +D  ++L++LGTE+DFK +K+ + FVF+NPNQ  ACGCG+SV++  A
Sbjct: 80  GVKILVDPKAVLFLLGTEMDFKVDKMAAQFVFNNPNQTGACGCGESVQLTPA 131


>gi|319408430|emb|CBI82085.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 124

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 81/111 (72%), Gaps = 3/111 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++TE A+ RIK+I+      A GI I +KKGGCAG+EY + L  +   D D ++E DG
Sbjct: 5   VISLTEVAIDRIKDIM--KTKNACGILIGIKKGGCAGMEYTITLAKEEMHDAD-VVEIDG 61

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            +V+I   ++L++LGT++D++   L SGF+F+NPNQ+SACGCG+SVEI+ A
Sbjct: 62  ARVFIARDAILFLLGTQVDYEVTTLRSGFIFNNPNQISACGCGESVEIRPA 112


>gi|319405776|emb|CBI79402.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 126

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 80/110 (72%), Gaps = 3/110 (2%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++ +TEAA+ R+K I+      A GI + +KKGGCAG+EY + LVT+   D D ++E +
Sbjct: 5   SVINLTEAAIDRVKAIM--ETKNAYGILVGVKKGGCAGMEYTITLVTEEIHDAD-VVEVN 61

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           G +V+I   ++L++LG ++D++   L SGF+F+NPNQVSACGCG+SVEI+
Sbjct: 62  GARVFIARNAVLFLLGAQMDYEITTLRSGFIFNNPNQVSACGCGESVEIR 111


>gi|49474146|ref|YP_032188.1| hypothetical protein BQ05250 [Bartonella quintana str. Toulouse]
 gi|49239650|emb|CAF26020.1| hypothetical protein BQ05250 [Bartonella quintana str. Toulouse]
          Length = 124

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 81/111 (72%), Gaps = 3/111 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +V +T+AA+ R+K ++      A+GI I +KKGGCAG+EY + LV +   D D ++E +G
Sbjct: 6   VVNLTQAAMDRVKAVM--DAKDARGILIGIKKGGCAGMEYTITLVKEEVPDAD-VVEVNG 62

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            +V+I   ++L++LGT+ID++   L SGFVF NPNQVSACGCG+SVE++ A
Sbjct: 63  ARVFIAHDAVLFLLGTQIDYEVTTLRSGFVFKNPNQVSACGCGESVELRPA 113


>gi|304321538|ref|YP_003855181.1| HesB/YadR/YfhF [Parvularcula bermudensis HTCC2503]
 gi|303300440|gb|ADM10039.1| HesB/YadR/YfhF [Parvularcula bermudensis HTCC2503]
          Length = 121

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 78/108 (72%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDN-PVDGDDLIEKDG 63
           +T+T+AA  R++EI+  +     G++I +K GGCAG+EY +D  TD  P+D  +++E  G
Sbjct: 9   LTLTDAAAERMREIMAAADDAFIGVKIGVKNGGCAGMEYTMDYATDRAPLD--EVVEDRG 66

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + + ID  ++L++LGTE+D+ TEKL S FVF+NPNQ  ACGCG+SV I
Sbjct: 67  ITILIDPKAILFLLGTEVDYVTEKLSSRFVFNNPNQTDACGCGESVTI 114


>gi|298291341|ref|YP_003693280.1| iron-sulfur cluster assembly accessory protein [Starkeya novella
           DSM 506]
 gi|296927852|gb|ADH88661.1| iron-sulfur cluster assembly accessory protein [Starkeya novella
           DSM 506]
          Length = 128

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 77/108 (71%), Gaps = 1/108 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  R++ I+  S     G+R+ +K  GCAG+EY ++   +     D+++E  G
Sbjct: 10  VMTLTDAAAERVRAIIARSDKPVAGLRVGIKNAGCAGMEYTMEF-AEEAGRFDEVVEDKG 68

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV ID  +++Y+LGT++D+KT+KL + FVF+NPNQ SACGCG+SV I
Sbjct: 69  VKVLIDPKAIMYLLGTQMDYKTDKLSAQFVFNNPNQTSACGCGESVAI 116


>gi|316934374|ref|YP_004109356.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris DX-1]
 gi|315602088|gb|ADU44623.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris DX-1]
          Length = 123

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 50/114 (43%), Positives = 82/114 (71%), Gaps = 3/114 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKD 62
           ++ +T+AA  R+KE++  +  +  G+R+ +K GGCAG  Y V+   D  P   D++IE  
Sbjct: 10  VMRLTDAAAGRVKELMGRADSEILGLRVGIKNGGCAGQSYTVEYAHDIKP--NDEVIEDK 67

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           GVK+ +D  ++L++LGTE+D+K +++ + FVF+NPNQ+SACGCG+SVE+K A +
Sbjct: 68  GVKILVDPKAVLFLLGTEMDYKADRMQAQFVFNNPNQISACGCGESVELKPASI 121


>gi|148255362|ref|YP_001239947.1| Iron-sulfur cluster assembly protein [Bradyrhizobium sp. BTAi1]
 gi|146407535|gb|ABQ36041.1| Iron-sulfur cluster assembly protein [Bradyrhizobium sp. BTAi1]
          Length = 134

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 47/116 (40%), Positives = 84/116 (72%), Gaps = 3/116 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIE 60
             ++ +T+AA  RI+E++  ++ +  G+R+ +K GGCAG  Y V+   D  P D  +++E
Sbjct: 21  PQVMRLTDAAATRIRELMQRAESEIIGLRVGVKNGGCAGQSYTVEYAHDIRPTD--EVVE 78

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
             GVK+ +D  ++L++LGTE+D++ +++ + FVF+NPNQ+SACGCG+SV++K A++
Sbjct: 79  DKGVKIMVDPKAVLFLLGTEMDYQADRMQAQFVFNNPNQISACGCGESVQLKPAEV 134


>gi|319404334|emb|CBI77929.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
 gi|319407338|emb|CBI80981.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 125

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 50/109 (45%), Positives = 81/109 (74%), Gaps = 3/109 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TEAA+ R+K I+      A GI + +KKGGCAG+EY + LVT+   D D ++E +G
Sbjct: 6   VINLTEAAIDRVKTIM--KTKNAYGILVGIKKGGCAGMEYTITLVTEEMHDAD-VVEVNG 62

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
            +V++   ++L++LGT++D++   L SGF+F+NPNQ+S+CGCG+SVEI+
Sbjct: 63  ARVFVARDAVLFLLGTQMDYEVTTLRSGFIFNNPNQISSCGCGESVEIR 111


>gi|91762129|ref|ZP_01264094.1| hesB protein [Candidatus Pelagibacter ubique HTCC1002]
 gi|91717931|gb|EAS84581.1| hesB protein [Candidatus Pelagibacter ubique HTCC1002]
          Length = 110

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 82/112 (73%), Gaps = 3/112 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLI 59
           MS I+ +++ A  RIKEI+   +  + G+R+++K GGCAG+ Y+++   + NP   D++I
Sbjct: 1   MSPIIKLSDNAASRIKEIMSGVESNSIGVRVAVKSGGCAGMSYVMEYAKEINP--SDEII 58

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           E  GVKV++D+A+++Y+LGTE+D+K E+  S FVF+NPN+   CGCG+S ++
Sbjct: 59  EDKGVKVFVDAAAVMYLLGTEMDYKKEEFSSSFVFNNPNESERCGCGESFKV 110


>gi|300023859|ref|YP_003756470.1| iron-sulfur cluster assembly accessory protein [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525680|gb|ADJ24149.1| iron-sulfur cluster assembly accessory protein [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 130

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 79/114 (69%), Gaps = 2/114 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M  ++T+T+AA  R+  ++    G  + ++I +KKGGCAG+EY +    D     D++IE
Sbjct: 7   MPKVMTLTDAAAARVATLIAQKPG-VKALKIGIKKGGCAGMEYTMTWA-DQIGKFDEVIE 64

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
             G  V ID A+++Y+LGTE+DFKT+KL S FVF+NPNQ SACGCG+SV ++ A
Sbjct: 65  DKGAIVLIDPAAIMYLLGTEMDFKTDKLSSQFVFNNPNQKSACGCGESVNLEPA 118


>gi|262277354|ref|ZP_06055147.1| iron-sulfur cluster assembly accessory protein [alpha
           proteobacterium HIMB114]
 gi|262224457|gb|EEY74916.1| iron-sulfur cluster assembly accessory protein [alpha
           proteobacterium HIMB114]
          Length = 111

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 81/112 (72%), Gaps = 2/112 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGK-AQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           MS I+T +  A  R+KEI+ + + K A G+RIS+K GGCAG+ Y ++ V +  +DGD+ I
Sbjct: 1   MSSILTFSNQAKTRLKEIMSSDEYKNALGLRISVKSGGCAGMTYDMNYV-EQLIDGDEKI 59

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           E +GV V+ID  +++Y+LGTE+D+K +K  S FVF+NPN+   CGCG+S +I
Sbjct: 60  EVEGVNVFIDPKAIMYLLGTEMDYKVDKFTSSFVFNNPNETERCGCGESFKI 111


>gi|217978358|ref|YP_002362505.1| iron-sulfur cluster assembly accessory protein [Methylocella
           silvestris BL2]
 gi|217503734|gb|ACK51143.1| iron-sulfur cluster assembly accessory protein [Methylocella
           silvestris BL2]
          Length = 119

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 74/111 (66%), Gaps = 1/111 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++TEAA  R ++++  +     GI++ +K GGCAG+ Y +DL  D    GD+++E  G
Sbjct: 8   VLSLTEAAAARARDLIAGAGKPVAGIKVGIKNGGCAGMTYTLDLA-DEVTPGDEIVEDQG 66

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           V + I    L+++LGT++DF+T+K  + F F NPNQ SACGCG+SV I  A
Sbjct: 67  VNILIAPKDLMFLLGTKLDFETDKFAASFTFKNPNQTSACGCGESVSITPA 117


>gi|90424332|ref|YP_532702.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisB18]
 gi|90106346|gb|ABD88383.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisB18]
          Length = 134

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 80/114 (70%), Gaps = 3/114 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKD 62
           ++ +T+AA  R++E+   +  +  G+R+ +K GGCAG  Y VD   D  P   D+++E  
Sbjct: 21  VMRLTDAAAARVRELTERADSEIIGLRVGIKNGGCAGQSYTVDYAHDVRP--SDEVVEDK 78

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           GVK+ ++  ++L++LGTE+D+K +K+ + FVF+NPNQ+SACGCG+SV++  A +
Sbjct: 79  GVKILVEPKAVLFLLGTEMDYKVDKMSATFVFNNPNQISACGCGESVQLSPAKI 132


>gi|115524968|ref|YP_781879.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris BisA53]
 gi|115518915|gb|ABJ06899.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris BisA53]
          Length = 133

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 78/112 (69%), Gaps = 3/112 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKD 62
           ++ +T+AA  R++++V  +     G+R+ +K GGCAG  Y VD   D  P D  +++E  
Sbjct: 20  VMRLTDAAAERVRDLVGRADSTILGLRVGIKNGGCAGQSYTVDYAHDIQPTD--EVVEDK 77

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           GVK+ +D  ++L++LGTE+D+K +K+ + FVF+NPNQ SACGCG+SV++  A
Sbjct: 78  GVKILVDPKAVLFLLGTEMDYKVDKMSATFVFNNPNQTSACGCGESVQLTPA 129


>gi|221234871|ref|YP_002517307.1| HesB protein family [Caulobacter crescentus NA1000]
 gi|220964043|gb|ACL95399.1| HesB protein family [Caulobacter crescentus NA1000]
          Length = 133

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 78/112 (69%), Gaps = 3/112 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDN-PVDGDDLIEKD 62
           +VT+T+AA  R+KEI+  +     G+R+ +K GGCAG EY+ +   +  P+D  +++E  
Sbjct: 19  VVTLTDAAAARVKEIMDKADQPYAGLRVGVKNGGCAGQEYVFEYAKEKGPID--EVVEDK 76

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           GV + I+  ++L+++GTEID++  KL S FVFHNPN+  ACGCG+SV I+ A
Sbjct: 77  GVTILIEPKAVLFLVGTEIDYEVTKLSSKFVFHNPNETDACGCGESVTIQPA 128


>gi|170747429|ref|YP_001753689.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653951|gb|ACB23006.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           radiotolerans JCM 2831]
          Length = 125

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 76/108 (70%), Gaps = 1/108 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++T+ A  RIK I+  +     G+R+ ++ GGCAG+ Y ++   +    G+D++E  G
Sbjct: 7   VLSLTDRAADRIKAIMAEADRPIAGLRVGVRNGGCAGMSYTMEYA-EAAKPGEDVVEDRG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V+V++D  ++L++LGTE+DF T KL S FVF+NPNQ SACGCG+SV I
Sbjct: 66  VRVFVDPKAVLFLLGTEMDFTTNKLASQFVFNNPNQTSACGCGESVAI 113


>gi|71083448|ref|YP_266167.1| hesB protein [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062561|gb|AAZ21564.1| hesB protein [Candidatus Pelagibacter ubique HTCC1062]
          Length = 110

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 81/111 (72%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+ I+ +++ A  RIKEI+   +  + G+R+++K GGCAG+ Y+++   +  +  D++IE
Sbjct: 1   MNPIIKLSDNAASRIKEIMSGVESNSIGVRVAVKSGGCAGMSYVMEYAKEINLS-DEIIE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GVKV++D+A+++Y+LGTE+D+K E+  S FVF+NPN+   CGCG+S ++
Sbjct: 60  DKGVKVFVDAAAVMYLLGTEMDYKKEEFSSSFVFNNPNESERCGCGESFKV 110


>gi|302383285|ref|YP_003819108.1| iron-sulfur cluster assembly accessory protein [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193913|gb|ADL01485.1| iron-sulfur cluster assembly accessory protein [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 132

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/109 (44%), Positives = 75/109 (68%), Gaps = 3/109 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKD 62
           +VT+TEAA  R++EI+ N++     +R+ +K GGCAG EY      +  P+D  +++E  
Sbjct: 17  VVTLTEAAAERVREIMANAEKAYVALRVGVKNGGCAGQEYTFAYAEEIGPMD--EVVEDK 74

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GV + ID  ++L+++G+E+D++T KL S FVF NPNQ  ACGCG+SV I
Sbjct: 75  GVTILIDPKAILFLIGSEVDYETSKLSSKFVFRNPNQTDACGCGESVTI 123


>gi|197105178|ref|YP_002130555.1| HesB/YadR/YfhF family protein [Phenylobacterium zucineum HLK1]
 gi|196478598|gb|ACG78126.1| HesB/YadR/YfhF family protein [Phenylobacterium zucineum HLK1]
          Length = 131

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 80/114 (70%), Gaps = 3/114 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLV-TDNPVDGDDLIEKD 62
           +VT+TE A  R++EI+  +     G+R+ +K GGCAG EY+++   T +P+D  +++E  
Sbjct: 19  VVTLTERAAERVREIMGKADKPYAGLRVGVKNGGCAGQEYVLEYAETADPMD--EVVEDK 76

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           GV + ++  ++L+++G+EID++  KL + FVFHNPN+  ACGCG+SV I+ A L
Sbjct: 77  GVTILVEPKAVLFLIGSEIDYEVSKLSAKFVFHNPNETDACGCGESVTIQPAKL 130


>gi|295689535|ref|YP_003593228.1| iron-sulfur cluster assembly accessory protein [Caulobacter segnis
           ATCC 21756]
 gi|295431438|gb|ADG10610.1| iron-sulfur cluster assembly accessory protein [Caulobacter segnis
           ATCC 21756]
          Length = 130

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 77/112 (68%), Gaps = 3/112 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLV-TDNPVDGDDLIEKD 62
           +VT+T+AA  R+K I+  +     G+R+ +K GGCAG EY+ +   T  P+D  +++E  
Sbjct: 16  VVTLTDAAAARVKAIMDKADKPYVGLRVGVKNGGCAGQEYVFEYAETKGPID--EVVEDK 73

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           GV + I+  ++L+++GTEID++  KL S FVFHNPN+  ACGCG+SV I+ A
Sbjct: 74  GVTILIEPKAVLFLIGTEIDYEVSKLSSKFVFHNPNETDACGCGESVTIQPA 125


>gi|154248533|ref|YP_001419491.1| iron-sulfur cluster assembly accessory protein [Xanthobacter
           autotrophicus Py2]
 gi|154162618|gb|ABS69834.1| iron-sulfur cluster assembly accessory protein [Xanthobacter
           autotrophicus Py2]
          Length = 141

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 82/117 (70%), Gaps = 4/117 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLI 59
           +  ++ +T+AA  +++EI+  ++     +R+ ++ GGCAG+ Y +D  T+  P D   ++
Sbjct: 21  LPPVIRITDAAAEQLREILAAAE-PGTALRVGIENGGCAGMSYKMDFTTEIAPFD--SVV 77

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           E  GVKV +D+ ++L++LGTE+D+KT+K+ S FVF+NPNQ S+CGCG+SV I   D+
Sbjct: 78  EDKGVKVVVDTKAVLFLLGTEMDYKTDKVSSQFVFNNPNQTSSCGCGESVAITPVDM 134


>gi|254418453|ref|ZP_05032177.1| hypothetical protein BBAL3_763 [Brevundimonas sp. BAL3]
 gi|196184630|gb|EDX79606.1| hypothetical protein BBAL3_763 [Brevundimonas sp. BAL3]
          Length = 129

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 76/108 (70%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           VT+T+AA  R++EI+ N++    G+RI +K GGCAG EY      +  P+D  +++E  G
Sbjct: 18  VTLTDAAAERVREILDNAENDHIGLRIGVKNGGCAGQEYTFAYADEIGPLD--EVVEDKG 75

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V + I+  ++L+++GTEID++T +L S FVF+NPNQ  ACGCG+SV I
Sbjct: 76  VTILIEPKAVLFLIGTEIDYETTRLASKFVFNNPNQTDACGCGESVTI 123


>gi|260575186|ref|ZP_05843186.1| iron-sulfur cluster assembly accessory protein [Rhodobacter sp.
           SW2]
 gi|259022446|gb|EEW25742.1| iron-sulfur cluster assembly accessory protein [Rhodobacter sp.
           SW2]
          Length = 119

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 77/109 (70%), Gaps = 5/109 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           VT+T  A  +I  ++   QG AQG+RI +KKGGCAG+EY +D VT+ NP+D   L+E+DG
Sbjct: 10  VTLTPQAATQIARLM-AKQG-AQGLRIGVKKGGCAGMEYTLDYVTEVNPLDA--LVEQDG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
            +V I   + ++++GTEID++T  L +GF F NPN   ACGCG+S++ K
Sbjct: 66  ARVLIAPMAQMFLIGTEIDYQTSLLDAGFKFRNPNVAEACGCGESIKFK 114


>gi|77462496|ref|YP_352000.1| hypothetical protein RSP_1948 [Rhodobacter sphaeroides 2.4.1]
 gi|77386914|gb|ABA78099.1| Protein of unknown function, HesB/YadR/YfhF [Rhodobacter
           sphaeroides 2.4.1]
          Length = 118

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 80/112 (71%), Gaps = 5/112 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           VT+T AA  +I  ++   QG ++G+RI +KKGGCAG+EY +D V+D NP+D  + +E+DG
Sbjct: 10  VTLTPAAAKQIARLM-QKQG-SKGLRIGVKKGGCAGMEYTMDYVSDINPMD--ETVEQDG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            +V I   + +++ GTEID++T  + SGF F NPN V ACGCG+S++ + A+
Sbjct: 66  ARVMIAPMAQMFLFGTEIDYETGLIESGFKFRNPNVVDACGCGESIKFREAE 117


>gi|330814297|ref|YP_004358536.1| iron binding protein SufA for iron-sulfur cluster assembly
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487392|gb|AEA81797.1| iron binding protein SufA for iron-sulfur cluster assembly
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 112

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 79/111 (71%), Gaps = 2/111 (1%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKA-QGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           S ++++T+AA  RI EI+ N++    +G+R+++  GGCAG+ Y ++ + +    GD++IE
Sbjct: 3   SQVISITDAAAERINEIMSNAKDNTIEGVRVNVVTGGCAGMSYEMNYINEKS-PGDEVIE 61

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GVKV+ID  +++Y+LGT +D+K +K  S FVF+NPN+   CGCG+S +I
Sbjct: 62  DKGVKVYIDPKAIMYLLGTVMDYKKDKFSSSFVFNNPNETERCGCGESFKI 112


>gi|126461373|ref|YP_001042487.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221638359|ref|YP_002524621.1| Iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides KD131]
 gi|126103037|gb|ABN75715.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221159140|gb|ACM00120.1| Iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides KD131]
          Length = 118

 Score =  105 bits (261), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 77/112 (68%), Gaps = 5/112 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           VT+T AA  +I  ++     K  G+RI +KKGGCAG+EY +D V+D NP+D  + +E+DG
Sbjct: 10  VTLTPAAAKQIARLMQKQDSK--GLRIGVKKGGCAGMEYTMDYVSDINPMD--ETVEQDG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            +V I   + +++ GTEID++T  + SGF F NPN V ACGCG+S++ + A+
Sbjct: 66  ARVMIAPMAQMFLFGTEIDYETGLIESGFKFRNPNVVDACGCGESIKFREAE 117


>gi|149202814|ref|ZP_01879786.1| iron-sulfur cluster assembly accessory protein [Roseovarius sp.
           TM1035]
 gi|149144096|gb|EDM32130.1| iron-sulfur cluster assembly accessory protein [Roseovarius sp.
           TM1035]
          Length = 116

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 77/108 (71%), Gaps = 5/108 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDG-DDLIEKDG 63
           V++T AAV +I  ++   +   QG+RI +KKGGCAG+EY +D VT+  +D  D++IE+DG
Sbjct: 10  VSITPAAVTQITRLM--QRDGHQGLRIGVKKGGCAGMEYTMDYVTE--IDPHDEVIEQDG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +V I   + +++ GTEID+KT  L SGFVF+NPN   ACGCG+S++ 
Sbjct: 66  ARVLIAPMAQMFLFGTEIDYKTSLLESGFVFNNPNVTEACGCGESIKF 113


>gi|332560380|ref|ZP_08414702.1| Iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides WS8N]
 gi|332278092|gb|EGJ23407.1| Iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides WS8N]
          Length = 118

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 76/112 (67%), Gaps = 5/112 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           VT+T AA  +I  ++     K  G+RI +KKGGCAG+EY +D V D NP+D  + +E+DG
Sbjct: 10  VTLTPAAAKQIARLMQKQDSK--GLRIGVKKGGCAGMEYTMDYVADINPMD--ETVEQDG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            +V I   + +++ GTEID++T  + SGF F NPN V ACGCG+S++ + A+
Sbjct: 66  ARVMIAPMAQMFLFGTEIDYETGLIESGFKFRNPNVVDACGCGESIKFREAE 117


>gi|167646557|ref|YP_001684220.1| iron-sulfur cluster assembly accessory protein [Caulobacter sp.
           K31]
 gi|167348987|gb|ABZ71722.1| iron-sulfur cluster assembly accessory protein [Caulobacter sp.
           K31]
          Length = 130

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 76/112 (67%), Gaps = 3/112 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDN-PVDGDDLIEKD 62
           +V++T AA  R+KEI+  +     G+R+ +K GGCAG  Y+ +   +  P+D  +++E  
Sbjct: 16  VVSLTPAAAARVKEIMDRADRPYAGLRVGVKNGGCAGSAYIFEYAAEKGPID--EVVEDQ 73

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           GV + ID  ++L+++GT ID++T KL S FVF+NPN+  ACGCG+SV I+ A
Sbjct: 74  GVTILIDPKAVLFLIGTTIDYETTKLSSKFVFNNPNETDACGCGESVTIQPA 125


>gi|146276396|ref|YP_001166555.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145554637|gb|ABP69250.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 118

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 79/112 (70%), Gaps = 5/112 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           VT+T AA  +I  ++   QG ++G+RI +KKGGCAG+EY +D V D NP+D  + +E++G
Sbjct: 10  VTLTPAAARQIARLM-QKQG-SKGLRIGVKKGGCAGMEYTMDYVADINPMD--ETVEQEG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            +V I   + +++ GTEID++T  + SGF F NPN V ACGCG+S++ + A+
Sbjct: 66  ARVMIAPMAQMFLFGTEIDYETGLIESGFKFRNPNVVDACGCGESIKFRDAE 117


>gi|329850530|ref|ZP_08265375.1| iron-sulfur cluster assembly accessory family protein
           [Asticcacaulis biprosthecum C19]
 gi|328840845|gb|EGF90416.1| iron-sulfur cluster assembly accessory family protein
           [Asticcacaulis biprosthecum C19]
          Length = 130

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 74/111 (66%), Gaps = 1/111 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +VT+T+AA  ++K I+  +     G+R+ +K+GGCAG EY++    D     D+++   G
Sbjct: 18  VVTLTDAAADQVKAIMARADNSYAGLRVGVKQGGCAGQEYVLSY-ADAIGPLDEVVSDKG 76

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           V V ID  ++LY++GT ID++T KL S FVF NPN+  ACGCG+SV IK A
Sbjct: 77  VTVLIDPKAVLYLVGTVIDYETTKLASKFVFRNPNETDACGCGESVTIKPA 127


>gi|114766176|ref|ZP_01445176.1| iron-sulfur cluster assembly accessory protein [Pelagibaca
           bermudensis HTCC2601]
 gi|114541547|gb|EAU44590.1| iron-sulfur cluster assembly accessory protein [Roseovarius sp.
           HTCC2601]
          Length = 126

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 77/111 (69%), Gaps = 3/111 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMT AAV ++++++    G+A G+RI +KKGGCAG+EY ++ V D     D+++E+DG 
Sbjct: 10  VTMTTAAVTQVRKLM-ERDGRA-GLRIGVKKGGCAGMEYTMEFV-DTADGNDEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           +V I   + +++ GTEID++   L SGF F+NPN   ACGCG+S++ K  D
Sbjct: 67  RVMIAPMAQMFLFGTEIDYQVSLLESGFQFNNPNVADACGCGESIKFKDLD 117


>gi|86137505|ref|ZP_01056082.1| iron-sulfur cluster assembly accessory protein [Roseobacter sp.
           MED193]
 gi|85825840|gb|EAQ46038.1| iron-sulfur cluster assembly accessory protein [Roseobacter sp.
           MED193]
          Length = 119

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 74/108 (68%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T  A  +I +++  + G   G+RI +KKGGCAG+EY ++ V D P + D+++E+DG 
Sbjct: 10  VTITPKAAAQITKLM--TSGGHAGLRIGVKKGGCAGMEYTMEYV-DEPDNNDEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           +V I   + +++ GTEID++T  L SGF F+NPN   ACGCG+S+  K
Sbjct: 67  RVLIAPMAQMFLFGTEIDYETSLLESGFKFNNPNVSEACGCGESISFK 114


>gi|114569871|ref|YP_756551.1| iron-sulfur cluster assembly accessory protein [Maricaulis maris
           MCS10]
 gi|114340333|gb|ABI65613.1| iron-sulfur cluster assembly accessory protein [Maricaulis maris
           MCS10]
          Length = 119

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 76/107 (71%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++TEAA  R+K ++  +Q  A  +R+ +K GGCAG+EY +  V D P   D+ +E  GV
Sbjct: 10  VSLTEAAAERVKALM--AQRGAGFLRVGVKNGGCAGMEYEMAYV-DAPGPLDERVEDHGV 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ ++S +LL++LGT+ID++   L++ FVF+NPNQ  ACGCG+SV I
Sbjct: 67  EIVLESKALLFLLGTQIDYEISPLHAKFVFNNPNQTDACGCGESVTI 113


>gi|88858494|ref|ZP_01133136.1| Fe-S cluster assembly and activation protein [Pseudoalteromonas
           tunicata D2]
 gi|88820111|gb|EAR29924.1| Fe-S cluster assembly and activation protein [Pseudoalteromonas
           tunicata D2]
          Length = 107

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 73/107 (68%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE+AV R++  + N +GK  G+R+ +K  GC+GL Y+++ V D   +GD+  E+DGV
Sbjct: 3   ITLTESAVNRVRTFLQN-RGKGIGLRVGIKTTGCSGLAYVLEFV-DELAEGDETFEQDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D+ SL+Y+ GT++DF  E L  GF F NPNQ   CGCG+S  +
Sbjct: 61  TVIVDAKSLVYIDGTQLDFVKEGLNEGFKFSNPNQSGECGCGESFTV 107


>gi|119387009|ref|YP_918064.1| iron-sulfur cluster assembly accessory protein [Paracoccus
           denitrificans PD1222]
 gi|119377604|gb|ABL72368.1| iron-sulfur cluster assembly accessory protein [Paracoccus
           denitrificans PD1222]
          Length = 123

 Score =  101 bits (251), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 72/105 (68%), Gaps = 3/105 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+AA  +I  ++  +Q  A G+RI LKKGGCAG+EY ++L  + P  GD+++E+   
Sbjct: 10  VTITQAAERQIARLM--AQKSASGLRIGLKKGGCAGMEYTMELA-ETPAPGDEVVEQGEA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           +V I   + +++ GTEID+++  L SGF F NPN   +CGCG+SV
Sbjct: 67  RVLIAPTAQMFLFGTEIDYESGLLESGFKFRNPNVTDSCGCGESV 111


>gi|260427247|ref|ZP_05781226.1| iron-sulfur cluster assembly accessory protein [Citreicella sp.
           SE45]
 gi|260421739|gb|EEX14990.1| iron-sulfur cluster assembly accessory protein [Citreicella sp.
           SE45]
          Length = 126

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 77/108 (71%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMT AA  ++++++ +  G+A G+RI +KKGGCAG+EY ++ V D     D+++E+DG 
Sbjct: 10  VTMTPAAETQVRKLM-DRDGRA-GLRIGVKKGGCAGMEYTMEFV-DTADPNDEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           +V I   + +++ GTEID+++  L SGF F+NPN   ACGCG+S++ K
Sbjct: 67  RVMIAPMAQMFLFGTEIDYRSSLLESGFHFNNPNVADACGCGESIKFK 114


>gi|85702902|ref|ZP_01034006.1| iron-sulfur cluster assembly accessory protein [Roseovarius sp.
           217]
 gi|85671830|gb|EAQ26687.1| iron-sulfur cluster assembly accessory protein [Roseovarius sp.
           217]
          Length = 116

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 75/111 (67%), Gaps = 5/111 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMT AA  +I  ++   +   QG+RI +KKGGCAG+EY ++ V  N    D+++E++G 
Sbjct: 10  VTMTPAAAEQI--MLLMQRDAHQGLRIGIKKGGCAGMEYTMEYV-KNIDPHDEVVEQEGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           +V I   + +++ GTEID+KT  L SGFVF+NPN   ACGCG+S  IK AD
Sbjct: 67  RVMIAPMAQMFLFGTEIDYKTSLLESGFVFNNPNVTEACGCGES--IKFAD 115


>gi|238022338|ref|ZP_04602764.1| hypothetical protein GCWU000324_02245 [Kingella oralis ATCC 51147]
 gi|237866952|gb|EEP67994.1| hypothetical protein GCWU000324_02245 [Kingella oralis ATCC 51147]
          Length = 106

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 73/108 (67%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE AV +I++ + N +GK +GIRI +K  GC+G+ Y ++ V D     D + E+DG
Sbjct: 1   MITITENAVKQIRKFLTN-RGKGEGIRIGVKTSGCSGMAYTLEFV-DEIQPEDQVFEQDG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV+ID  S++Y+ GT++DF  E L  GF F NPN   +CGCG+S  +
Sbjct: 59  VKVFIDPKSMVYLDGTQVDFAKEGLQEGFKFENPNAKESCGCGESFHV 106


>gi|254465569|ref|ZP_05078980.1| HesB/YadR/YfhF [Rhodobacterales bacterium Y4I]
 gi|206686477|gb|EDZ46959.1| HesB/YadR/YfhF [Rhodobacterales bacterium Y4I]
          Length = 119

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 72/109 (66%), Gaps = 3/109 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMT  A  +I +++    G A G+RI +KKGGCAG+EY ++ V D P   D+++E+DG 
Sbjct: 10  VTMTPKAAAQIAKLM-QKDGHA-GLRIGVKKGGCAGMEYTMEYV-DEPAPNDEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
           ++ I   + +++ GTEID++   L SGF F+NPN   ACGCG+S+  K 
Sbjct: 67  RILIAPMAQMFLFGTEIDYEVSLLESGFKFNNPNVAEACGCGESISFKE 115


>gi|254293812|ref|YP_003059835.1| iron-sulfur cluster assembly accessory protein [Hirschia baltica
           ATCC 49814]
 gi|254042343|gb|ACT59138.1| iron-sulfur cluster assembly accessory protein [Hirschia baltica
           ATCC 49814]
          Length = 121

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 76/108 (70%), Gaps = 3/108 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           IVT+++AA  R+KEI+  S+  A  +R+ +K GGCAG+EY++D     P   D+ +  + 
Sbjct: 9   IVTLSDAAAKRVKEIM--SERGAGFLRVGVKNGGCAGMEYVMDY-AQAPEPLDERVADND 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V++ +D+ ++L++LG++ID++   L+S FVF NPNQ  ACGCG+SV I
Sbjct: 66  VEIVVDAKAVLFLLGSQIDYEVSPLHSKFVFRNPNQTDACGCGESVTI 113


>gi|83593900|ref|YP_427652.1| HesB/YadR/YfhF [Rhodospirillum rubrum ATCC 11170]
 gi|83576814|gb|ABC23365.1| HesB/YadR/YfhF [Rhodospirillum rubrum ATCC 11170]
          Length = 113

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 73/111 (65%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           +   +T+TEAAV RIK ++  +     G+R+ +   GC+GL Y +D   D P   ++++ 
Sbjct: 3   LPPPITLTEAAVARIKALMARADKPVAGLRVGVSTKGCSGLSYKIDYAEDGPRPFEEVVS 62

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +DG  V+++S ++++++G+++DFK +KL + F F NPN+ + CGCG+S  +
Sbjct: 63  QDGATVFLESNAVMFLIGSQMDFKQDKLSATFSFANPNEKARCGCGESFSV 113


>gi|315499754|ref|YP_004088557.1| iron-sulfur cluster assembly accessory protein [Asticcacaulis
           excentricus CB 48]
 gi|315417766|gb|ADU14406.1| iron-sulfur cluster assembly accessory protein [Asticcacaulis
           excentricus CB 48]
          Length = 132

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 77/112 (68%), Gaps = 3/112 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLV-TDNPVDGDDLIEKD 62
           IV++T+AA  ++K I+  +     G+R+ +K+GGCAG EY++      +P+D  +++   
Sbjct: 18  IVSLTDAAAAQVKTIMSRADKPYVGLRVGVKQGGCAGQEYVLSYAEAADPLD--EVVTDK 75

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           GV + I+  ++LY++GT ID++T KL S FVF+NPN+  ACGCG+SV IK A
Sbjct: 76  GVTILIEPKAVLYLVGTVIDYETTKLASKFVFNNPNETDACGCGESVTIKPA 127


>gi|84684903|ref|ZP_01012803.1| iron-sulfur cluster assembly accessory protein [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667238|gb|EAQ13708.1| iron-sulfur cluster assembly accessory protein [Rhodobacterales
           bacterium HTCC2654]
          Length = 121

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 75/108 (69%), Gaps = 5/108 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           VT+T+ A  +I  ++   +G  +G+RI +KKGGCAG+EY +D V D +P   D+++E+DG
Sbjct: 10  VTITDTAAVQIARLM--DKGGHKGLRIGVKKGGCAGMEYTMDYVDDVDP--NDEVVEQDG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +V I   + +++ GTEID++T  L SGF F NPN V ACGCG+S++ 
Sbjct: 66  ARVMIAPMAQMFLFGTEIDYETSLLESGFKFRNPNVVDACGCGESIKF 113


>gi|89055016|ref|YP_510467.1| HesB/YadR/YfhF [Jannaschia sp. CCS1]
 gi|88864565|gb|ABD55442.1| HesB/YadR/YfhF [Jannaschia sp. CCS1]
          Length = 126

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 77/112 (68%), Gaps = 5/112 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           VTMT+ A  +I +++   QG  QG+RI +KKGGCAG+EY ++ V++ +P+D  +++E+DG
Sbjct: 10  VTMTDKAARQIAKLM--DQGGTQGLRIGVKKGGCAGMEYTMEYVSEIDPLD--EVVEQDG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            +V I   + +++ GTEID++   L + F F NPN   ACGCG+S++ K  D
Sbjct: 66  ARVMIAPMAQMFLFGTEIDYEVSLLEASFQFRNPNVSDACGCGESIKFKDMD 117


>gi|83858474|ref|ZP_00951996.1| HesB/YadR/YfhF [Oceanicaulis alexandrii HTCC2633]
 gi|83853297|gb|EAP91149.1| HesB/YadR/YfhF [Oceanicaulis alexandrii HTCC2633]
          Length = 119

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 47/112 (41%), Positives = 77/112 (68%), Gaps = 3/112 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TEAA  R+K+++ +       +R+ +K GGCAG+EY++D V + P   D+ +E  GV
Sbjct: 9   VTLTEAAATRVKKLMADRD--LGYLRVGVKNGGCAGMEYVMDYVAE-PDPLDERVEDQGV 65

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           ++ +D+ SLL++LG +ID++   L++ FVF NPN+  ACGCG+SV +  A +
Sbjct: 66  EIVVDAKSLLFLLGAQIDYEVTPLHAKFVFRNPNETDACGCGESVTLVPAQV 117


>gi|163796144|ref|ZP_02190106.1| hypothetical protein BAL199_30237 [alpha proteobacterium BAL199]
 gi|159178603|gb|EDP63143.1| hypothetical protein BAL199_30237 [alpha proteobacterium BAL199]
          Length = 121

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 77/115 (66%), Gaps = 2/115 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNS-QGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M   +T+T+AA  R+++++  S +    G+R+ +K  GC+GL Y+++   D     +DL+
Sbjct: 5   MKAPITLTDAAAARVRDLMAKSPEDGVIGLRVGVKNTGCSGLSYVIEYAKDRK-KFEDLV 63

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           E  GV + ID  +++++LG+E+D+K +KL+SGFVF+NPN+   CGCG+S  +  A
Sbjct: 64  EDKGVSILIDPTAVMFILGSEMDYKEDKLFSGFVFNNPNETGRCGCGESFSVAAA 118


>gi|84515533|ref|ZP_01002895.1| iron-sulfur cluster assembly accessory protein [Loktanella
           vestfoldensis SKA53]
 gi|84510816|gb|EAQ07271.1| iron-sulfur cluster assembly accessory protein [Loktanella
           vestfoldensis SKA53]
          Length = 120

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 75/108 (69%), Gaps = 5/108 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           VT+TE A  +I  ++  ++   QG+RI +KKGGCAG+EY +  VTD +P+D  +++E+ G
Sbjct: 10  VTITEKAATQIARLM--AKDGHQGLRIGVKKGGCAGMEYTMAYVTDIDPLD--EVVEQQG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +V I   + +++ GTEID++T  L SGF F NPN V ACGCG+S++ 
Sbjct: 66  ARVMIAPMAQMFLFGTEIDYETSLLESGFKFRNPNVVDACGCGESIKF 113


>gi|329889576|ref|ZP_08267919.1| chain B, Crystal Structure Of Isca Native [Brevundimonas diminuta
           ATCC 11568]
 gi|328844877|gb|EGF94441.1| chain B, Crystal Structure Of Isca Native [Brevundimonas diminuta
           ATCC 11568]
          Length = 115

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 72/107 (67%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA  R++EI+ N++    G+R+ +K  GCAG EY      +  +  D+++E  GV
Sbjct: 1   MTLTDAAAARVREIMDNAEKDYVGLRVGVKNSGCAGQEYTF-AYAEEALPLDEVVEDKGV 59

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + I+  ++L+++GTEID++  KL S FVF NPN+  ACGCG+SV I
Sbjct: 60  TILIEPKAVLFLIGTEIDYEVTKLASKFVFRNPNETDACGCGESVTI 106


>gi|83951973|ref|ZP_00960705.1| iron-sulfur cluster assembly accessory protein [Roseovarius
           nubinhibens ISM]
 gi|83836979|gb|EAP76276.1| iron-sulfur cluster assembly accessory protein [Roseovarius
           nubinhibens ISM]
          Length = 116

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 76/109 (69%), Gaps = 5/109 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVD-GDDLIEKDG 63
           VTMT AA  +I +++  ++   QG+RI +KKGGCAG+EY +D VT+  VD  D+++E++G
Sbjct: 10  VTMTPAAAAQIAKLM--TKDGHQGLRIGVKKGGCAGMEYTMDYVTE--VDPNDEVVEQEG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
            ++ I   + +++ GTEID++   L SGF F+NPN   ACGCG+S+  +
Sbjct: 66  ARIMIAPMAQMFLFGTEIDYEVSLLESGFKFNNPNVTEACGCGESIRFE 114


>gi|149190099|ref|ZP_01868376.1| HesB family protein [Vibrio shilonii AK1]
 gi|148836129|gb|EDL53089.1| HesB family protein [Vibrio shilonii AK1]
          Length = 107

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 73/107 (68%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA  R++  + N +GK  G+R+ +K  GC+G+ Y+++ V D   DGD++ E +GV
Sbjct: 3   ISMTEAAASRVRTFLEN-RGKGIGLRLGVKTTGCSGMAYVLEFV-DELDDGDEVFEHEGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID+ SL+Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDAKSLVYLDGTELDYVKEGLNEGFEFNNPNAKGECGCGESFNV 107


>gi|126729654|ref|ZP_01745467.1| iron-sulfur cluster assembly accessory protein [Sagittula stellata
           E-37]
 gi|126709773|gb|EBA08826.1| iron-sulfur cluster assembly accessory protein [Sagittula stellata
           E-37]
          Length = 127

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 73/108 (67%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T  AV +I+ ++   +    G++I +KKGGCAG+EY +D V D     D+++E+DG 
Sbjct: 10  VTITPKAVSQIRRLM--ERDNRFGLKIGVKKGGCAGMEYTMDYV-DEAEGADEIVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           +V I   + +++ GTEID++T  L SGF F NPN V ACGCG+S++ K
Sbjct: 67  RVLIAPMAQMFLFGTEIDYETSLLESGFKFRNPNVVDACGCGESIKFK 114


>gi|89068858|ref|ZP_01156241.1| iron-sulfur cluster assembly accessory protein [Oceanicola
           granulosus HTCC2516]
 gi|89045628|gb|EAR51691.1| iron-sulfur cluster assembly accessory protein [Oceanicola
           granulosus HTCC2516]
          Length = 126

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 74/108 (68%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+ A  +I+ ++   +   QG+RI +KKGGCAG+EY +D   D+    D+++E+DG 
Sbjct: 10  VTITDRAAAQIRRLM--QRDGHQGLRIGVKKGGCAGMEYTMDFA-DSVDPNDEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           +V I   + +++ GTEID++T  L SGF F+NPN   +CGCG+S++ K
Sbjct: 67  RVMIAPMAQMFLFGTEIDYQTALLESGFKFNNPNVTDSCGCGESIKFK 114


>gi|149913783|ref|ZP_01902315.1| iron-sulfur cluster assembly accessory protein [Roseobacter sp.
           AzwK-3b]
 gi|149812067|gb|EDM71898.1| iron-sulfur cluster assembly accessory protein [Roseobacter sp.
           AzwK-3b]
          Length = 116

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/109 (44%), Positives = 77/109 (70%), Gaps = 5/109 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDG-DDLIEKDG 63
           V+MT  A  +I +++   +   QG+RI +KKGGCAG+EY ++ VT+  VD  D+++E++G
Sbjct: 10  VSMTTDAASQIAKLM--DRDGHQGLRIGVKKGGCAGMEYTMEYVTE--VDPHDEVVEQNG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
            +V I   + +++ GTEID+KT  L SGFVF+NPN   ACGCG+S++ +
Sbjct: 66  ARVMIAPMAQMFLFGTEIDYKTSLLESGFVFNNPNVTEACGCGESIKFE 114


>gi|330446682|ref|ZP_08310334.1| iron-sulfur cluster assembly protein IscA [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328490873|dbj|GAA04831.1| iron-sulfur cluster assembly protein IscA [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 107

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 72/107 (67%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA  R+   +  S+GK  G+R+ ++  GC+G+ Y+++ V D   +GD + E+ GV
Sbjct: 3   ITITEAAASRVSTFL-ASRGKGLGLRLGVRTSGCSGMAYILEFV-DELDEGDQVFEEKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D+ SL+Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIVDAKSLVYLEGTELDFAKEGLNEGFKFNNPNVSSECGCGESFNV 107


>gi|117620083|ref|YP_856285.1| iron-sulfur cluster assembly protein IscA [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117561490|gb|ABK38438.1| iron-sulfur cluster assembly protein IscA [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 107

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT+AA  R+   + N +GK  G+R+ +K  GC+GL Y+++ V D   D D + E+DGV
Sbjct: 3   ITMTDAAAARVSSFLTN-RGKGIGLRLGVKTTGCSGLAYVLEFV-DELADEDQVFEQDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D+ SL+++ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIVDAKSLIHLDGTELDFVKEGLNEGFQFNNPNAKGECGCGESFSV 107


>gi|189503018|gb|ACE06890.1| unknown [Schistosoma japonicum]
          Length = 168

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 72/107 (67%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T++AV R +E++     KA G+RI ++  GC GL Y +D   + P  GD+++E+D V
Sbjct: 63  LTLTKSAVARAQELL-RKNPKAIGLRIGVRTRGCNGLSYTLDFCFEGPQPGDEVVEQDSV 121

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +++ID  + L +LGTE+D++ + L S FVF+NPN    CGCG+S  +
Sbjct: 122 RIFIDRRAQLTLLGTEMDYQKDVLSSQFVFNNPNIKGTCGCGESFSV 168


>gi|29841436|gb|AAP06468.1| similar to CG8198 gene product in Drosophila melanogaster
           [Schistosoma japonicum]
 gi|164609131|gb|ABY62788.1| P16 protein [Schistosoma japonicum]
          Length = 168

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 72/107 (67%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T++AV R +E++     KA G+RI ++  GC GL Y +D   + P  GD+++E+D V
Sbjct: 63  LTLTKSAVARAQELL-RKNPKAIGLRIGVRTRGCNGLSYTLDFCFEGPQPGDEVVEQDSV 121

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +++ID  + L +LGTE+D++ + L S FVF+NPN    CGCG+S  +
Sbjct: 122 RIFIDRRAQLTLLGTEMDYQKDVLSSQFVFNNPNIKGTCGCGESFSV 168


>gi|254509959|ref|ZP_05122026.1| iron-sulfur cluster assembly accessory protein [Rhodobacteraceae
           bacterium KLH11]
 gi|221533670|gb|EEE36658.1| iron-sulfur cluster assembly accessory protein [Rhodobacteraceae
           bacterium KLH11]
          Length = 121

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMTE A  +I  ++    G   G+RI +KKGGCAG+EY +D V D     D+++E+DG 
Sbjct: 10  VTMTEKAAEQIVRLM--QSGGHVGLRIGVKKGGCAGMEYTMDYV-DEADPNDEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V I   + +++ GTEID++   L SGF F NPN V ACGCG+S++ 
Sbjct: 67  RVMIAPMAQMFLFGTEIDYEVSLLESGFKFRNPNVVDACGCGESIKF 113


>gi|15889020|ref|NP_354701.1| hypothetical protein Atu1713 [Agrobacterium tumefaciens str. C58]
 gi|15156811|gb|AAK87486.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 110

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++EAA  RI +IV    GK Q +R+S++ GGC+G  Y  DL  +NP D D +I +   
Sbjct: 6   ITLSEAAAKRIAQIVAADAGK-QALRVSVEGGGCSGFSYKFDL-AENPADDDIVIARGDA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS S++YM G+EIDF    L   F   NPN V++CGCG S  I
Sbjct: 64  KVLIDSMSVIYMAGSEIDFVDNLLGQSFQIKNPNAVASCGCGTSFSI 110


>gi|254486716|ref|ZP_05099921.1| iron-sulfur cluster assembly accessory protein [Roseobacter sp.
           GAI101]
 gi|214043585|gb|EEB84223.1| iron-sulfur cluster assembly accessory protein [Roseobacter sp.
           GAI101]
          Length = 115

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 73/107 (68%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T  A  +I +++  S G A G+RI +KKGGCAG+EY ++ V + P   D+++E+DG 
Sbjct: 11  VTITPKAATQISKLM-TSAGHA-GLRIGIKKGGCAGMEYTMEYVNE-PDANDEVVEQDGA 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V I   + +++ GTEID++T  L SGF F NPN   ACGCG+S++ 
Sbjct: 68  RVLIAPMAQMFLFGTEIDYETTLLESGFKFRNPNVTEACGCGESIKF 114


>gi|163739790|ref|ZP_02147198.1| iron-sulfur cluster assembly accessory protein [Phaeobacter
           gallaeciensis BS107]
 gi|163740997|ref|ZP_02148390.1| iron-sulfur cluster assembly accessory protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161385988|gb|EDQ10364.1| iron-sulfur cluster assembly accessory protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161387020|gb|EDQ11381.1| iron-sulfur cluster assembly accessory protein [Phaeobacter
           gallaeciensis BS107]
          Length = 119

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 73/108 (67%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+ A  +I +++   +G   G+RI +KKGGCAG+EY ++ V D P   D+++E+DG 
Sbjct: 10  VTITDKAAAQIAKLM--DKGGHSGLRIGVKKGGCAGMEYTMEYV-DQPDPNDEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           +V I   + +++ GTEID++   L +GF F+NPN   ACGCG+S+  K
Sbjct: 67  RVLIAPMAQMFLFGTEIDYEVSLLEAGFKFNNPNVSEACGCGESISFK 114


>gi|114798611|ref|YP_761301.1| iron-sulfur cluster assembly accessory protein [Hyphomonas
           neptunium ATCC 15444]
 gi|114738785|gb|ABI76910.1| iron-sulfur cluster assembly accessory protein [Hyphomonas
           neptunium ATCC 15444]
          Length = 119

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 76/108 (70%), Gaps = 5/108 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQG-IRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           V +++AA  R+K+I+     +  G +R+ +  GGCAG+EY++D  ++ P   D+++E +G
Sbjct: 10  VRLSDAAAERVKDIMAE---RGMGYLRVGVTNGGCAGMEYVMDYASE-PAALDEVVEDNG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V + ID+ ++L++LG+E+D++T  L+  FVF NPNQ  ACGCG+SV I
Sbjct: 66  VTILIDAKAVLFLLGSELDYETTLLHEKFVFRNPNQTDACGCGESVTI 113


>gi|182677105|ref|YP_001831251.1| iron-sulfur cluster assembly accessory protein [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182632988|gb|ACB93762.1| iron-sulfur cluster assembly accessory protein [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 124

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 75/112 (66%), Gaps = 3/112 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKD 62
           I+++T+ A  R +E++  +    + ++I +K GGCAG+ Y +DL+ +  P+D  ++IE  
Sbjct: 8   ILSLTDNAAARTRELLAQAGNADKLLKIGIKNGGCAGMSYTLDLIDELGPLD--EIIEDK 65

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           GV++ +    ++++LGT++DF T++L S F F NPNQ  +CGCG+SV I  A
Sbjct: 66  GVRLAVAPQDVMFLLGTQVDFVTDRLGSSFTFRNPNQTGSCGCGESVSITPA 117


>gi|170726131|ref|YP_001760157.1| iron-sulfur cluster assembly protein IscA [Shewanella woodyi ATCC
           51908]
 gi|169811478|gb|ACA86062.1| iron-sulfur cluster assembly protein IscA [Shewanella woodyi ATCC
           51908]
          Length = 107

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MT AA  R+K  + +S+GK  G+R+ LK  GC+G+ Y+++ V D   D D++ E DGV
Sbjct: 3   ISMTPAAAERVKSFL-DSRGKGIGLRLGLKTSGCSGMAYIIEFVDDLNAD-DEVYEIDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID+ S +Y+ G E+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIIDAKSFIYLQGIELDFVKEGLNEGFQFNNPNAKGECGCGESFTV 107


>gi|58267804|ref|XP_571058.1| iron ion transport-related protein [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134112309|ref|XP_775130.1| hypothetical protein CNBE4040 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257782|gb|EAL20483.1| hypothetical protein CNBE4040 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57227292|gb|AAW43751.1| iron ion transport-related protein, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 215

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 73/110 (66%), Gaps = 1/110 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           + +TMT  A+  ++E++  S  + + +RIS+K  GCAG+ Y +D V       D+++E+D
Sbjct: 106 NAITMTPTAISHLRELL-ASPTEPRLLRISVKSRGCAGMAYHLDYVPPPGGKFDEVVEQD 164

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           GV+V IDS +L  ++G+ +D++  +L +GFVF NPN V  CGCG+S  I+
Sbjct: 165 GVRVLIDSKALFSIIGSRMDWRDNRLSAGFVFDNPNVVDTCGCGESFNIR 214


>gi|89072691|ref|ZP_01159256.1| Putative hesB family protein [Photobacterium sp. SKA34]
 gi|89051511|gb|EAR56965.1| Putative hesB family protein [Photobacterium sp. SKA34]
          Length = 107

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D   +GD + E+ GV
Sbjct: 3   ITITEAAAGRVSTFLAN-RGKGLGLRLGVRTSGCSGMAYILEFV-DELDEGDQVFEEKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL+Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIVDPKSLVYLEGTELDFAKEGLNEGFQFNNPNVSSECGCGESFNV 107


>gi|328868087|gb|EGG16467.1| iron-sulfur cluster assembly 1 like protein [Dictyostelium
           fasciculatum]
          Length = 148

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 72/109 (66%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           + +MT++A+ +IKE++     K QG+R+ +K+ GC+GL+Y +D  +  P   D+++   G
Sbjct: 16  VFSMTDSAITKIKELMIKEGEKCQGLRLGVKQRGCSGLQYTLDFTSQPPNKLDEVVTDKG 75

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           + + +DS +L+ ++GTE+D+  E +   F+F NPN  + CGCG+S  +K
Sbjct: 76  ITIVVDSKALMSVIGTEMDYIEEPIKKEFIFINPNATNTCGCGESFTVK 124


>gi|254509345|ref|ZP_05121434.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           16]
 gi|219547741|gb|EED24777.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           16]
          Length = 107

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE A  R+K  + N +GK  G+R+ +K  GC+G+ Y+++ V D   + D + E DGV
Sbjct: 3   ITMTETAASRVKTFLDN-RGKGIGLRLGVKTTGCSGMAYVLEFV-DELNEEDSVFEHDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDQKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|321259375|ref|XP_003194408.1| iron ion transport-related protein [Cryptococcus gattii WM276]
 gi|317460879|gb|ADV22621.1| iron ion transport-related protein, putative [Cryptococcus gattii
           WM276]
          Length = 214

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 73/110 (66%), Gaps = 1/110 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           + +TMT  A+  ++E++  S  + + +RIS+K  GCAG+ Y +D V       D+++E+D
Sbjct: 105 NAITMTPTAISHLRELL-ASPTEPRLLRISVKSRGCAGMAYHLDYVPPPGGKFDEVVEQD 163

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           GV+V IDS +L  ++G+ +D++  +L +GFVF NPN V  CGCG+S  I+
Sbjct: 164 GVRVLIDSKALFSIIGSRMDWRDNRLSAGFVFDNPNVVDTCGCGESFNIR 213


>gi|163747025|ref|ZP_02154381.1| HesB-like iron-sulfur cluster assembly protein, putative
           [Oceanibulbus indolifex HEL-45]
 gi|161379586|gb|EDQ03999.1| HesB-like iron-sulfur cluster assembly protein, putative
           [Oceanibulbus indolifex HEL-45]
          Length = 124

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 72/107 (67%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMT  A  +I +++  S G A G+RI +KKGGCAG+EY +D V     + D+++E+DG 
Sbjct: 10  VTMTPKAAGQIAKLM-QSAGHA-GLRIGVKKGGCAGMEYTMDYVEATDPN-DEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V I   + +++ GTEID++T  L SGF F NPN   ACGCG+S++ 
Sbjct: 67  RVMIAPMAQMFLFGTEIDYETTLLESGFKFRNPNVTEACGCGESIKF 113


>gi|159044892|ref|YP_001533686.1| putative iron-binding protein iscA [Dinoroseobacter shibae DFL 12]
 gi|157912652|gb|ABV94085.1| putative iron-binding protein iscA [Dinoroseobacter shibae DFL 12]
          Length = 121

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/110 (44%), Positives = 72/110 (65%), Gaps = 3/110 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+ A   I +++  +QG  QG+RI +KKGGCAG+EY +D V D     D+++E    
Sbjct: 10  VTITDRAAAHIGKLM--AQGNKQGLRIGVKKGGCAGMEYTMDYV-DEIDPHDEVVETGEA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           +V I   + +++ GTEID++T  L SGF F NPN V ACGCG+S++   A
Sbjct: 67  RVMIAPMAQMFLFGTEIDYETSLLESGFKFRNPNVVDACGCGESIKFDEA 116


>gi|260771405|ref|ZP_05880330.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           furnissii CIP 102972]
 gi|260613531|gb|EEX38725.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           furnissii CIP 102972]
 gi|315180986|gb|ADT87900.1| HesB family protein [Vibrio furnissii NCTC 11218]
          Length = 107

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 72/107 (67%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+K  + N +GK  G+R+ +K  GC+G+ Y+++ V D   + D++ E  GV
Sbjct: 3   ITLTETAASRVKSYLDN-RGKGVGLRLGVKTTGCSGMAYVLEFV-DELNEEDEVFEDHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS SL+Y+ GT++D+K E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDSKSLVYLDGTQLDYKKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|163759457|ref|ZP_02166542.1| hypothetical protein HPDFL43_08897 [Hoeflea phototrophica DFL-43]
 gi|162283054|gb|EDQ33340.1| hypothetical protein HPDFL43_08897 [Hoeflea phototrophica DFL-43]
          Length = 111

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E+A  RIKEIV   QGK+  +R+S++ GGC+G  Y  DL  + P + D ++E+D  
Sbjct: 7   VTLSESAARRIKEIVSAEQGKS-ALRVSVEGGGCSGFSYKFDL-DNEPGEDDIVLERDDA 64

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V ID  SL+YM G+EIDF    +   F   NPN V++CGCG S  +
Sbjct: 65  RVLIDQVSLVYMAGSEIDFVDNLMGQAFQIKNPNAVASCGCGTSFSV 111


>gi|310815874|ref|YP_003963838.1| HesB/YadR/YfhF [Ketogulonicigenium vulgare Y25]
 gi|308754609|gb|ADO42538.1| HesB/YadR/YfhF [Ketogulonicigenium vulgare Y25]
          Length = 115

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 76/108 (70%), Gaps = 5/108 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           V++T AA  RI+ ++  + G A G+R+ +KKGGCAG+EY ++     NP+D  +++++DG
Sbjct: 10  VSLTPAAATRIRALM-ETAGHA-GLRLGVKKGGCAGMEYTMEYADQVNPLD--EIVDQDG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +V I   + +++ GTEIDF+   L++GF F+NPN V ACGCG+S++ 
Sbjct: 66  ARVMIAPMAQMFLFGTEIDFEDTLLHTGFKFNNPNVVEACGCGESIKF 113


>gi|163731410|ref|ZP_02138857.1| HesB-like iron-sulfur cluster assembly protein, putative
           [Roseobacter litoralis Och 149]
 gi|161394864|gb|EDQ19186.1| HesB-like iron-sulfur cluster assembly protein, putative
           [Roseobacter litoralis Och 149]
          Length = 114

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 73/107 (68%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T  A  ++ +++  S G A G+RI +KKGGCAG+EY ++ V D   + D+++E+DG 
Sbjct: 10  VTLTPKACAQVAKLM-QSAGHA-GLRIGIKKGGCAGMEYTMEYVEDTDPN-DEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V I   + +++ GTEID++T  L SGF F NPN   ACGCG+S++ 
Sbjct: 67  RVMIAPMAQMFLFGTEIDYETSLLESGFKFRNPNVTEACGCGESIKF 113


>gi|56697462|ref|YP_167830.1| iron-sulfur cluster assembly accessory protein [Ruegeria pomeroyi
           DSS-3]
 gi|56679199|gb|AAV95865.1| iron-sulfur cluster assembly accessory protein [Ruegeria pomeroyi
           DSS-3]
          Length = 124

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMT  A  +I  ++   +G   G+RI +KKGGCAG+EY +D V D     D+++E+DG 
Sbjct: 14  VTMTPRAATQIARLM--DKGGHTGLRIGVKKGGCAGMEYTMDYV-DQADPHDEVVEQDGA 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ I   + +++ GTEID++   L SGF F NPN V ACGCG+S++ 
Sbjct: 71  RILIAPMAQMFLFGTEIDYEVSLLESGFKFKNPNVVDACGCGESIKF 117


>gi|262195420|ref|YP_003266629.1| iron-sulfur cluster assembly accessory protein [Haliangium
           ochraceum DSM 14365]
 gi|262078767|gb|ACY14736.1| iron-sulfur cluster assembly accessory protein [Haliangium
           ochraceum DSM 14365]
          Length = 111

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 62/111 (55%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS+ +T+TE A   IK        +   IRI ++ GGC G  Y+ D V   P D D +  
Sbjct: 1   MSETITITETAASEIKRQQSKRGAEQAAIRIGIRGGGCTGFAYLFDWVDGAPKDTDKVFS 60

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GV V++D  S  Y+ GTE+DF+T  +  GF F+NPN    CGCG+SV+ 
Sbjct: 61  AHGVSVYVDPKSFNYLKGTELDFETSIMGHGFKFNNPNAKGTCGCGESVQF 111


>gi|325293098|ref|YP_004278962.1| iron-sulfur cluster assembly accessory protein [Agrobacterium sp.
           H13-3]
 gi|325060951|gb|ADY64642.1| iron-sulfur cluster assembly accessory protein [Agrobacterium sp.
           H13-3]
          Length = 110

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++EAA  RI +IV    GK Q +R+S++ GGC+G  Y  DL  D P D D +I +   
Sbjct: 6   ITLSEAAAKRIAQIVAADAGK-QALRVSVEGGGCSGFSYKFDLAED-PADDDIVIARGDA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS S++YM G+EIDF    L   F   NPN V++CGCG S  I
Sbjct: 64  KVLIDSLSVVYMAGSEIDFVDNLLGQSFQIKNPNAVASCGCGTSFSI 110


>gi|90579376|ref|ZP_01235186.1| Putative hesB family protein [Vibrio angustum S14]
 gi|90440209|gb|EAS65390.1| Putative hesB family protein [Vibrio angustum S14]
          Length = 107

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 72/107 (67%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D   +GD + ++ GV
Sbjct: 3   ITITEAAASRVSTFLAN-RGKGLGLRLGVRTSGCSGMAYILEFV-DELDEGDQVFDEKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D+ SL+Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIVDAKSLVYLDGTELDFAKEGLNEGFQFNNPNVSSECGCGESFNV 107


>gi|299755861|ref|XP_001828932.2| iron sulfur assembly protein 1 [Coprinopsis cinerea okayama7#130]
 gi|298411414|gb|EAU92939.2| iron sulfur assembly protein 1 [Coprinopsis cinerea okayama7#130]
          Length = 218

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 72/107 (67%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT  AV RI+ ++ NS    Q IRI ++  GCAG+ Y ++ V D P   D+++E+DGV
Sbjct: 113 LTMTPGAVERIR-MLLNSP-TPQLIRIGVRNKGCAGMSYHLEYV-DKPGKFDEVVEQDGV 169

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V IDS +L  ++G+E+D+K + L S FVF NPN   ACGCG+S  +
Sbjct: 170 RVLIDSKALFSIIGSEMDWKEDALSSKFVFKNPNIKDACGCGESFTV 216


>gi|126741369|ref|ZP_01757044.1| iron-sulfur cluster assembly accessory protein [Roseobacter sp.
           SK209-2-6]
 gi|126717535|gb|EBA14262.1| iron-sulfur cluster assembly accessory protein [Roseobacter sp.
           SK209-2-6]
          Length = 119

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 49/110 (44%), Positives = 72/110 (65%), Gaps = 3/110 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T  A  +I +++  S G A G+RI +KKGGCAG+EY ++ V D     D+++E+DG 
Sbjct: 10  VTLTPRAAAQITKLM-TSAGHA-GLRIGVKKGGCAGMEYTMEYV-DTADGNDEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           +V I   + +++ GTEID++   L SGF F NPN   ACGCG+S+  K A
Sbjct: 67  RVMIAPMAQMFLFGTEIDYEVSLLESGFKFKNPNVADACGCGESISFKEA 116


>gi|83943249|ref|ZP_00955709.1| iron-sulfur cluster assembly accessory protein [Sulfitobacter sp.
           EE-36]
 gi|83846257|gb|EAP84134.1| iron-sulfur cluster assembly accessory protein [Sulfitobacter sp.
           EE-36]
          Length = 114

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 73/107 (68%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T  A  +I +++  S G A G+RI +KKGGCAG+EY ++ V +   + D+++E+DG 
Sbjct: 10  VTITPKAANQITKLM-TSAGHA-GLRIGIKKGGCAGMEYTMEYVNEADAN-DEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V I   + +++ GTEID++T  L SGF F NPN   ACGCG+S++ 
Sbjct: 67  RVMIAPMAQMFLFGTEIDYETSLLESGFKFRNPNVTEACGCGESIKF 113


>gi|226946076|ref|YP_002801149.1| Iron-sulfur biogenesis protein [Azotobacter vinelandii DJ]
 gi|2271523|gb|AAC24474.1| IscA [Azotobacter vinelandii]
 gi|226721003|gb|ACO80174.1| Iron-sulfur biogenesis protein [Azotobacter vinelandii DJ]
          Length = 107

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMTEAA   I+  + + +GK +GIR+ ++  GC+GL Y+++ V D     D + E  GV
Sbjct: 3   VTMTEAAARHIRRSL-DGRGKGEGIRLGVRTSGCSGLAYVLEFV-DEVASEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  I
Sbjct: 61  KVIVDPKSLVYLDGTELDFVREGLNEGFKFNNPNVRGECGCGESFNI 107


>gi|126726304|ref|ZP_01742145.1| iron-sulfur cluster assembly accessory protein [Rhodobacterales
           bacterium HTCC2150]
 gi|126704167|gb|EBA03259.1| iron-sulfur cluster assembly accessory protein [Rhodobacterales
           bacterium HTCC2150]
          Length = 123

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 74/108 (68%), Gaps = 5/108 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           V++T  A  +I  ++   +   QG+RI +KKGGCAG+EY +D VT+ +P+D  +++E++G
Sbjct: 10  VSITPKAAAKIAALM--EKDTHQGLRIGVKKGGCAGMEYTMDYVTEIDPLD--EVVEQEG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +V I   + +++ GTEID++T  L SGF F NPN   ACGCG+S++ 
Sbjct: 66  ARVMIAPMAQMFLFGTEIDYETSLLESGFKFRNPNVTEACGCGESIKF 113


>gi|108760194|ref|YP_633159.1| iron-sulfur cluster assembly accessory protein [Myxococcus xanthus
           DK 1622]
 gi|108464074|gb|ABF89259.1| iron-sulfur cluster assembly accessory protein [Myxococcus xanthus
           DK 1622]
          Length = 113

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 73/107 (68%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+ ++AV R+KE++   Q    G+R+++K GGC+GL+Y ++  ++   + D + EKDGV
Sbjct: 8   ITIADSAVARLKELLEQRQTPEAGLRLAVKGGGCSGLQYSMEW-SEKSRERDKIFEKDGV 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V++D  S LY++GTE+ F+   + SGF   NPN  +ACGCG+S  +
Sbjct: 67  RVFVDPKSYLYLIGTELVFEQTLMASGFKLDNPNIKAACGCGESFSV 113


>gi|320539266|ref|ZP_08038936.1| FeS cluster assembly protein [Serratia symbiotica str. Tucson]
 gi|320030658|gb|EFW12667.1| FeS cluster assembly protein [Serratia symbiotica str. Tucson]
          Length = 107

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 74/107 (69%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TM+++A  R++  + + +GK  G+R++++  GC+G+ Y+++ V D   D D + E+ GV
Sbjct: 3   ITMSDSAAQRVQAFI-DKRGKGLGLRLAVRTSGCSGMAYVLEFV-DEINDDDIVFEEKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV+ID  SL+Y+ GTE+DF  E L  GF F+NPN +S CGCG+S  +
Sbjct: 61  KVFIDGKSLVYLDGTELDFVKEGLNEGFKFNNPNVLSECGCGESFNV 107


>gi|99080606|ref|YP_612760.1| HesB/YadR/YfhF [Ruegeria sp. TM1040]
 gi|99036886|gb|ABF63498.1| HesB/YadR/YfhF [Ruegeria sp. TM1040]
          Length = 117

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 73/108 (67%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMT  A  +I +++ N+ G A G+RI +KKGGCAG+EY ++ V D     D+++E+DG 
Sbjct: 10  VTMTPRAAAQISKLMENA-GHA-GLRIGVKKGGCAGMEYTMEYV-DVADPNDEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           +V I   + +++ GTEID++T  L S F F+NPN   ACGCG+S+  K
Sbjct: 67  RVLIAPMAQMFLFGTEIDYETTLLESSFKFNNPNVAEACGCGESISFK 114


>gi|330830078|ref|YP_004393030.1| HesB-like protein [Aeromonas veronii B565]
 gi|328805214|gb|AEB50413.1| HesB-like protein [Aeromonas veronii B565]
          Length = 107

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT+AA  R+   + N +GK  G+R+ +K  GC+GL Y+++ V D   D D + E+ GV
Sbjct: 3   ITMTDAAAARVSSFLAN-RGKGIGLRLGVKTTGCSGLAYVLEFV-DELTDEDQVFEQQGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D+ SL+++ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIVDAKSLIHLDGTELDFVKEGLNEGFQFNNPNAKGECGCGESFSV 107


>gi|145299541|ref|YP_001142382.1| iron-sulfur cluster assembly protein IscA [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142852313|gb|ABO90634.1| iron-sulfur cluster assembly protein IscA [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 107

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT+AA  R+   + N +GK  G+R+ +K  GC+GL Y+++ V D   D D + E++GV
Sbjct: 3   ITMTDAAAARVSSFLTN-RGKGIGLRLGVKTTGCSGLAYVLEFV-DELADEDQVFEQNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D+ SL+++ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  RIIVDAKSLIHLDGTELDFVKEGLNEGFQFNNPNAKGECGCGESFSV 107


>gi|254438110|ref|ZP_05051604.1| hypothetical protein OA307_2980 [Octadecabacter antarcticus 307]
 gi|198253556|gb|EDY77870.1| hypothetical protein OA307_2980 [Octadecabacter antarcticus 307]
          Length = 119

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 75/108 (69%), Gaps = 5/108 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           V++T+ A  +I +++  ++   QG+RI +KKGGCAG+EY +D V D +P+D  +++E+DG
Sbjct: 10  VSITDKAAIQIAKLM--AKEGNQGLRIGVKKGGCAGMEYTMDYVADVDPLD--EVVEQDG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +V I   + +++ GTEID++   L SGF F NPN   ACGCG+S++ 
Sbjct: 66  ARVMIAPMAQMFLFGTEIDYEVSLLESGFKFRNPNVTEACGCGESIKF 113


>gi|254450871|ref|ZP_05064308.1| HesB/YadR/YfhF [Octadecabacter antarcticus 238]
 gi|198265277|gb|EDY89547.1| HesB/YadR/YfhF [Octadecabacter antarcticus 238]
          Length = 119

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 75/108 (69%), Gaps = 5/108 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           V++T+ A  +I +++  ++   QG+RI +KKGGCAG+EY +D V D +P+D  +++E+DG
Sbjct: 10  VSITDKAAIQIAKLM--AKEGNQGLRIGVKKGGCAGMEYTMDYVADVDPLD--EVVEQDG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +V I   + +++ GTEID++   L SGF F NPN   ACGCG+S++ 
Sbjct: 66  ARVMIAPMAQMFLFGTEIDYEVSLLESGFKFRNPNVTEACGCGESIKF 113


>gi|126735579|ref|ZP_01751324.1| iron-sulfur cluster assembly accessory protein [Roseobacter sp.
           CCS2]
 gi|126714766|gb|EBA11632.1| iron-sulfur cluster assembly accessory protein [Roseobacter sp.
           CCS2]
          Length = 120

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 76/108 (70%), Gaps = 5/108 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           V++T+ A  +I +++   +   QG+RI +KKGGCAG+EY +D VT+ +P+D  +++E+DG
Sbjct: 10  VSITDKAAAQIAKLM--DKDGHQGLRIGVKKGGCAGMEYTMDYVTEVDPLD--EVVEQDG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +V I   + +++ GTEID++   L +GF F NPN V ACGCG+S++ 
Sbjct: 66  ARVMIAPMAQMFLFGTEIDYEVSLLEAGFKFRNPNVVDACGCGESIKF 113


>gi|26987580|ref|NP_743005.1| iron-sulfur cluster assembly protein IscA [Pseudomonas putida
           KT2440]
 gi|148546118|ref|YP_001266220.1| iron-sulfur cluster assembly protein IscA [Pseudomonas putida F1]
 gi|167031902|ref|YP_001667133.1| iron-sulfur cluster assembly protein IscA [Pseudomonas putida GB-1]
 gi|325272146|ref|ZP_08138577.1| iron-sulfur cluster assembly protein IscA [Pseudomonas sp. TJI-51]
 gi|24982256|gb|AAN66469.1|AE016276_4 iron-binding protein IscA [Pseudomonas putida KT2440]
 gi|148510176|gb|ABQ77036.1| iron-sulfur cluster assembly protein IscA [Pseudomonas putida F1]
 gi|166858390|gb|ABY96797.1| iron-sulfur cluster assembly protein IscA [Pseudomonas putida GB-1]
 gi|313497213|gb|ADR58579.1| IscA [Pseudomonas putida BIRD-1]
 gi|324102709|gb|EGC00125.1| iron-sulfur cluster assembly protein IscA [Pseudomonas sp. TJI-51]
          Length = 107

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   I+  + + +GK +GIR+ ++  GC+GL Y+++ V D   D D + E  GV
Sbjct: 3   ISMTEAAANHIRRSL-DGRGKGEGIRLGVRTTGCSGLAYVLEFV-DELADEDQVFENHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFVKEGLNEGFKFNNPNVRGECGCGESFNV 107


>gi|110680159|ref|YP_683166.1| HesB-like iron-sulfur cluster assembly protein, putative
           [Roseobacter denitrificans OCh 114]
 gi|109456275|gb|ABG32480.1| HesB-like iron-sulfur cluster assembly protein, putative
           [Roseobacter denitrificans OCh 114]
          Length = 114

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 73/107 (68%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T  A  ++ +++  S G A G+RI +KKGGCAG+EY ++ V D   + D+++E+DG 
Sbjct: 10  VTLTPKACAQVAKLM-ASAGHA-GLRIGIKKGGCAGMEYTMEYVEDADPN-DEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V I   + +++ GTEID++T  L SGF F NPN   ACGCG+S++ 
Sbjct: 67  RVMIAPMAQMFLFGTEIDYETSLLESGFKFRNPNVTEACGCGESIKF 113


>gi|83954384|ref|ZP_00963104.1| iron-sulfur cluster assembly accessory protein [Sulfitobacter sp.
           NAS-14.1]
 gi|83841421|gb|EAP80591.1| iron-sulfur cluster assembly accessory protein [Sulfitobacter sp.
           NAS-14.1]
          Length = 114

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 73/107 (68%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T  A  +I +++  S G A G+RI +KKGGCAG+EY ++ V +   + D+++E+DG 
Sbjct: 10  VTITPKAANQITKLM-TSAGHA-GLRIGIKKGGCAGMEYTMEYVNEADAN-DEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V I   + +++ GTEID++T  L SGF F NPN   ACGCG+S++ 
Sbjct: 67  RVMIAPMAQMFLFGTEIDYETSLLESGFKFRNPNVSEACGCGESIKF 113


>gi|229592450|ref|YP_002874569.1| HesB family protein [Pseudomonas fluorescens SBW25]
 gi|229364316|emb|CAY52061.1| HesB family protein [Pseudomonas fluorescens SBW25]
          Length = 107

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   I+    N +GK +GIR+ ++  GC+GL Y+++ V D  V+ D + E  G 
Sbjct: 3   ISMTEAAAQHIRR-SLNGRGKGEGIRLGVRTTGCSGLAYVLEFV-DEVVEEDQVFESHGE 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  I
Sbjct: 61  KVIIDPKSLTYLDGTELDFVKEGLNEGFKFNNPNVRGECGCGESFNI 107


>gi|86157022|ref|YP_463807.1| HesB/YadR/YfhF [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85773533|gb|ABC80370.1| HesB/YadR/YfhF [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 110

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 68/111 (61%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  + ++E A   IK +       A G+R+ +K GGC+GL Y +D   + P   D +IE
Sbjct: 1   MAAAIEISEKAAVHIKALGAQKGAPAGGLRLGVKGGGCSGLSYFIDWANE-PARFDQVIE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +DG +V++D  S +++ GT ID++   + +GFVF NPN  SACGCG+S  I
Sbjct: 60  RDGARVFVDPKSAVFLAGTVIDWQQTLMQTGFVFRNPNVKSACGCGESFTI 110


>gi|294677136|ref|YP_003577751.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           capsulatus SB 1003]
 gi|294475956|gb|ADE85344.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           capsulatus SB 1003]
          Length = 119

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 77/112 (68%), Gaps = 5/112 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           VT+T AAV +I E++  ++  A G RI +KKGGCAG+EY +++ ++ +P+D   ++E+  
Sbjct: 10  VTLTPAAVAQIAELM--AREGAAGFRIGVKKGGCAGMEYTMEIASEADPMD--IVVEEGP 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            +V I   + +++LGTEID++   L SGF F NPN V +CGCG+SV+ + A 
Sbjct: 66  ARVLIAPLAQMFLLGTEIDYEETMLESGFKFRNPNVVESCGCGESVKFRDAP 117


>gi|114771031|ref|ZP_01448471.1| iron-sulfur cluster assembly accessory protein [alpha
           proteobacterium HTCC2255]
 gi|114548313|gb|EAU51199.1| iron-sulfur cluster assembly accessory protein [alpha
           proteobacterium HTCC2255]
          Length = 116

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 75/109 (68%), Gaps = 5/109 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           +T+TE A  +I++++   QG  +G+R+ +KKGGCAG+EY +D V D +P   D++I ++G
Sbjct: 10  LTITETATAQIRKLM--EQGNKKGLRVGVKKGGCAGMEYTMDYVDDIDP--NDEIITQNG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
             V I   + +++ GTEID++   L +GF F+NPN   ACGCG+S++ +
Sbjct: 66  ATVMIAPMAQMFLFGTEIDYEVSLLEAGFKFNNPNVSEACGCGESIKFE 114


>gi|296112831|ref|YP_003626769.1| Fe-S cluster assembly protein IscA [Moraxella catarrhalis RH4]
 gi|295920525|gb|ADG60876.1| Fe-S cluster assembly protein IscA [Moraxella catarrhalis RH4]
 gi|326561073|gb|EGE11438.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           7169]
 gi|326561499|gb|EGE11843.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           46P47B1]
 gi|326565367|gb|EGE15545.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           12P80B1]
 gi|326566704|gb|EGE16843.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           103P14B1]
 gi|326567532|gb|EGE17647.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           BC1]
 gi|326569379|gb|EGE19439.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           BC8]
 gi|326571421|gb|EGE21436.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           BC7]
 gi|326575296|gb|EGE25224.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           CO72]
 gi|326576618|gb|EGE26525.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           101P30B1]
 gi|326577515|gb|EGE27395.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           O35E]
          Length = 106

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 69/108 (63%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T  A   IK+ + N +G   GIR+ ++  GC+GL Y+++ V D+P + D+  E  G
Sbjct: 1   MINLTTQAAQHIKDFLEN-RGSGVGIRVGVRTAGCSGLAYVLEFV-DDPNNSDERFESHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V V+ID  SL+Y+ G ++D+ TE L SGF F NPNQ   CGCG+S  +
Sbjct: 59  VSVFIDPKSLVYLNGLQMDYVTEGLNSGFKFTNPNQTGECGCGESFTV 106


>gi|197121046|ref|YP_002132997.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           sp. K]
 gi|220915739|ref|YP_002491043.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|196170895|gb|ACG71868.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           sp. K]
 gi|219953593|gb|ACL63977.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 110

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 70/111 (63%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  + ++E A  +IK +       A G+R+ +K GGC+GL Y +D  ++ P   D +IE
Sbjct: 1   MAAAIEISEKAAVQIKALGAQKGTPAGGLRLGVKGGGCSGLSYFIDW-SNEPARFDQVIE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +DG +V++D  S +++ GT ID++   + +GFVF NPN  SACGCG+S  I
Sbjct: 60  RDGARVFVDPKSAVFLAGTVIDWQQTLMQTGFVFRNPNVKSACGCGESFTI 110


>gi|209694308|ref|YP_002262236.1| iron-binding protein IscA (iron-sulfur cluster assembly protein)
           [Aliivibrio salmonicida LFI1238]
 gi|208008259|emb|CAQ78404.1| iron-binding protein IscA (iron-sulfur cluster assembly protein)
           [Aliivibrio salmonicida LFI1238]
          Length = 107

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 72/107 (67%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TEAA  R++  + N +GK  G+R+ ++  GC+G+ Y+++ V D+  + D++ EK GV
Sbjct: 3   ISVTEAAASRVQTFLEN-RGKGIGLRLGVRTSGCSGMAYILEFV-DDLNEEDEVFEKFGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL YM GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIIDPKSLAYMDGTELDFAKEGLNEGFKFNNPNVKSECGCGESFNV 107


>gi|127513243|ref|YP_001094440.1| iron-sulfur cluster assembly protein IscA [Shewanella loihica PV-4]
 gi|126638538|gb|ABO24181.1| iron-sulfur cluster assembly protein IscA [Shewanella loihica PV-4]
          Length = 107

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT AA  R++  + N +GK  G+R+ LK  GC+G+ Y+++ V D   D D++ E DGV
Sbjct: 3   ITMTPAAADRVRSFLAN-RGKGIGLRLGLKTSGCSGMAYVLEFV-DELNDDDEVYEIDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID+ S +Y+ G E+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIIDAKSFIYLQGIELDFVKEGLNEGFQFNNPNAKGECGCGESFTV 107


>gi|319783182|ref|YP_004142658.1| iron-sulfur cluster assembly accessory protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317169070|gb|ADV12608.1| iron-sulfur cluster assembly accessory protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 115

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/107 (49%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V MTEAA  RI  IV N  GK   +R+S++ GGC+G  Y  DLV D   D D  IEKDG 
Sbjct: 11  VDMTEAAAKRIARIVSNEAGK-TALRVSVEGGGCSGFSYKFDLV-DTRNDDDVAIEKDGA 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V ID  SL+YM G+ IDF  + +   F   NPN V++CGCG S  I
Sbjct: 69  TVLIDDLSLVYMGGSVIDFVDDLMGQSFQIRNPNAVASCGCGTSFSI 115


>gi|157371860|ref|YP_001479849.1| iron-sulfur cluster assembly protein [Serratia proteamaculans 568]
 gi|166973718|sp|A8GHY1|ISCA_SERP5 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|157323624|gb|ABV42721.1| iron-sulfur cluster assembly protein IscA [Serratia proteamaculans
           568]
          Length = 107

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 72/107 (67%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TM+++A  R++  + N++GK  G+R+ ++  GC+G+ Y+++ V D+  D D + E  GV
Sbjct: 3   ITMSDSAAQRVQAFM-NNRGKGLGLRLGVRTSGCSGMAYVLEFV-DDMNDDDIVFENKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDGKSLVYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFNV 107


>gi|323494807|ref|ZP_08099905.1| HesB family protein [Vibrio brasiliensis LMG 20546]
 gi|323310947|gb|EGA64113.1| HesB family protein [Vibrio brasiliensis LMG 20546]
          Length = 107

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE A  R++  + N +GK  G+R+ +K  GC+G+ Y+++ V D   + D + E +GV
Sbjct: 3   ITMTETAASRVRTFLEN-RGKGIGLRLGVKTTGCSGMAYVLEFV-DELNEEDSVFEHEGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDQKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|259418545|ref|ZP_05742462.1| iron-sulfur cluster assembly accessory protein [Silicibacter sp.
           TrichCH4B]
 gi|259344767|gb|EEW56621.1| iron-sulfur cluster assembly accessory protein [Silicibacter sp.
           TrichCH4B]
          Length = 117

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 71/108 (65%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMT  A  +I +++    G A G+RI +KKGGCAG+EY ++ V D     D+++E+DG 
Sbjct: 10  VTMTPRAAAQISKLM-EKAGHA-GLRIGIKKGGCAGMEYTMEYV-DAADPNDEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           +V I   + +++ GTEID++T  L S F F+NPN   ACGCG+S+  K
Sbjct: 67  RVLIAPMAQMFLFGTEIDYETTLLESSFKFNNPNVAEACGCGESISFK 114


>gi|255264501|ref|ZP_05343843.1| iron-sulfur cluster assembly accessory protein [Thalassiobium sp.
           R2A62]
 gi|255106836|gb|EET49510.1| iron-sulfur cluster assembly accessory protein [Thalassiobium sp.
           R2A62]
          Length = 118

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 75/108 (69%), Gaps = 5/108 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           V MT  A  +I +++  ++   +G+RI +KKGGCAG+EY ++ VT+ NP+D  +++E+DG
Sbjct: 10  VNMTPKAAAQISKLM--AKDGHEGLRIGVKKGGCAGMEYTMEYVTEVNPMD--EVVEQDG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            ++ I   + +++ GTEID++   L +GF F+NPN   ACGCG+S++ 
Sbjct: 66  ARIMIAPMAQMFLFGTEIDYEVSLLEAGFKFNNPNVTEACGCGESIKF 113


>gi|217979722|ref|YP_002363869.1| iron-sulfur cluster assembly accessory protein [Methylocella
           silvestris BL2]
 gi|217505098|gb|ACK52507.1| iron-sulfur cluster assembly accessory protein [Methylocella
           silvestris BL2]
          Length = 106

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 74/106 (69%), Gaps = 3/106 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKD 62
           ++ +T+ AV  +++ +  +  + +G+RI ++ GGCAGL+YM+ LV+D NP   D L+E+D
Sbjct: 1   MIQLTDGAVDAVRQAIEGAGAQVEGLRIMVEAGGCAGLKYMMGLVSDINP--NDILVERD 58

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           GVKV++D ASL ++ GT +DF +    +GF F+NP   ++C CG+S
Sbjct: 59  GVKVYVDEASLPHLYGTTVDFVSGLEGAGFTFNNPTATNSCSCGKS 104


>gi|16126101|ref|NP_420665.1| HesB/YadR/YfhF family protein [Caulobacter crescentus CB15]
 gi|13423299|gb|AAK23833.1| HesB/YadR/YfhF family protein [Caulobacter crescentus CB15]
          Length = 104

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 69/101 (68%), Gaps = 3/101 (2%)

Query: 15  IKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDN-PVDGDDLIEKDGVKVWIDSASL 73
           +KEI+  +     G+R+ +K GGCAG EY+ +   +  P+D  +++E  GV + I+  ++
Sbjct: 1   MKEIMDKADQPYAGLRVGVKNGGCAGQEYVFEYAKEKGPID--EVVEDKGVTILIEPKAV 58

Query: 74  LYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           L+++GTEID++  KL S FVFHNPN+  ACGCG+SV I+ A
Sbjct: 59  LFLVGTEIDYEVTKLSSKFVFHNPNETDACGCGESVTIQPA 99


>gi|84503027|ref|ZP_01001123.1| iron-sulfur cluster assembly accessory protein [Oceanicola
           batsensis HTCC2597]
 gi|84388571|gb|EAQ01443.1| iron-sulfur cluster assembly accessory protein [Oceanicola
           batsensis HTCC2597]
          Length = 116

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 77/110 (70%), Gaps = 3/110 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T  A  +I +++ +  G+ +G+RI +KKGGCAG+EY +D V D+    D+++E+DG 
Sbjct: 10  VSITPRAASQIVKLM-HRDGR-EGLRIGVKKGGCAGMEYTMDYV-DSIDPNDEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           +V I   + +++ GTEID++T  L SGF F+NPN V ACGCG+S++   +
Sbjct: 67  RVMIAPMAQMFLFGTEIDYETSLLESGFRFNNPNVVEACGCGESIKFAES 116


>gi|54307947|ref|YP_128967.1| putative hesB family protein [Photobacterium profundum SS9]
 gi|46912373|emb|CAG19165.1| Putative hesB family protein [Photobacterium profundum SS9]
          Length = 107

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 73/107 (68%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D+  + D++ E+ GV
Sbjct: 3   ITITEAAASRVATFLKN-RGKGFGLRLGVRTSGCSGMAYVLEFV-DDINEEDEVFEEKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ ID+ SL+Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  RIVIDAKSLVYLDGTELDFAKEGLNEGFQFNNPNVSSECGCGESFNV 107


>gi|303311467|ref|XP_003065745.1| Iron-sulfur cluster assembly accessory family protein [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240105407|gb|EER23600.1| Iron-sulfur cluster assembly accessory family protein [Coccidioides
           posadasii C735 delta SOWgp]
 gi|320039618|gb|EFW21552.1| iron-sulfur cluster assembly accessory protein Isa1 [Coccidioides
           posadasii str. Silveira]
          Length = 249

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 72/104 (69%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV +I+ ++  SQ   + IR+ +K  GC+GL Y ++ V + P   D+++E+DG+
Sbjct: 146 MTLTPAAVEQIRNLL--SQPDPKMIRVGVKNRGCSGLAYHLEFV-EKPAPFDEVVEQDGI 202

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV IDS +L  ++G+E+D++ +KL S FVF NPN    CGCG+S
Sbjct: 203 KVLIDSKALFSIIGSEMDWQEDKLASRFVFKNPNIKDECGCGES 246


>gi|119194195|ref|XP_001247701.1| hypothetical protein CIMG_01472 [Coccidioides immitis RS]
          Length = 249

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 72/104 (69%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV +I+ ++  SQ   + IR+ +K  GC+GL Y ++ V + P   D+++E+DG+
Sbjct: 146 MTLTPAAVEQIRNLL--SQPDPKMIRVGVKNRGCSGLAYHLEFV-EKPAPFDEVVEQDGI 202

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV IDS +L  ++G+E+D++ +KL S FVF NPN    CGCG+S
Sbjct: 203 KVLIDSKALFSIIGSEMDWQEDKLASRFVFKNPNIKDECGCGES 246


>gi|254476215|ref|ZP_05089601.1| iron-sulfur cluster assembly accessory protein [Ruegeria sp. R11]
 gi|214030458|gb|EEB71293.1| iron-sulfur cluster assembly accessory protein [Ruegeria sp. R11]
          Length = 119

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 72/108 (66%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+ A  +I +++   +G   G+RI +KKGGCAG+EY ++ V D     D+++E+DG 
Sbjct: 10  VTITDKAAAQIAKLM--DKGGHSGLRIGVKKGGCAGMEYTMEYV-DEADPNDEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           +V I   + +++ GTEID++   L +GF F+NPN   ACGCG+S+  K
Sbjct: 67  RVLIAPMAQMFLFGTEIDYEVSLLEAGFKFNNPNVAEACGCGESISFK 114


>gi|13471190|ref|NP_102759.1| hypothetical protein mlr1094 [Mesorhizobium loti MAFF303099]
 gi|14021934|dbj|BAB48545.1| mlr1094 [Mesorhizobium loti MAFF303099]
          Length = 115

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/107 (49%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V MTEAA  RI EIV    GK   +R+S++ GGC+G  Y  DLV D   D D  IEKDG 
Sbjct: 11  VDMTEAAARRIAEIVSGEAGK-TALRVSVEGGGCSGFSYKFDLV-DTRNDDDVAIEKDGA 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V ID  SL+YM G+ IDF  + +   F   NPN V++CGCG S  I
Sbjct: 69  TVLIDDLSLVYMGGSVIDFVDDLMGQSFQIRNPNAVASCGCGTSFSI 115


>gi|260433888|ref|ZP_05787859.1| iron-sulfur cluster assembly accessory protein [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417716|gb|EEX10975.1| iron-sulfur cluster assembly accessory protein [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 121

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T  A  +I  ++    G   G+RI +KKGGCAG+EY ++ V D     D+++E+DG 
Sbjct: 10  VTITPKAAEQIVRLM--KSGGHAGLRIGVKKGGCAGMEYTMEYV-DQADPNDEVVEQDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V I   + +++ GTEID++T  L SGF F NPN V ACGCG+S++ 
Sbjct: 67  RVMIAPMAQMFLFGTEIDYETTLLESGFKFKNPNVVDACGCGESIKF 113


>gi|270264743|ref|ZP_06193008.1| iron-binding protein IscA [Serratia odorifera 4Rx13]
 gi|270041426|gb|EFA14525.1| iron-binding protein IscA [Serratia odorifera 4Rx13]
          Length = 107

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TM+++A  R++  + N++GK  G+R+ ++  GC+G+ Y+++ V D   D D + E  GV
Sbjct: 3   ITMSDSAAQRVQAFM-NNRGKGLGLRLGVRTSGCSGMAYVLEFV-DEMNDDDIVFENKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDGKSLVYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFNV 107


>gi|253689398|ref|YP_003018588.1| iron-sulfur cluster assembly protein IscA [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|259493872|sp|C6DBI9|ISCA_PECCP RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|251755976|gb|ACT14052.1| iron-sulfur cluster assembly protein IscA [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 107

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++E+A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D+  DGD + E  G+
Sbjct: 3   ISLSESAAQRVSAFIAN-RGKGLGLRLGVRTSGCSGMAYVLEFV-DDLNDGDTVFEDKGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDGKSLVYLDGTELDFVKEGLNEGFKFNNPNSSGECGCGESFNV 107


>gi|317490856|ref|ZP_07949292.1| iron-sulfur cluster assembly protein IscA [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316920403|gb|EFV41726.1| iron-sulfur cluster assembly protein IscA [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 107

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++M++AA  R++  + N +GK  G+R+ ++  GC+G+ Y+++ V D P + D + E  GV
Sbjct: 3   ISMSDAAAQRVQTFLAN-RGKGYGLRLGVRTSGCSGMAYVLEFV-DAPNEDDVVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V +D  SL Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  RVIVDGKSLAYLDGTELDFVKEGLNEGFKFNNPNMTSECGCGESFNV 107


>gi|170723495|ref|YP_001751183.1| iron-sulfur cluster assembly protein IscA [Pseudomonas putida W619]
 gi|169761498|gb|ACA74814.1| iron-sulfur cluster assembly protein IscA [Pseudomonas putida W619]
          Length = 107

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   ++  +   +GK +GIR+ ++  GC+GL Y+++ V D   D D + E  GV
Sbjct: 3   ISMTEAAANHVRRSL-EGRGKGEGIRLGVRTTGCSGLAYVLEFV-DELADEDTVFENHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFVKEGLNEGFKFNNPNVRGECGCGESFNV 107


>gi|114570465|ref|YP_757145.1| iron-sulfur cluster assembly accessory protein [Maricaulis maris
           MCS10]
 gi|114340927|gb|ABI66207.1| iron-sulfur cluster assembly accessory protein [Maricaulis maris
           MCS10]
          Length = 109

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 72/112 (64%), Gaps = 4/112 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI- 59
           MS  VT++ +A  +IK I+  +Q  A  +RI +  GGC+G  Y  DL  D+ V+GDD+I 
Sbjct: 1   MSANVTLSASAAKQIKTII-AAQAAAGLLRIGVVGGGCSGFSYTFDL--DDAVNGDDMII 57

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           E+DG KV ID ASL ++ G+EID+  E + + F  HNPN  +ACGCG S  +
Sbjct: 58  ERDGAKVVIDEASLPFLDGSEIDYVDELIGASFKIHNPNATAACGCGTSFSV 109


>gi|90410862|ref|ZP_01218876.1| Putative hesB family protein [Photobacterium profundum 3TCK]
 gi|90328075|gb|EAS44386.1| Putative hesB family protein [Photobacterium profundum 3TCK]
          Length = 107

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 73/107 (68%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D+  + D++ E+ GV
Sbjct: 3   ITITEAAAGRVATFLEN-RGKGFGLRLGVRTSGCSGMAYVLEFV-DDINEEDEVFEEKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ ID+ SL+Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  RIVIDAKSLVYLDGTELDFAKEGLNEGFQFNNPNVSSECGCGESFNV 107


>gi|260912951|ref|ZP_05919436.1| iron-binding protein IscA [Pasteurella dagmatis ATCC 43325]
 gi|260632941|gb|EEX51107.1| iron-binding protein IscA [Pasteurella dagmatis ATCC 43325]
          Length = 107

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 72/108 (66%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           +++TEAA  R++  + N +GK  G+R+ +K  GC+GL Y+++ V + NP   D + E+ G
Sbjct: 3   ISLTEAAADRVRTFLTN-RGKGIGLRLGIKTSGCSGLAYVLEFVDELNP--DDQVFEQHG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VK+ +D+ SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 60  VKIIVDAKSLVYLDGTELDFAKEGLNEGFKFNNPNVKDQCGCGESFHV 107


>gi|332969114|gb|EGK08151.1| iron-sulfur cluster assembly protein IscA [Kingella kingae ATCC
           23330]
          Length = 106

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 71/108 (65%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+ A   I+  +   +GK +GIRI +K  GC+G+ Y ++ V +   + D + E+DG
Sbjct: 1   MITVTQNAAQHIQNFL-AKRGKGEGIRIGVKTSGCSGMAYTLEFVDEVQAE-DTVFEQDG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV+ID  SL+Y+ GT++D++ E L  GF F NPN   +CGCG+S  +
Sbjct: 59  VKVFIDPKSLVYLDGTQVDYQKEGLQEGFKFENPNVKESCGCGESFHV 106


>gi|312962914|ref|ZP_07777401.1| iron-sulfur cluster assembly protein IscA [Pseudomonas fluorescens
           WH6]
 gi|311282941|gb|EFQ61535.1| iron-sulfur cluster assembly protein IscA [Pseudomonas fluorescens
           WH6]
          Length = 107

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   I+  + N +GK +GIR+ ++  GC+GL Y+++ V D  V  D + E  G 
Sbjct: 3   ISMTEAAAQHIRRSL-NGRGKGEGIRLGVRTTGCSGLAYVLEFV-DEVVAEDQVFESHGE 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  I
Sbjct: 61  KVIIDPKSLTYLDGTELDFVKEGLNEGFKFNNPNVRGECGCGESFNI 107


>gi|261820561|ref|YP_003258667.1| iron-sulfur cluster assembly protein [Pectobacterium wasabiae
           WPP163]
 gi|261604574|gb|ACX87060.1| iron-sulfur cluster assembly protein IscA [Pectobacterium wasabiae
           WPP163]
          Length = 107

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++E+A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D+  DGD + E  GV
Sbjct: 3   ISLSESAAQRVSAFIAN-RGKGLGLRLGVRTSGCSGMAYVLEFV-DDLNDGDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDGKSLVYLDGTELDFVKEGLNEGFKFNNPNITGECGCGESFNV 107


>gi|86357444|ref|YP_469336.1| hypothetical protein RHE_CH01816 [Rhizobium etli CFN 42]
 gi|86281546|gb|ABC90609.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 110

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+++AA  RI  I+    GK+  +R+S++ GGC+G  Y  DL  D+P + D ++EK+  
Sbjct: 6   VTLSDAAAKRIASIIGAETGKS-ALRVSVEGGGCSGFSYKFDLA-DSPGEDDVVVEKNDA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS SL+YM G+EIDF    L   F   NPN V++CGCG S  I
Sbjct: 64  KVLIDSLSLVYMAGSEIDFVDNLLGQSFQIKNPNAVASCGCGTSFSI 110


>gi|104780231|ref|YP_606729.1| iron-sulfur cluster assembly protein IscA [Pseudomonas entomophila
           L48]
 gi|95109218|emb|CAK13915.1| iron-sulfur cluster assembly protein IscA [Pseudomonas entomophila
           L48]
          Length = 107

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   I+  + + +GK +GIR+ ++  GC+GL Y+++ V D   + D + E  GV
Sbjct: 3   ISMTEAAANHIRRSL-DGRGKGEGIRLGVRTTGCSGLAYVLEFV-DELAEEDQVFENHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFVKEGLNEGFKFNNPNVRGECGCGESFNV 107


>gi|114778700|ref|ZP_01453512.1| hypothetical protein SPV1_13532 [Mariprofundus ferrooxydans PV-1]
 gi|114551062|gb|EAU53624.1| hypothetical protein SPV1_13532 [Mariprofundus ferrooxydans PV-1]
          Length = 112

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 74/108 (68%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T+AA  R++E+V  SQ   +G+R++++  GC+GLEY++DL  + P +GD +   DG 
Sbjct: 8   VELTDAAKKRVRELV--SQAGCKGLRLAVRPAGCSGLEYLMDL-AEGPSEGDLVRVCDGF 64

Query: 65  KVWIDSASLLYML-GTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++++D+ S    L G  +DF+ + L SGFV++NPNQ  ACGCGQS  +
Sbjct: 65  ELYVDAPSYATALTGLRLDFQQDLLSSGFVYNNPNQKGACGCGQSFSV 112


>gi|308050468|ref|YP_003914034.1| iron-sulfur cluster assembly protein IscA [Ferrimonas balearica DSM
           9799]
 gi|307632658|gb|ADN76960.1| iron-sulfur cluster assembly protein IscA [Ferrimonas balearica DSM
           9799]
          Length = 107

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TEAA  R+K  + N +GK  G+R+ LK  GC+GL Y+++ V D+   GD++IE  GV
Sbjct: 3   ISLTEAAAERVKTYLKN-RGKGIGLRLGLKTSGCSGLAYVLEFV-DDLSPGDEVIEAQGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + ID+ SL+Y+ G E+D+  E L  GF F NPN    CGCG+S  +
Sbjct: 61  NLIIDAKSLVYLDGLEVDYVKEGLNEGFKFENPNAKGECGCGESFTV 107


>gi|24373819|ref|NP_717862.1| HesB/YadR/YfhF family protein [Shewanella oneidensis MR-1]
 gi|113970079|ref|YP_733872.1| iron-sulfur cluster assembly protein IscA [Shewanella sp. MR-4]
 gi|114047320|ref|YP_737870.1| iron-sulfur cluster assembly protein IscA [Shewanella sp. MR-7]
 gi|117920721|ref|YP_869913.1| iron-sulfur cluster assembly protein IscA [Shewanella sp. ANA-3]
 gi|24348217|gb|AAN55306.1|AE015668_7 HesB/YadR/YfhF family protein [Shewanella oneidensis MR-1]
 gi|113884763|gb|ABI38815.1| iron-sulfur cluster assembly protein IscA [Shewanella sp. MR-4]
 gi|113888762|gb|ABI42813.1| iron-sulfur cluster assembly protein IscA [Shewanella sp. MR-7]
 gi|117613053|gb|ABK48507.1| iron-sulfur cluster assembly protein IscA [Shewanella sp. ANA-3]
          Length = 107

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT AA  R++  + N +GK  G+R+ LK  GC+G+ Y+++ V D   D D++ + DGV
Sbjct: 3   ITMTPAATERVRSFLAN-RGKGIGLRLGLKTSGCSGMAYVLEFV-DALNDDDEVYDIDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID+ S +Y+ G E+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIIDAKSFIYLQGIELDFVKEGLNEGFQFNNPNAKGECGCGESFTV 107


>gi|261252069|ref|ZP_05944642.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           orientalis CIP 102891]
 gi|260935460|gb|EEX91449.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           orientalis CIP 102891]
          Length = 107

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE A  R++  + N +GK  G+R+ +K  GC+G+ Y+++ V D   + D + E  GV
Sbjct: 3   ITMTETAASRVRTFLDN-RGKGIGLRLGVKTTGCSGMAYVLEFV-DELNEEDSVFEHSGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|323499939|ref|ZP_08104898.1| HesB family protein [Vibrio sinaloensis DSM 21326]
 gi|323315180|gb|EGA68232.1| HesB family protein [Vibrio sinaloensis DSM 21326]
          Length = 107

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE A  R++  + N +GK  G+R+ +K  GC+G+ Y+++ V D   + D + E  GV
Sbjct: 3   ITMTETAASRVRTFLEN-RGKGIGLRLGVKTTGCSGMAYVLEFV-DELNEEDSVFEHAGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDQKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|260776730|ref|ZP_05885625.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607953|gb|EEX34218.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 107

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE A  R++  + N +GK  G+R+ +K  GC+G+ Y+++ V D   + D + E  GV
Sbjct: 3   ITMTETAASRVRTFLEN-RGKGIGLRLGVKTTGCSGMAYVLEFV-DELNEEDSVFEHSGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDQKSLAYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|91225148|ref|ZP_01260370.1| HesB family protein [Vibrio alginolyticus 12G01]
 gi|269965162|ref|ZP_06179296.1| hesB family protein [Vibrio alginolyticus 40B]
 gi|91190091|gb|EAS76362.1| HesB family protein [Vibrio alginolyticus 12G01]
 gi|269830148|gb|EEZ84375.1| hesB family protein [Vibrio alginolyticus 40B]
          Length = 107

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE+A  R++  + N +GK  G+R+ +K  GC+G+ Y+++ V D   + D++ E  GV
Sbjct: 3   ITMTESAASRVRAFLDN-RGKGIGLRLGVKTTGCSGMAYVLEFV-DELNEEDEVFELSGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIIDQKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|50122157|ref|YP_051324.1| iron-sulfur cluster assembly protein [Pectobacterium atrosepticum
           SCRI1043]
 gi|227329511|ref|ZP_03833535.1| iron-sulfur cluster assembly protein [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
 gi|81644319|sp|Q6D261|ISCA_ERWCT RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|49612683|emb|CAG76133.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 107

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++E+A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D+  DGD + E  GV
Sbjct: 3   ISLSESAAQRVSAFIAN-RGKGLGLRLGVRTSGCSGMAYVLEFV-DDLNDGDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDGKSLVYLDGTELDFVKEGLNEGFKFNNPNISGECGCGESFNV 107


>gi|59711226|ref|YP_204002.1| Fe-S cluster assembly protein IscA [Vibrio fischeri ES114]
 gi|197335386|ref|YP_002155376.1| iron-sulfur cluster assembly protein IscA [Vibrio fischeri MJ11]
 gi|59479327|gb|AAW85114.1| Fe-S cluster assembly protein IscA [Vibrio fischeri ES114]
 gi|197316876|gb|ACH66323.1| iron-sulfur cluster assembly protein IscA [Vibrio fischeri MJ11]
          Length = 107

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TEAA  R+++ + N +GK  G+R+ ++  GC+G+ Y+++ V D   + D + E+ GV
Sbjct: 3   ISVTEAAASRVQKFLEN-RGKGVGLRLGVRTSGCSGMAYILEFV-DELNEEDQVFEQFGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL YM GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIIDPKSLAYMDGTELDFAKEGLNEGFKFNNPNVKSECGCGESFNV 107


>gi|262395127|ref|YP_003286981.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           sp. Ex25]
 gi|262338721|gb|ACY52516.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           sp. Ex25]
          Length = 107

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE+A  R++  + N +GK  G+R+ +K  GC+G+ Y+++ V D   + D++ E  GV
Sbjct: 3   ITMTESAASRVRAFLDN-RGKGIGLRLGVKTTGCSGMAYVLEFV-DELNEEDEVFELSGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIIDKKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|229525396|ref|ZP_04414801.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae bv. albensis VL426]
 gi|229338977|gb|EEO03994.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae bv. albensis VL426]
          Length = 107

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 72/107 (67%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E A  R+K  + N +GK  G+R+ +K  GC+G+ Y+++ V D+  + D + E  GV
Sbjct: 3   VTLSETAASRVKTFLDN-RGKGIGLRLGVKTTGCSGMAYVLEFV-DDVNEEDHVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID+ S++Y+ GT++D+K E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDTKSMVYLDGTQLDYKKEGLNEGFEFNNPNVKSECGCGESFNV 107


>gi|27363904|ref|NP_759432.1| iron-sulfur cluster assembly protein IscA [Vibrio vulnificus CMCP6]
 gi|320157283|ref|YP_004189662.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           vulnificus MO6-24/O]
 gi|27360021|gb|AAO08959.1| iron-sulfur cluster assembly protein IscA [Vibrio vulnificus CMCP6]
 gi|319932595|gb|ADV87459.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           vulnificus MO6-24/O]
          Length = 107

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE A  R+K  + N +GK  G+R+ +K  GC+G+ Y+++ V D   + D++ E  GV
Sbjct: 3   VTLTETAASRVKAFLDN-RGKGVGLRLGVKTTGCSGMAYVLEFV-DELNEEDEVFEHSGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GT++D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDKKSLVYLDGTQLDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|251792925|ref|YP_003007651.1| iron-sulfur cluster assembly protein IscA [Aggregatibacter
           aphrophilus NJ8700]
 gi|247534318|gb|ACS97564.1| iron-sulfur cluster assembly protein IscA [Aggregatibacter
           aphrophilus NJ8700]
          Length = 107

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE+A  R+K  +   +GK  G+R+ +K  GC+GL YM++ V D   + D + E+ GV
Sbjct: 3   ITLTESAADRVKTFL-EKRGKGIGLRLGIKTSGCSGLSYMLEFV-DTLNEDDQVFEQHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D+ SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVIVDTKSLVYLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFNV 107


>gi|15640769|ref|NP_230399.1| hesB family protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|147674050|ref|YP_001216235.1| HesB/YadR/YfhF family protein [Vibrio cholerae O395]
 gi|153216256|ref|ZP_01950356.1| HesB/YadR/YfhF family protein [Vibrio cholerae 1587]
 gi|153800576|ref|ZP_01955162.1| HesB/YadR/YfhF family protein [Vibrio cholerae MZO-3]
 gi|153817291|ref|ZP_01969958.1| HesB/YadR/YfhF family protein [Vibrio cholerae NCTC 8457]
 gi|153822717|ref|ZP_01975384.1| HesB/YadR/YfhF family protein [Vibrio cholerae B33]
 gi|153824624|ref|ZP_01977291.1| HesB/YadR/YfhF family protein [Vibrio cholerae MZO-2]
 gi|153829407|ref|ZP_01982074.1| HesB/YadR/YfhF family protein [Vibrio cholerae 623-39]
 gi|227080929|ref|YP_002809480.1| hesB family protein [Vibrio cholerae M66-2]
 gi|229505636|ref|ZP_04395146.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae BX 330286]
 gi|229510692|ref|ZP_04400171.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae B33]
 gi|229513111|ref|ZP_04402577.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae TMA 21]
 gi|229517814|ref|ZP_04407258.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae RC9]
 gi|229523427|ref|ZP_04412834.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae TM 11079-80]
 gi|229530120|ref|ZP_04419510.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae 12129(1)]
 gi|229608654|ref|YP_002879302.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae MJ-1236]
 gi|254225015|ref|ZP_04918629.1| HesB/YadR/YfhF family protein [Vibrio cholerae V51]
 gi|254285468|ref|ZP_04960432.1| HesB/YadR/YfhF family protein [Vibrio cholerae AM-19226]
 gi|254847887|ref|ZP_05237237.1| HesB/YadR/YfhF family protein [Vibrio cholerae MO10]
 gi|258619949|ref|ZP_05714989.1| hesB family protein [Vibrio mimicus VM573]
 gi|258627180|ref|ZP_05721968.1| hesB family protein [Vibrio mimicus VM603]
 gi|261212150|ref|ZP_05926436.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           sp. RC341]
 gi|262161309|ref|ZP_06030420.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae INDRE 91/1]
 gi|262168802|ref|ZP_06036497.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae RC27]
 gi|262172179|ref|ZP_06039857.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           mimicus MB-451]
 gi|262190468|ref|ZP_06048719.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae CT 5369-93]
 gi|262402865|ref|ZP_06079426.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           sp. RC586]
 gi|297581149|ref|ZP_06943073.1| HesB/YadR/YfhF family protein [Vibrio cholerae RC385]
 gi|298499117|ref|ZP_07008924.1| iron-sulfur cluster assembly protein IscA [Vibrio cholerae MAK 757]
 gi|9655195|gb|AAF93915.1| hesB family protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|124114401|gb|EAY33221.1| HesB/YadR/YfhF family protein [Vibrio cholerae 1587]
 gi|124123865|gb|EAY42608.1| HesB/YadR/YfhF family protein [Vibrio cholerae MZO-3]
 gi|125622402|gb|EAZ50722.1| HesB/YadR/YfhF family protein [Vibrio cholerae V51]
 gi|126512207|gb|EAZ74801.1| HesB/YadR/YfhF family protein [Vibrio cholerae NCTC 8457]
 gi|126519748|gb|EAZ76971.1| HesB/YadR/YfhF family protein [Vibrio cholerae B33]
 gi|146315933|gb|ABQ20472.1| HesB/YadR/YfhF family protein [Vibrio cholerae O395]
 gi|148875127|gb|EDL73262.1| HesB/YadR/YfhF family protein [Vibrio cholerae 623-39]
 gi|149741842|gb|EDM55871.1| HesB/YadR/YfhF family protein [Vibrio cholerae MZO-2]
 gi|150424330|gb|EDN16267.1| HesB/YadR/YfhF family protein [Vibrio cholerae AM-19226]
 gi|227008817|gb|ACP05029.1| hesB family protein [Vibrio cholerae M66-2]
 gi|227012574|gb|ACP08784.1| hesB family protein [Vibrio cholerae O395]
 gi|229333894|gb|EEN99380.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae 12129(1)]
 gi|229339790|gb|EEO04805.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae TM 11079-80]
 gi|229344529|gb|EEO09503.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae RC9]
 gi|229350004|gb|EEO14958.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae TMA 21]
 gi|229350657|gb|EEO15598.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae B33]
 gi|229357859|gb|EEO22776.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae BX 330286]
 gi|229371309|gb|ACQ61732.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae MJ-1236]
 gi|254843592|gb|EET22006.1| HesB/YadR/YfhF family protein [Vibrio cholerae MO10]
 gi|258580482|gb|EEW05443.1| hesB family protein [Vibrio mimicus VM603]
 gi|258587682|gb|EEW12391.1| hesB family protein [Vibrio mimicus VM573]
 gi|260838758|gb|EEX65409.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           sp. RC341]
 gi|261893255|gb|EEY39241.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           mimicus MB-451]
 gi|262022920|gb|EEY41626.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae RC27]
 gi|262029059|gb|EEY47712.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae INDRE 91/1]
 gi|262033640|gb|EEY52129.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae CT 5369-93]
 gi|262351647|gb|EEZ00780.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           sp. RC586]
 gi|297534465|gb|EFH73302.1| HesB/YadR/YfhF family protein [Vibrio cholerae RC385]
 gi|297543450|gb|EFH79500.1| iron-sulfur cluster assembly protein IscA [Vibrio cholerae MAK 757]
 gi|327483536|gb|AEA77943.1| Iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae LMA3894-4]
          Length = 107

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 72/107 (67%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E A  R+K  + N +GK  G+R+ +K  GC+G+ Y+++ V D+  + D + E  GV
Sbjct: 3   VTLSETAASRVKTFLDN-RGKGIGLRLGVKTTGCSGMAYVLEFV-DDLNEEDHVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID+ S++Y+ GT++D+K E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDTKSMVYLDGTQLDYKKEGLNEGFEFNNPNVKSECGCGESFNV 107


>gi|294788954|ref|ZP_06754194.1| iron-sulfur cluster assembly protein IscA [Simonsiella muelleri
           ATCC 29453]
 gi|294483056|gb|EFG30743.1| iron-sulfur cluster assembly protein IscA [Simonsiella muelleri
           ATCC 29453]
          Length = 106

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 71/109 (65%), Gaps = 4/109 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKD 62
           ++T+TE A   I+  +   +GK +GIRI +K  GC+G+ Y ++ V  + +D DD + E+ 
Sbjct: 1   MITVTENAASHIQNFLVK-RGKGEGIRIGVKTSGCSGMAYTLEFV--DEIDSDDTVFEQS 57

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVK++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 58  GVKIFIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKESCGCGESFHV 106


>gi|320583425|gb|EFW97638.1| iron sulfur assembly-related protein [Pichia angusta DL-1]
          Length = 190

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 73/108 (67%), Gaps = 3/108 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           +  ++T+T  A+  +K+++   Q   + IRIS++  GC+GL Y ++ V+ +P   D+ +E
Sbjct: 83  LKSVITLTPNAILHLKQLM--QQPDPKLIRISVRNRGCSGLSYHLEYVS-HPEKFDEQVE 139

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +DGVKV IDS +L  ++G+E+D+  +KL S FVF NPN   +CGCG+S
Sbjct: 140 QDGVKVLIDSKALFSIIGSEMDWIDDKLSSKFVFKNPNSKGSCGCGES 187


>gi|254463149|ref|ZP_05076565.1| iron-sulfur cluster assembly accessory protein [Rhodobacterales
           bacterium HTCC2083]
 gi|206679738|gb|EDZ44225.1| iron-sulfur cluster assembly accessory protein [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 128

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 60/85 (70%), Gaps = 1/85 (1%)

Query: 28  GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEIDFKTEK 87
           G+RI +KKGGCAG+EY +D V D     D+L+E++G +V I   + +++ GTEID++T  
Sbjct: 31  GLRIGVKKGGCAGMEYTMDYV-DEVDKNDELVEQNGARVMIAPMAQMFLFGTEIDYETSL 89

Query: 88  LYSGFVFHNPNQVSACGCGQSVEIK 112
           L SGF F NPN   ACGCG+S++ K
Sbjct: 90  LESGFKFRNPNVTDACGCGESIKFK 114


>gi|261867569|ref|YP_003255491.1| iron-sulfur cluster assembly protein IscA [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412901|gb|ACX82272.1| iron-sulfur cluster assembly protein IscA [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 107

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE+A  R+K  +   +GK  G+R+ +K  GC+GL YM++ V D   + D + E+ GV
Sbjct: 3   ITLTESAADRVKTFL-AKRGKGIGLRLGVKTSGCSGLSYMLEFV-DALNEDDQVFEQHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D+ SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVIVDTKSLVYLDGTQLDFTKEGLNEGFKFANPNVKDECGCGESFNV 107


>gi|209549081|ref|YP_002280998.1| iron-sulfur cluster assembly accessory protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534837|gb|ACI54772.1| iron-sulfur cluster assembly accessory protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 110

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+++AA  RI  IV    GK+  +R+S++ GGC+G  Y  DL  D+  D D ++EK+  
Sbjct: 6   VTLSDAAAKRIAAIVGAEAGKS-ALRVSVEGGGCSGFSYKFDL-ADSAGDDDVVVEKNDA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS SL+YM G+EIDF    L   F   NPN V++CGCG S  I
Sbjct: 64  KVLIDSLSLVYMAGSEIDFVDNLLGQSFQIKNPNAVASCGCGTSFSI 110


>gi|197285713|ref|YP_002151585.1| iron-binding protein [Proteus mirabilis HI4320]
 gi|227356224|ref|ZP_03840613.1| HesB family protein [Proteus mirabilis ATCC 29906]
 gi|226711597|sp|B4EZU6|ISCA_PROMH RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|194683200|emb|CAR43851.1| iron-binding protein (iron-sulfur cluster assembly protein)
           [Proteus mirabilis HI4320]
 gi|227163688|gb|EEI48604.1| HesB family protein [Proteus mirabilis ATCC 29906]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TEAA  R++  + N +GK +G+R+ ++  GC+G+ Y+++   D   D D + E  GV
Sbjct: 3   ISLTEAAANRVRSFLAN-RGKGEGLRLGVRTSGCSGMAYVLEF-ADVINDEDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  S++Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  KVIIDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVANECGCGESFTV 107


>gi|315125529|ref|YP_004067532.1| Fe-S cluster assembly/activation protein [Pseudoalteromonas sp.
           SM9913]
 gi|315014042|gb|ADT67380.1| Fe-S cluster assembly/activation protein [Pseudoalteromonas sp.
           SM9913]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+AA  R++  + N +GK  G+R+ +K  GC+GL Y+++ V D   D D+     GV
Sbjct: 3   VTLTDAAANRVQSFLAN-RGKGIGLRVGIKTTGCSGLAYVLEFV-DELNDDDETFAAKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D+ SL+Y+ GTE+D+  E L  GF F+NPNQ   CGCG+S  +
Sbjct: 61  TLIVDAKSLVYIDGTELDYTKEGLNEGFKFNNPNQADECGCGESFTV 107


>gi|332532353|ref|ZP_08408233.1| iron binding protein IscA for iron-sulfur cluster assembly
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038220|gb|EGI74666.1| iron binding protein IscA for iron-sulfur cluster assembly
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+AA  R++  + N +GK  G+R+ +K  GC+GL Y+++ V D   D D+     GV
Sbjct: 3   VTLTDAAANRVQSFLAN-RGKGLGLRVGIKTTGCSGLAYVLEFVDDLNED-DETFAAKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D+ SL+Y+ GTE+D+  E L  GF F+NPNQ   CGCG+S  +
Sbjct: 61  TLIVDAKSLVYIDGTELDYTKEGLNEGFKFNNPNQADECGCGESFTV 107


>gi|227112702|ref|ZP_03826358.1| iron-sulfur cluster assembly protein [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++E A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D+  DGD + E  GV
Sbjct: 3   ISLSENAAQRVNAFIAN-RGKGLGLRLGVRTSGCSGMAYVLEFV-DDLNDGDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDGKSLVYLDGTELDFVKEGLNEGFKFNNPNISGECGCGESFNV 107


>gi|15892651|ref|NP_360365.1| hesB protein [Rickettsia conorii str. Malish 7]
 gi|15619822|gb|AAL03266.1| hesB protein [Rickettsia conorii str. Malish 7]
          Length = 110

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 72/111 (64%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T++A  +IK ++        GIR+ +K GGCAG  Y V+   D+    D+++E
Sbjct: 1   MKNVISLTDSAAKQIKLLIEKRAKPTFGIRVGVKSGGCAGQTYYVEYA-DSKNQFDEVVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+E+D+   K  S F F NPN+ ++CGCG+S  +
Sbjct: 60  EKGVRILIDPKALMYILGSEMDYVETKFKSQFTFTNPNEKASCGCGKSFRV 110


>gi|15604345|ref|NP_220861.1| HESB protein (hesB2) [Rickettsia prowazekii str. Madrid E]
 gi|6647953|sp|Q9ZD62|Y484_RICPR RecName: Full=Uncharacterized protein RP484
 gi|3861037|emb|CAA14937.1| HESB PROTEIN (hesB2) [Rickettsia prowazekii]
 gi|292572099|gb|ADE30014.1| Iron-sulfur cluster assembly accessory protein [Rickettsia
           prowazekii Rp22]
          Length = 110

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 70/111 (63%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T+AA  ++K ++        GIR+ +K GGCAG  Y V+   DN    D+++E
Sbjct: 1   MKNVISLTDAAAKQVKLLIEKRAKPTFGIRVGIKSGGCAGQTYYVEYA-DNKNQFDEVVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+E+D+      S F F NPN+ + CGCG+S  +
Sbjct: 60  EKGVRILIDPKTLMYILGSEMDYVETNFKSQFTFTNPNEKANCGCGKSFSV 110


>gi|15602185|ref|NP_245257.1| hypothetical protein PM0320 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720557|gb|AAK02404.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 71/108 (65%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           +++TE A  R++  + N +GK  G+R+ +K  GC+GL Y+++ V + NP D   + E+ G
Sbjct: 3   ISLTETAADRVRTFLAN-RGKGIGLRLGIKTSGCSGLAYVLEFVDELNPED--QVFEQHG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VK+ +D+ SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 60  VKIIVDAKSLVYLDGTELDFAKEGLNEGFKFNNPNVKDQCGCGESFHV 107


>gi|119774432|ref|YP_927172.1| HesB/YadR/YfhF family protein [Shewanella amazonensis SB2B]
 gi|119766932|gb|ABL99502.1| HesB/YadR/YfhF family protein [Shewanella amazonensis SB2B]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MT AA  R+K  + N +GK  G+R+ LK  GC+G+ Y+++ V D+  D D++ E DGV
Sbjct: 3   ISMTPAANERVKAFLAN-RGKGVGLRLGLKTSGCSGMAYVLEFV-DDLNDDDEVYEIDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + ID+ S +Y+ G E+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  NIIIDAKSFIYLQGIELDFVKEGLNEGFKFNNPNAKGECGCGESFTV 107


>gi|293390588|ref|ZP_06634922.1| iron-sulfur cluster assembly protein IscA [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951122|gb|EFE01241.1| iron-sulfur cluster assembly protein IscA [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 107

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE+A  R+++ +   +GK  G+R+ +K  GC+GL YM++ V D   + D + E+ GV
Sbjct: 3   ITLTESAADRVRKFL-AKRGKGIGLRLGVKTSGCSGLSYMLEFV-DALNEDDQVFEQHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D+ SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVIVDTKSLVYLDGTQLDFAKEGLNEGFKFANPNVKDECGCGESFNV 107


>gi|72069971|ref|XP_798918.1| PREDICTED: similar to CG8198-PA [Strongylocentrotus purpuratus]
 gi|115702932|ref|XP_001200190.1| PREDICTED: similar to CG8198-PA [Strongylocentrotus purpuratus]
          Length = 129

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AAV +IK +V N + + +G+R+ +K  GC GL Y +D   +     D+ + +DGV
Sbjct: 25  LVLTQAAVEKIKTLVIN-KSEVEGLRVGVKTRGCNGLSYTLDYAKEKQ-KFDEEVVQDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K++IDS + L +LGTE+DF   KL S FVF+NPN    CGCG+S  +
Sbjct: 83  KIFIDSKAQLTLLGTEMDFVNTKLSSEFVFNNPNIKGTCGCGESFNV 129


>gi|93006482|ref|YP_580919.1| iron-sulfur cluster assembly protein IscA [Psychrobacter
           cryohalolentis K5]
 gi|92394160|gb|ABE75435.1| iron-sulfur cluster assembly protein IscA [Psychrobacter
           cryohalolentis K5]
          Length = 106

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ MTE A   ++E + N +GK +GIR+ ++  GC+GL Y+++ V D P + D   E  G
Sbjct: 1   MIEMTERAAQHVREFLDN-RGKGEGIRVGIRTAGCSGLAYVLEFV-DTPDENDTRYESLG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V ++ID  SL+Y+ G  +D++ E L  GF F NPNQ   CGCG+S  +
Sbjct: 59  VSIFIDPKSLVYLDGLLMDYEKEGLNEGFKFSNPNQKGECGCGESFTV 106


>gi|269214368|ref|ZP_06158536.1| iron-sulfur cluster assembly protein IscA [Neisseria lactamica ATCC
           23970]
 gi|313668527|ref|YP_004048811.1| HesB-like protein [Neisseria lactamica ST-640]
 gi|269209929|gb|EEZ76384.1| iron-sulfur cluster assembly protein IscA [Neisseria lactamica ATCC
           23970]
 gi|313005989|emb|CBN87448.1| HesB-like protein [Neisseria lactamica 020-06]
          Length = 126

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 71/110 (64%), Gaps = 4/110 (3%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EK 61
           +++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V +   DGDDLI E+
Sbjct: 20  NMITLTENAAKHINDYL-AKRGKGLGVRLGVKTSGCSGMAYNLEFVDE--ADGDDLIFEE 76

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 77  HGARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 126


>gi|113460429|ref|YP_718491.1| HesB-family protein [Haemophilus somnus 129PT]
 gi|112822472|gb|ABI24561.1| HesB-family protein [Haemophilus somnus 129PT]
          Length = 107

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA  R++  +   +GK  G+R+ +K  GC+GL Y+++ V D   + D++ E+DGV
Sbjct: 3   ITLTQAAANRVRTFL-EKRGKGIGLRLGIKTSGCSGLAYVLEFV-DILNEDDEVFEQDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVIVDRKSLVYLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFNV 107


>gi|170717818|ref|YP_001783509.1| iron-sulfur cluster assembly protein IscA [Haemophilus somnus 2336]
 gi|168825947|gb|ACA31318.1| iron-sulfur cluster assembly protein IscA [Haemophilus somnus 2336]
          Length = 107

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA  R++  +   +GK  G+R+ +K  GC+GL Y+++ V D   + D++ E+DGV
Sbjct: 3   ITLTQAAANRVRTFL-EKRGKGIGLRLGIKTSGCSGLAYVLEFV-DVLNEDDEVFEQDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVIVDHKSLVYLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFNV 107


>gi|117926632|ref|YP_867249.1| iron-sulfur cluster assembly accessory protein [Magnetococcus sp.
           MC-1]
 gi|117610388|gb|ABK45843.1| iron-sulfur cluster assembly accessory protein [Magnetococcus sp.
           MC-1]
          Length = 114

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 63/107 (58%), Gaps = 1/107 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  AV   K  +  S+    G+R+ +  GGC+G  Y V+L     VDGD+LI  DGVK+
Sbjct: 4   LTPGAVKAAKRFIRYSEEPVLGLRVGINSGGCSGFRYEVELC-KALVDGDELITIDGVKI 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
           + D  S+ Y+ G  IDFK   + S FVF NPN  S+CGCG S EI +
Sbjct: 63  YTDPVSIPYIKGMTIDFKETMMESKFVFDNPNASSSCGCGNSFEIHQ 109


>gi|144899511|emb|CAM76375.1| HesB/YadR/YfhF [Magnetospirillum gryphiswaldense MSR-1]
          Length = 112

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 70/111 (63%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +T+TE+A  R++ ++      + GIRI ++  GC+G++Y ++   D     D+++E
Sbjct: 3   MKAPITITESAAQRVRAMLDKRGKPSAGIRIGVRSKGCSGMQYTLEYA-DEKSPFDEVVE 61

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + G+ V ID  + +++ GTE+D+  EK+ SGFVF NPN+   CGCG+S  +
Sbjct: 62  QGGITVLIDPKAAMFIFGTEMDWVEEKMQSGFVFRNPNEKGRCGCGESFHV 112


>gi|221066574|ref|ZP_03542679.1| iron-sulfur cluster assembly protein IscA [Comamonas testosteroni
           KF-1]
 gi|264678866|ref|YP_003278773.1| iron-sulfur cluster assembly protein IscA [Comamonas testosteroni
           CNB-2]
 gi|299532423|ref|ZP_07045815.1| iron-sulfur cluster assembly protein IscA [Comamonas testosteroni
           S44]
 gi|220711597|gb|EED66965.1| iron-sulfur cluster assembly protein IscA [Comamonas testosteroni
           KF-1]
 gi|262209379|gb|ACY33477.1| iron-sulfur cluster assembly protein IscA [Comamonas testosteroni
           CNB-2]
 gi|298719661|gb|EFI60626.1| iron-sulfur cluster assembly protein IscA [Comamonas testosteroni
           S44]
          Length = 107

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (62%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDG 63
           ++MTEAA   +   + + +GK  G+R+ +K  GC+GL Y ++ V +  V  DD++ E  G
Sbjct: 3   ISMTEAAARHVNRYL-SRRGKGIGVRLGVKTTGCSGLAYKLEYVDE--VQPDDVVFEDHG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +KV ID  SL Y+ GTE+DF  E L  GF FHNPN+   CGCG+S  I
Sbjct: 60  IKVLIDPKSLAYIDGTELDFVREGLNEGFKFHNPNERDRCGCGESFRI 107


>gi|28897372|ref|NP_796977.1| HesB family protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|260363561|ref|ZP_05776390.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           K5030]
 gi|260876332|ref|ZP_05888687.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           AN-5034]
 gi|260898603|ref|ZP_05907099.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           Peru-466]
 gi|260899297|ref|ZP_05907692.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           AQ4037]
 gi|28805584|dbj|BAC58861.1| HesB family protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308086879|gb|EFO36574.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           Peru-466]
 gi|308093055|gb|EFO42750.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           AN-5034]
 gi|308106606|gb|EFO44146.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           AQ4037]
 gi|308113045|gb|EFO50585.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           K5030]
 gi|328472605|gb|EGF43468.1| HesB family protein [Vibrio parahaemolyticus 10329]
          Length = 107

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE A  R+K  + N +GK  G+R+ +K  GC+G+ Y+++ V D   + D++ +  GV
Sbjct: 3   ITMTETAASRVKAFLDN-RGKGIGLRLGVKTTGCSGMAYVLEFV-DELNEEDEVFDFSGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIIDKKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|237747553|ref|ZP_04578033.1| iron-binding protein iscA [Oxalobacter formigenes OXCC13]
 gi|229378915|gb|EEO29006.1| iron-binding protein iscA [Oxalobacter formigenes OXCC13]
          Length = 107

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   I   +   +GK  G+R  ++  GC+G+ Y ++ V D P  GD + E  GV
Sbjct: 3   ITLTEKAANHISRFL-QRRGKGIGLRFGVQTTGCSGMSYKLEYV-DEPDAGDVIFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+DF  E L  GF F+NPN   +CGCG S ++
Sbjct: 61  KVFVDPKSLPYLDGTELDFAREGLNEGFKFYNPNVTDSCGCGNSFKV 107


>gi|28868632|ref|NP_791251.1| iron-binding protein IscA [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213971527|ref|ZP_03399638.1| iron-binding protein IscA [Pseudomonas syringae pv. tomato T1]
 gi|301386132|ref|ZP_07234550.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           tomato Max13]
 gi|302060168|ref|ZP_07251709.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           tomato K40]
 gi|302135111|ref|ZP_07261101.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28851870|gb|AAO54946.1| iron-binding protein IscA [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213923719|gb|EEB57303.1| iron-binding protein IscA [Pseudomonas syringae pv. tomato T1]
 gi|330872888|gb|EGH07037.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330965906|gb|EGH66166.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331019389|gb|EGH99445.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 107

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   ++  + + +GK  G+R+ ++  GC+GL Y+++ V D     D + E  GV
Sbjct: 3   ISMTEAAANHVRRSL-DGRGKGDGVRLGVRTTGCSGLAYVLEFV-DEAASEDTVFELHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFVREGLNEGFKFNNPNSRGECGCGESFNV 107


>gi|256079122|ref|XP_002575839.1| hypothetical protein [Schistosoma mansoni]
 gi|238661090|emb|CAZ32074.1| hypothetical protein Smp_045150 [Schistosoma mansoni]
          Length = 168

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 70/107 (65%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T++AV R  +++     KA G+RI ++  GC GL Y +D   +    GD+++E+D V
Sbjct: 63  LTLTKSAVARALQLL-QMNPKATGLRIGVRTRGCNGLSYTLDFCFEGRQPGDEVVEQDNV 121

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +++ID  + L +LGTE+D++ + L S FVF+NPN    CGCG+S  +
Sbjct: 122 RIFIDRRAQLTLLGTEMDYQQDVLSSQFVFNNPNIKGTCGCGESFSV 168


>gi|66044487|ref|YP_234328.1| HesB/YadR/YfhF:Iron-sulphur cluster assembly protein IscA
           [Pseudomonas syringae pv. syringae B728a]
 gi|302185754|ref|ZP_07262427.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           syringae 642]
 gi|51102909|gb|AAT96058.1| IscA [Pseudomonas viridiflava]
 gi|63255194|gb|AAY36290.1| HesB/YadR/YfhF:Iron-sulphur cluster assembly protein IscA
           [Pseudomonas syringae pv. syringae B728a]
 gi|330950798|gb|EGH51058.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae Cit
           7]
 gi|330957518|gb|EGH57778.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           maculicola str. ES4326]
 gi|330969079|gb|EGH69145.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           aceris str. M302273PT]
 gi|330985005|gb|EGH83108.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 107

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   ++  +   +GK  G+R+ ++  GC+GL Y+++ V D     D + E  GV
Sbjct: 3   ISMTEAAANHVRRSL-EGRGKGDGVRLGVRTTGCSGLAYVLEFV-DEAASEDTVFEMHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFVREGLNEGFKFNNPNSRGECGCGESFNV 107


>gi|327295258|ref|XP_003232324.1| iron sulfur assembly protein [Trichophyton rubrum CBS 118892]
 gi|326465496|gb|EGD90949.1| iron sulfur assembly protein [Trichophyton rubrum CBS 118892]
          Length = 269

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 71/104 (68%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T  A+ +++++V  SQ   + IRI +K  GC+GL Y ++ V + P   D+++E+DGV
Sbjct: 149 VSLTPTALSKLRDLV--SQPDPKLIRIGVKNRGCSGLSYHLEYV-EKPAPFDEVVEQDGV 205

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV IDS +L  ++G+E+D+  + L S FVF+NPN    CGCG+S
Sbjct: 206 KVLIDSKALFSIIGSEVDWHEDPLSSRFVFNNPNIKDECGCGES 249


>gi|153835381|ref|ZP_01988048.1| iron-sulfur cluster assembly protein IscA [Vibrio harveyi HY01]
 gi|156973370|ref|YP_001444277.1| hypothetical protein VIBHAR_01057 [Vibrio harveyi ATCC BAA-1116]
 gi|163802464|ref|ZP_02196357.1| scaffold protein [Vibrio sp. AND4]
 gi|148868103|gb|EDL67269.1| iron-sulfur cluster assembly protein IscA [Vibrio harveyi HY01]
 gi|156524964|gb|ABU70050.1| hypothetical protein VIBHAR_01057 [Vibrio harveyi ATCC BAA-1116]
 gi|159173765|gb|EDP58580.1| scaffold protein [Vibrio sp. AND4]
          Length = 107

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE+A  R+K  + N +GK  G+R+ +K  GC+G+ Y+++ V D+  + D++ E   V
Sbjct: 3   ITMTESAASRVKAFLDN-RGKGIGLRLGVKTTGCSGMAYVLEFV-DDLNEEDEVFELSDV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIIDKKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|153003511|ref|YP_001377836.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           sp. Fw109-5]
 gi|152027084|gb|ABS24852.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           sp. Fw109-5]
          Length = 109

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + ++E A  RI+ +         G+R+ +K GGC+GL Y +D   + P   D +IE+DG 
Sbjct: 4   IEISEKAAVRIRALSQEKGTPQGGLRLGVKGGGCSGLSYFIDWAPE-PAKHDQVIERDGA 62

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++++D  S +++ GT +D++   + SGFVF NPN  SACGCG+S  I
Sbjct: 63  RLFVDPKSAVFLAGTVVDWQQTLMQSGFVFRNPNVKSACGCGESFTI 109


>gi|220935225|ref|YP_002514124.1| iron-sulfur cluster assembly protein [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219996535|gb|ACL73137.1| iron-sulfur cluster assembly protein [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 107

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE+A  R+K  +   +GK  G+R+ ++  GC+G+ Y+++   D   +GD + E  GV
Sbjct: 3   ITLTESAADRVKTFL-AKRGKGLGLRLGVRTTGCSGMAYVIEFA-DELDEGDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ++  SL+Y+ GTE+DF  E L  GF F+NPN+   CGCG+S  +
Sbjct: 61  KVIVNPKSLVYLEGTELDFAREGLNEGFKFNNPNEKDRCGCGESFNV 107


>gi|240128415|ref|ZP_04741076.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268686811|ref|ZP_06153673.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268627095|gb|EEZ59495.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae SK-93-1035]
          Length = 126

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 71/110 (64%), Gaps = 4/110 (3%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EK 61
           +++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V +   +GDDLI E+
Sbjct: 20  NMITLTENAAKHINDYLA-KRGKGLGVRLGVKTSGCSGMAYNLEFVDE--ANGDDLIFER 76

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 77  HGARIYIDPKSLVYLDGTQVDYTKEDLQEGFKFENPNVKDSCGCGESFHV 126


>gi|302498837|ref|XP_003011415.1| hypothetical protein ARB_02265 [Arthroderma benhamiae CBS 112371]
 gi|291174966|gb|EFE30775.1| hypothetical protein ARB_02265 [Arthroderma benhamiae CBS 112371]
          Length = 251

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 71/104 (68%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T  A+ +++++V  SQ   + IRI +K  GC+GL Y ++ V + P   D+++E+DGV
Sbjct: 148 VSLTPTALSKLRDLV--SQPDPKLIRIGVKNRGCSGLSYHLEYV-EKPAPFDEVVEQDGV 204

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV IDS +L  ++G+E+D+  + L S FVF+NPN    CGCG+S
Sbjct: 205 KVLIDSKALFSIIGSEMDWHEDPLSSRFVFNNPNIKDECGCGES 248


>gi|25146411|ref|NP_741696.1| hypothetical protein Y39B6A.3 [Caenorhabditis elegans]
 gi|15209351|emb|CAC51075.1| C. elegans protein Y39B6A.3a, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 129

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV RI+ ++   Q  A  ++I +++ GC GL Y ++   D     D+ +E+DG+
Sbjct: 25  LTLTNEAVSRIR-VLLAQQNDANALKIGVRQKGCNGLTYTLEYAKDKQ-KFDEEVEQDGI 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KVWI+  + L +LG+E+D+ T+KL S FVF NPN    CGCG+S  I
Sbjct: 83  KVWIEPKAQLSLLGSEMDYVTDKLSSEFVFRNPNIKGTCGCGESFSI 129


>gi|269962419|ref|ZP_06176769.1| hesB family protein [Vibrio harveyi 1DA3]
 gi|269832915|gb|EEZ87024.1| hesB family protein [Vibrio harveyi 1DA3]
          Length = 107

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE+A  R+K  + N +GK  G+R+ +K  GC+G+ Y+++ V D+  + D++ E   V
Sbjct: 3   ITMTESAASRVKAFLDN-RGKGIGLRLGVKTTGCSGMAYVLEFV-DDLNEEDEVFELSEV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIIDKKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|156366241|ref|XP_001627048.1| predicted protein [Nematostella vectensis]
 gi|156213945|gb|EDO34948.1| predicted protein [Nematostella vectensis]
          Length = 131

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 72/107 (67%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV ++K ++ +SQ  A  +++ +++ GC GL Y ++  T+     D+L+ +DGV
Sbjct: 27  LTLTPSAVNKVKTLL-SSQPDAIALKVGVRQRGCNGLSYTLEFATEKG-KFDELVTQDGV 84

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS + L +LGTE+DF  +KL S FVF+NPN    CGCG+S  I
Sbjct: 85  KVLIDSKAQLSLLGTEMDFVEDKLSSEFVFNNPNIKGTCGCGESFNI 131


>gi|289626162|ref|ZP_06459116.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289649068|ref|ZP_06480411.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330869586|gb|EGH04295.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 107

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   ++  +   +GK  G+R+ ++  GC+GL Y+++ V D     D + E  GV
Sbjct: 3   ISMTEAAANHVRRSL-EGRGKGDGVRLGVRTTGCSGLAYVLEFV-DEAASEDAVFEMHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFVREGLNEGFKFNNPNSRGECGCGESFNV 107


>gi|326480948|gb|EGE04958.1| hypothetical protein TEQG_08677 [Trichophyton equinum CBS 127.97]
          Length = 252

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 71/104 (68%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T  A+ +++++V  SQ   + IRI +K  GC+GL Y ++ V + P   D+++E+DGV
Sbjct: 149 VSLTPTALSKLRDLV--SQPDPKLIRIGVKNRGCSGLSYHLEYV-EKPAPFDEVVEQDGV 205

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV IDS +L  ++G+E+D+  + L S FVF+NPN    CGCG+S
Sbjct: 206 KVLIDSKALFSIIGSEMDWHEDPLSSRFVFNNPNIKDECGCGES 249


>gi|83312125|ref|YP_422389.1| hypothetical protein amb3026 [Magnetospirillum magneticum AMB-1]
 gi|82946966|dbj|BAE51830.1| Uncharacterized conserved protein [Magnetospirillum magneticum
           AMB-1]
          Length = 111

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 70/108 (64%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQ-GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +T+T+AA  R+K ++   +GK   GIRI ++  GC+G+ Y ++   D     D+++E  G
Sbjct: 6   MTITDAAAERVK-VLLEKRGKPSVGIRIGVRSKGCSGMSYTLEYA-DEKTQFDEILEDKG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V V ID  + +++LGTE+DF  +K+ SGFVF NPN+   CGCG+S  +
Sbjct: 64  VTVLIDPKATMFILGTEMDFVEDKMQSGFVFKNPNEKGRCGCGESFHV 111


>gi|260459781|ref|ZP_05808035.1| iron-sulfur cluster assembly accessory protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259034583|gb|EEW35840.1| iron-sulfur cluster assembly accessory protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 115

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V MTEAA  RI +IV    GK   +R+S++ GGC+G  Y  DLV D   D D  IE+DG 
Sbjct: 11  VDMTEAAARRIAKIVSGEDGK-TALRVSVEGGGCSGFSYKFDLV-DTRNDDDVAIERDGA 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V ID  SL+YM G+ IDF  + +   F   NPN V++CGCG S  I
Sbjct: 69  TVLIDDLSLVYMGGSVIDFVDDLMGQSFQIKNPNAVASCGCGTSFSI 115


>gi|193209025|ref|NP_001123038.1| hypothetical protein Y39B6A.3 [Caenorhabditis elegans]
 gi|148473207|emb|CAN86925.1| C. elegans protein Y39B6A.3b, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 131

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV RI+ ++   Q  A  ++I +++ GC GL Y ++   D     D+ +E+DG+
Sbjct: 27  LTLTNEAVSRIR-VLLAQQNDANALKIGVRQKGCNGLTYTLEYAKDKQ-KFDEEVEQDGI 84

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KVWI+  + L +LG+E+D+ T+KL S FVF NPN    CGCG+S  I
Sbjct: 85  KVWIEPKAQLSLLGSEMDYVTDKLSSEFVFRNPNIKGTCGCGESFSI 131


>gi|157825851|ref|YP_001493571.1| Iron-sulfur cluster assembly accessory protein [Rickettsia akari
           str. Hartford]
 gi|157799809|gb|ABV75063.1| Iron-sulfur cluster assembly accessory protein [Rickettsia akari
           str. Hartford]
          Length = 110

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 71/111 (63%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T++A  ++K ++        G+R+ +K GGCAG  Y V+   D+    D+++E
Sbjct: 1   MKNVISLTDSAAKQVKLLIEKRDKPTFGVRVGVKSGGCAGQTYYVEYA-DSKNQFDEVVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+EID+   K  S F F NPN+ + CGCG+S  +
Sbjct: 60  EKGVRILIDPKALMYILGSEIDYVETKFKSQFTFTNPNEKAGCGCGKSFSV 110


>gi|325266615|ref|ZP_08133292.1| iron-sulfur cluster assembly protein IscA [Kingella denitrificans
           ATCC 33394]
 gi|324982058|gb|EGC17693.1| iron-sulfur cluster assembly protein IscA [Kingella denitrificans
           ATCC 33394]
          Length = 106

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 69/108 (63%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T  A   I+  +   +GK +GIRI +K  GC+G+ Y ++ V D   + D + E+DG
Sbjct: 1   MITITSNAADHIRNFI-AKRGKGEGIRIGVKTSGCSGMAYTLEFVDDIQPE-DQVFEQDG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ GT++D+  + L  GF F NPN   +CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLDGTQVDYAKDGLQEGFKFENPNVKESCGCGESFHV 106


>gi|51892121|ref|YP_074812.1| hypothetical protein STH983 [Symbiobacterium thermophilum IAM
           14863]
 gi|51855810|dbj|BAD39968.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 124

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 68/110 (61%), Gaps = 2/110 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+KEI+  S+G+   +R+ ++ GGC+G EY + L   NP   D++ E DG+
Sbjct: 3   ITLTEKASNRLKEII-KSKGENLALRVLVRPGGCSGFEYGMAL-ERNPRPDDNISEFDGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           KV ID ASL Y+ G+ ID+    +  GF  +NPN V+ C CGQS     A
Sbjct: 61  KVVIDPASLPYLDGSTIDYVDSLMGGGFAINNPNAVTGCACGQSFRTANA 110


>gi|15677244|ref|NP_274397.1| HesB/YadR/YfhF family protein [Neisseria meningitidis MC58]
 gi|7226622|gb|AAF41749.1| HesB/YadR/YfhF family protein [Neisseria meningitidis MC58]
 gi|308389500|gb|ADO31820.1| HesB-like protein [Neisseria meningitidis alpha710]
 gi|316984200|gb|EFV63178.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           H44/76]
          Length = 126

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EK 61
           +++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V +   DGDDLI E 
Sbjct: 20  NMITLTENAAKHINDYL-AKRGKGLGVRLGVKTSGCSGMAYNLEFVDE--ADGDDLIFEG 76

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 77  HGARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 126


>gi|332289847|ref|YP_004420699.1| iron-sulfur cluster assembly protein [Gallibacterium anatis UMN179]
 gi|330432743|gb|AEC17802.1| iron-sulfur cluster assembly protein [Gallibacterium anatis UMN179]
          Length = 107

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE+A  R+++ + N +GK  G+R+ +K  GC+GL Y+++ V D   + D + E +GV
Sbjct: 3   ISLTESAAQRVRDFLAN-RGKGIGLRLGIKTSGCSGLAYVLEFV-DTLNEDDQVFEDNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D+ SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KIIVDNKSLVYLDGTQLDFVKEGLNEGFKFTNPNVKEQCGCGESFHV 107


>gi|119469044|ref|ZP_01612028.1| Fe-S cluster assembly and activation protein (possibly as
           alternative scaffold for Fe-S cluster assembly)
           [Alteromonadales bacterium TW-7]
 gi|119447296|gb|EAW28564.1| Fe-S cluster assembly and activation protein (possibly as
           alternative scaffold for Fe-S cluster assembly)
           [Alteromonadales bacterium TW-7]
          Length = 107

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+AA  R++  + N +GK  G+R+ +K  GC+GL Y+++ V D   + D+     GV
Sbjct: 3   VTLTDAAANRVQSFLAN-RGKGLGLRVGIKTTGCSGLAYVLEFV-DELNEDDETFAAKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D+ SL+Y+ GTE+D+  E L  GF F+NPNQ   CGCG+S  +
Sbjct: 61  TLIVDAKSLVYIDGTELDYTKEGLNEGFKFNNPNQADECGCGESFTV 107


>gi|146308524|ref|YP_001188989.1| iron-sulfur cluster assembly protein IscA [Pseudomonas mendocina
           ymp]
 gi|330504688|ref|YP_004381557.1| iron-sulfur cluster assembly protein IscA [Pseudomonas mendocina
           NK-01]
 gi|145576725|gb|ABP86257.1| iron-sulfur cluster assembly protein IscA [Pseudomonas mendocina
           ymp]
 gi|328918974|gb|AEB59805.1| iron-sulfur cluster assembly protein IscA [Pseudomonas mendocina
           NK-01]
          Length = 107

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TM+EAA   ++  +   +GK +GIR+ ++  GC+GL Y+++ V D     D + E  GV
Sbjct: 3   ITMSEAAARHVQRSL-EGRGKGEGIRLGVRTTGCSGLAYVLEFV-DELAAEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFVKEGLNEGFKFNNPNVRGECGCGESFNV 107


>gi|84387616|ref|ZP_00990633.1| HesB family protein [Vibrio splendidus 12B01]
 gi|86145585|ref|ZP_01063915.1| HesB family protein [Vibrio sp. MED222]
 gi|218708631|ref|YP_002416252.1| HesB family protein [Vibrio splendidus LGP32]
 gi|84377461|gb|EAP94327.1| HesB family protein [Vibrio splendidus 12B01]
 gi|85836556|gb|EAQ54682.1| HesB family protein [Vibrio sp. MED222]
 gi|218321650|emb|CAV17602.1| HesB family protein [Vibrio splendidus LGP32]
          Length = 107

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT+ A  R++  + N +GK  G+R+++K  GC+G+ Y+++ V D   + D++ E  GV
Sbjct: 3   ITMTDTAASRVQAFLDN-RGKGLGLRLAVKTTGCSGMAYVLEFV-DELNEEDEVFEHSGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDYVKEGLNEGFEFNNPNAKGECGCGESFNV 107


>gi|241068515|ref|XP_002408456.1| iron-sulfur protein Isa2, putative [Ixodes scapularis]
 gi|215492444|gb|EEC02085.1| iron-sulfur protein Isa2, putative [Ixodes scapularis]
          Length = 129

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 71/111 (63%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T++A  ++K ++        GIR+ +K GGCAG  Y V+   D+    D+++E
Sbjct: 20  MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGVKSGGCAGQTYYVEYA-DSKNQFDEIVE 78

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+E+D+   K  S F F NPN+ + CGCG+S  +
Sbjct: 79  EKGVRILIDPKALMYILGSEMDYVETKFKSQFTFTNPNEKANCGCGKSFSV 129


>gi|297250250|ref|ZP_06863916.2| iron-sulfur cluster assembly protein IscA [Neisseria polysaccharea
           ATCC 43768]
 gi|296839404|gb|EFH23342.1| iron-sulfur cluster assembly protein IscA [Neisseria polysaccharea
           ATCC 43768]
          Length = 126

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EK 61
           +++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V +   DGDDLI E 
Sbjct: 20  NMITLTENAAKHINDYL-AKRGKGLGVRLGVKTSGCSGMAYNLEFVDE--ADGDDLIFEG 76

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 77  HGARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 126


>gi|289677958|ref|ZP_06498848.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           syringae FF5]
          Length = 109

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   ++  +   +GK  G+R+ ++  GC+GL Y+++ V D     D + E  GV
Sbjct: 5   ISMTEAAANHVRRSL-EGRGKGDGVRLGVRTTGCSGLAYVLEFV-DEAASEDTVFELHGV 62

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 63  KVIIDPKSLVYLDGTELDFVREGLNEGFKFNNPNSRGECGCGESFNV 109


>gi|237800034|ref|ZP_04588495.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|330895880|gb|EGH28165.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330936992|gb|EGH41090.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           pisi str. 1704B]
 gi|330975894|gb|EGH75960.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           aptata str. DSM 50252]
 gi|331022889|gb|EGI02946.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 107

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   ++  +   +GK  G+R+ ++  GC+GL Y+++ V D     D + E  GV
Sbjct: 3   ISMTEAAANHVRRSL-EGRGKGDGVRLGVRTTGCSGLAYVLEFV-DEAASEDTVFELHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFVREGLNEGFKFNNPNSRGECGCGESFNV 107


>gi|296808263|ref|XP_002844470.1| iron sulfur assembly protein 1 [Arthroderma otae CBS 113480]
 gi|238843953|gb|EEQ33615.1| iron sulfur assembly protein 1 [Arthroderma otae CBS 113480]
          Length = 254

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 71/104 (68%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T  A+ +++++V  SQ   + IRI +K  GC+GL Y ++ V + P   D+++E+DGV
Sbjct: 151 VSLTPTALSKLRDLV--SQPDPKLIRIGVKNRGCSGLSYHLEYV-EKPAPFDEVVEQDGV 207

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV IDS +L  ++G+E+D+  + L S FVF+NPN    CGCG+S
Sbjct: 208 KVLIDSKALFSIIGSEMDWHEDPLSSRFVFNNPNIKDECGCGES 251


>gi|71734391|ref|YP_273569.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257487208|ref|ZP_05641249.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|298486014|ref|ZP_07004088.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|71554944|gb|AAZ34155.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298159491|gb|EFI00538.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|320322930|gb|EFW79020.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329947|gb|EFW85935.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330874673|gb|EGH08822.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330894484|gb|EGH27145.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           mori str. 301020]
 gi|331009177|gb|EGH89233.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 107

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   ++  +   +GK  G+R+ ++  GC+GL Y+++ V D     D + E  GV
Sbjct: 3   ISMTEAAANHVRRSL-EGRGKGDGVRLGVRTTGCSGLAYVLEFV-DEAAGEDTVFEMHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFVREGLNEGFKFNNPNSRGECGCGESFNV 107


>gi|319942821|ref|ZP_08017122.1| iron-sulfur cluster assembly protein IscA [Sutterella
           wadsworthensis 3_1_45B]
 gi|319803588|gb|EFW00549.1| iron-sulfur cluster assembly protein IscA [Sutterella
           wadsworthensis 3_1_45B]
          Length = 107

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 70/108 (64%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDG 63
           VT+TEAA   +++ +   +GK  G+R+ +K  GC+G+ Y ++    + V+ DD + E  G
Sbjct: 3   VTLTEAAAKHVQKYL-ARRGKGVGLRLGVKTSGCSGMAYKLEFA--DQVEPDDKVWESFG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV +D  SL Y+ GTE+D+  E L  GF FHNPN+ S CGCG+S +I
Sbjct: 60  VKVLVDEKSLPYLDGTELDYTREGLQEGFKFHNPNEKSRCGCGESFQI 107


>gi|126174608|ref|YP_001050757.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica
           OS155]
 gi|153000904|ref|YP_001366585.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica
           OS185]
 gi|160875612|ref|YP_001554928.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica
           OS195]
 gi|217973139|ref|YP_002357890.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica
           OS223]
 gi|304408982|ref|ZP_07390603.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica
           OS183]
 gi|307302985|ref|ZP_07582740.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica
           BA175]
 gi|125997813|gb|ABN61888.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica
           OS155]
 gi|151365522|gb|ABS08522.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica
           OS185]
 gi|160861134|gb|ABX49668.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica
           OS195]
 gi|217498274|gb|ACK46467.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica
           OS223]
 gi|304352803|gb|EFM17200.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica
           OS183]
 gi|306913345|gb|EFN43767.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica
           BA175]
 gi|315267800|gb|ADT94653.1| iron-sulfur cluster assembly protein IscA [Shewanella baltica
           OS678]
          Length = 107

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT AA  R++  + N +GK  G+R+ L+  GC+G+ Y+++ V D+  D D++ + + V
Sbjct: 3   ITMTPAAADRVRSFLVN-RGKGVGLRLGLRTSGCSGMAYVLEFV-DSLNDDDEVFDIEDV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID+ SL+Y+ G E+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIIDAKSLIYLQGIELDFVKEGLNEGFQFNNPNAKGECGCGESFTV 107


>gi|77460831|ref|YP_350338.1| Iron-sulphur cluster assembly protein IscA [Pseudomonas fluorescens
           Pf0-1]
 gi|77384834|gb|ABA76347.1| HesB family protein [Pseudomonas fluorescens Pf0-1]
          Length = 107

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   ++  + + +GK +GIR+ ++  GC+GL Y+++ V D  V  D + E  G 
Sbjct: 3   ISMTEAAARHVRRSL-DGRGKGEGIRLGVRTTGCSGLAYVLEFV-DEVVAEDQVFESHGE 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  I
Sbjct: 61  KVIIDPKSLAYLDGTELDFVKEGLNEGFKFNNPNVRGECGCGESFNI 107


>gi|120611116|ref|YP_970794.1| iron-sulfur cluster assembly protein IscA [Acidovorax citrulli
           AAC00-1]
 gi|120589580|gb|ABM33020.1| iron-sulfur cluster assembly protein IscA [Acidovorax citrulli
           AAC00-1]
          Length = 107

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA   +   + + +GK  G+R+ +K  GC+GL Y ++ V D P   D + E  GV
Sbjct: 3   ITLTEAAARHVSRYL-SRRGKGLGVRLGVKTTGCSGLAYKLEYV-DEPEPEDVIFEDHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GT++DF  E L  GF F+NPN+   CGCG+S  +
Sbjct: 61  KVLIDPKSLAYIDGTQLDFVREGLNEGFRFNNPNERDRCGCGESFRV 107


>gi|87198227|ref|YP_495484.1| HesB/YadR/YfhF [Novosphingobium aromaticivorans DSM 12444]
 gi|87133908|gb|ABD24650.1| HesB/YadR/YfhF [Novosphingobium aromaticivorans DSM 12444]
          Length = 120

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 71/108 (65%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           V +T +A  RI  ++ N+   A G+++S  + GC+GL Y VD VT+ NP+D  + IE  G
Sbjct: 15  VILTASAEARIANLMENAPEGAIGVKLSTPRRGCSGLAYSVDYVTEANPMD--ERIETPG 72

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
              +IDSAS+LY++G+ +D++ +   +GFVF NPN   +CGCG+S  +
Sbjct: 73  GLFFIDSASVLYLIGSTMDWQEDDFTAGFVFQNPNAKGSCGCGESFTV 120


>gi|315633892|ref|ZP_07889181.1| iron-sulfur cluster assembly protein IscA [Aggregatibacter segnis
           ATCC 33393]
 gi|315477142|gb|EFU67885.1| iron-sulfur cluster assembly protein IscA [Aggregatibacter segnis
           ATCC 33393]
          Length = 109

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE+A  R++  +   +GK  G+R+ +K  GC+GL YM++ V     D D + E+ GV
Sbjct: 5   VTLTESAADRVRTFL-AKRGKGIGLRLGIKTSGCSGLSYMLEFVDALNAD-DHVFEQYGV 62

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D+ SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 63  KVIVDTKSLVYLDGTQLDFAKEGLNEGFKFTNPNVKDECGCGESFNV 109


>gi|309379670|emb|CBX21659.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 106

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 70/109 (64%), Gaps = 4/109 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKD 62
           ++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V  +  DGDDLI E+ 
Sbjct: 1   MITLTENAAKHINDYL-AKRGKGLGVRLGVKTSGCSGMAYNLEFV--DEADGDDLIFEEH 57

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 58  GARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|170085345|ref|XP_001873896.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164651448|gb|EDR15688.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 198

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT  AV RI+ ++       Q IRI ++  GCAGL Y ++ V ++P   D+++E+DGV
Sbjct: 93  LTMTPLAVSRIRALLGGPT--PQLIRIGVRNKGCAGLSYHLEYV-EHPGKFDEVVEQDGV 149

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V IDS +L  ++G+++D++ + L S FVF NPN   ACGCG+S  +
Sbjct: 150 RVLIDSKALFSIIGSQMDWQEDNLSSKFVFKNPNIKDACGCGESFNV 196


>gi|253999557|ref|YP_003051620.1| iron-sulfur cluster assembly protein IscA [Methylovorus sp. SIP3-4]
 gi|313201584|ref|YP_004040242.1| iron-sulfur cluster assembly protein isca [Methylovorus sp. MP688]
 gi|253986236|gb|ACT51093.1| iron-sulfur cluster assembly protein IscA [Methylovorus sp. SIP3-4]
 gi|312440900|gb|ADQ85006.1| iron-sulfur cluster assembly protein IscA [Methylovorus sp. MP688]
          Length = 107

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (62%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           +T+TE A  R+++ + N +GK  G+R+ +K  GC+G+ Y ++ V D NP D     E  G
Sbjct: 3   ITLTETAASRVQKFLSN-RGKGIGLRLGVKTTGCSGMAYTLEFVDDLNPEDM--AFESHG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV +D  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  I
Sbjct: 60  VKVIVDPKSLVYIDGTELDFTKEGLNEGFKFNNPNVKDECGCGESFTI 107


>gi|161870255|ref|YP_001599425.1| HesB/YadR/YfhF family protein [Neisseria meningitidis 053442]
 gi|304387290|ref|ZP_07369483.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           ATCC 13091]
 gi|161595808|gb|ABX73468.1| HesB/YadR/YfhF family protein [Neisseria meningitidis 053442]
 gi|304338673|gb|EFM04790.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           ATCC 13091]
          Length = 126

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EK 61
           +++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V +   DGDDLI E 
Sbjct: 20  NMITLTENAAKHINDYL-AKRGKGLGVRLGVKTSGCSGMAYNLEFVDE--ADGDDLIFEG 76

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 77  HGARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 126


>gi|51473669|ref|YP_067426.1| iron-binding protein IscA/HesB [Rickettsia typhi str. Wilmington]
 gi|51459981|gb|AAU03944.1| iron-binding protein IscA/HesB [Rickettsia typhi str. Wilmington]
          Length = 110

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 70/111 (63%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T++A  ++K ++        GIR+ +K GGCAG  Y V+   DN    D+++E
Sbjct: 1   MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGIKSGGCAGQTYYVEYA-DNKNQFDEVVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+E+D+      S F F NPN+ + CGCG+S  +
Sbjct: 60  EKGVRILIDPKALMYILGSEMDYVETNFKSQFTFTNPNEKANCGCGKSFSV 110


>gi|218681510|ref|ZP_03529397.1| iron-sulfur cluster assembly accessory protein [Rhizobium etli CIAT
           894]
          Length = 110

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 1   MSDI-VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M+D  VT+++AA  RI  IV    GK+  +R+S++ GGC+G  Y  DL  +   D D ++
Sbjct: 1   MTDTSVTLSDAAAKRIAAIVGAEAGKSA-LRVSVEGGGCSGFSYKFDL-AEGAGDDDVVV 58

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           EK+  KV IDS SL+YM G+EIDF    L   F   NPN V++CGCG S  I
Sbjct: 59  EKNNAKVLIDSLSLVYMAGSEIDFVDNLLGQSFQIKNPNAVASCGCGTSFSI 110


>gi|37678941|ref|NP_933550.1| hypothetical protein VV0757 [Vibrio vulnificus YJ016]
 gi|37197683|dbj|BAC93521.1| uncharacterized conserved protein [Vibrio vulnificus YJ016]
          Length = 107

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T++A  R++  + N +GK  G+R+ +K  GC+G+ Y+++ V D   + D++ E  GV
Sbjct: 3   VTLTDSAANRVRAFLDN-RGKGIGLRLGVKTTGCSGMAYVLEFV-DELNEEDEVFEHSGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GT++D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDKKSLVYLDGTQLDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|120598679|ref|YP_963253.1| iron-sulfur cluster assembly protein IscA [Shewanella sp. W3-18-1]
 gi|146293243|ref|YP_001183667.1| iron-sulfur cluster assembly protein IscA [Shewanella putrefaciens
           CN-32]
 gi|120558772|gb|ABM24699.1| iron-sulfur cluster assembly protein IscA [Shewanella sp. W3-18-1]
 gi|145564933|gb|ABP75868.1| iron-sulfur cluster assembly protein IscA [Shewanella putrefaciens
           CN-32]
 gi|319426243|gb|ADV54317.1| iron-sulfur cluster assembly protein IscA [Shewanella putrefaciens
           200]
          Length = 107

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT AA  R++  + N +GK  G+R+ L+  GC+G+ Y+++ V D   D D++ + + V
Sbjct: 3   ITMTPAATERVRSFLAN-RGKGIGLRLGLRTSGCSGMAYVLEFV-DTLNDDDEVFDIEDV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID+ SL+Y+ G E+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIIDAKSLIYLQGIELDFVKEGLNEGFQFNNPNAKGECGCGESFTV 107


>gi|293394862|ref|ZP_06639152.1| iron-binding protein IscA [Serratia odorifera DSM 4582]
 gi|291422613|gb|EFE95852.1| iron-binding protein IscA [Serratia odorifera DSM 4582]
          Length = 107

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TM+++A  R++  + + +GK  G+R+ ++  GC+G+ Y+++ V D   D D + E  GV
Sbjct: 3   ITMSDSAAQRVQAFL-DHRGKGLGLRLGVRTSGCSGMAYVLEFV-DETNDDDVIFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  KVIIDGKSLVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGESFNV 107


>gi|27376866|ref|NP_768395.1| IscN-like protein [Bradyrhizobium japonicum USDA 110]
 gi|30179814|sp|P37029|Y1755_BRAJA RecName: Full=Uncharacterized protein blr1755
 gi|12620464|gb|AAG60740.1|AF322012_45 ID91 [Bradyrhizobium japonicum]
 gi|27350008|dbj|BAC47020.1| blr1755 [Bradyrhizobium japonicum USDA 110]
          Length = 106

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T++AV  IK  + +S+ +A G+R+ ++ GGC G +Y +  + D P   D +I+ DG
Sbjct: 1   MINLTDSAVNAIKSAISSSERRAGGLRVMIEAGGCNGFKYKMG-IADEPKPDDTVIDCDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +KV++DS S  ++ GT IDF      SGF FHNPN  + C CG+S
Sbjct: 60  LKVFVDSKSREHLAGTTIDFVLAPESSGFTFHNPNAATNCSCGKS 104


>gi|312884221|ref|ZP_07743930.1| HesB family protein [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367994|gb|EFP95537.1| HesB family protein [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 107

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT+ A  R++  + N +GK  G+R+ +K  GC+G+ Y+++ V D   + D + E  GV
Sbjct: 3   ITMTDTAASRVRTFLDN-RGKGIGLRLGVKTTGCSGMAYVLEFV-DELNEEDSVFEHSGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID+ SL+Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDAKSLVYLDGTELDYVKEGLNEGFEFNNPNAKGECGCGESFNV 107


>gi|239947328|ref|ZP_04699081.1| HesB protein [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921604|gb|EER21628.1| HesB protein [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 110

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 71/111 (63%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T++A  ++K ++        GIR+ +K GGCAG  Y V+   D+    D+++E
Sbjct: 1   MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGVKSGGCAGQTYYVEYA-DSKNQFDEIVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+E+D+   K  S F F NPN+ + CGCG+S  +
Sbjct: 60  EKGVRILIDPKALMYILGSEMDYVETKFKSQFTFTNPNEKANCGCGKSFSV 110


>gi|157376004|ref|YP_001474604.1| iron-sulfur cluster assembly protein IscA [Shewanella sediminis
           HAW-EB3]
 gi|157318378|gb|ABV37476.1| iron-sulfur cluster assembly protein IscA [Shewanella sediminis
           HAW-EB3]
          Length = 107

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT AA  R+K  +  S+GK  G+R+ LK  GC+G+ Y+++ V D+  D D++ E   V
Sbjct: 3   ITMTPAAAERVKSFLV-SRGKGIGLRLGLKTSGCSGMAYILEFV-DDLNDDDEVYEIGDV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID+ S +Y+ G E+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIIDAKSFIYLQGIELDFVKEGLNEGFQFNNPNAKGECGCGESFTV 107


>gi|70732287|ref|YP_262043.1| iron-sulfur cluster assembly protein IscA [Pseudomonas fluorescens
           Pf-5]
 gi|68346586|gb|AAY94192.1| iron-sulfur cluster assembly protein IscA [Pseudomonas fluorescens
           Pf-5]
          Length = 107

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   ++  + N +GK  GIR+ ++  GC+GL Y+++ V D   + D + E  G 
Sbjct: 3   ISMTEAAAQHVRRSL-NGRGKGDGIRLGVRTTGCSGLAYVLEFV-DEIGEDDQVFESHGE 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  I
Sbjct: 61  KVIIDPKSLTYLDGTELDFVKEGLNEGFKFNNPNVRGECGCGESFNI 107


>gi|52425778|ref|YP_088915.1| IscA protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307830|gb|AAU38330.1| IscA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 124

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + MTE+A   +K+ +  S+GK  G+R+ +K  GC+GL Y+++ V +   D D++ E+ GV
Sbjct: 20  IGMTESAAKHVKKCL-ESRGKGIGLRLGIKTSGCSGLAYVLEFVDELNSD-DNVFEQHGV 77

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D+ SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 78  KVIVDTKSLVYLNGTQLDFVKEGLNEGFKFTNPNVKDQCGCGESFNV 124


>gi|313109230|ref|ZP_07795198.1| putative iron-binding protein IscA [Pseudomonas aeruginosa 39016]
 gi|310881700|gb|EFQ40294.1| putative iron-binding protein IscA [Pseudomonas aeruginosa 39016]
          Length = 107

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   ++  +   +GK +GIR+ ++  GC+GL Y+++ V D     D + E  GV
Sbjct: 3   ISMTEAAAKHVQRSL-EGRGKGEGIRLGVRTTGCSGLAYVLEFV-DELAAEDLVFENHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFTREGLNEGFKFNNPNVRGECGCGESFNV 107


>gi|327481762|gb|AEA85072.1| iron-sulfur cluster assembly protein IscA [Pseudomonas stutzeri DSM
           4166]
          Length = 107

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT AA   ++  +   +GK  G+R+ ++  GC+GL Y+++ V +   + D + E  GV
Sbjct: 3   ITMTPAAAQHVRRSL-EGRGKGVGVRLGVRTTGCSGLAYVLEFVDETAAE-DSVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  I
Sbjct: 61  KVIIDPKSLVYLDGTELDFVREGLNEGFKFNNPNVRGECGCGESFNI 107


>gi|289208017|ref|YP_003460083.1| iron-sulfur cluster assembly protein IscA [Thioalkalivibrio sp.
           K90mix]
 gi|288943648|gb|ADC71347.1| iron-sulfur cluster assembly protein IscA [Thioalkalivibrio sp.
           K90mix]
          Length = 107

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  RI+  +   +GK  G+R+ ++  GC+G+ Y+V+   D+  D D + E  GV
Sbjct: 3   ITLTEPAAERIQSFL-AQRGKGLGVRLGVRTTGCSGMAYVVEFA-DDIEDTDTVFEDRGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ++  SL+Y+ GTE+DF  E L  GF F+NPN+ + CGCG+S  I
Sbjct: 61  KLVVNPKSLVYLDGTELDFGKEGLNEGFKFNNPNEKARCGCGESFSI 107


>gi|49080304|gb|AAT50002.1| PA3812 [synthetic construct]
          Length = 108

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   ++  +   +GK +GIR+ ++  GC+GL Y+++ V +   + D + E  GV
Sbjct: 3   ISMTEAAAKHVQRSL-EGRGKGEGIRLGVRTTGCSGLAYVLEFVDELAAE-DLVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFTREGLNEGFKFNNPNVRGECGCGESFNV 107


>gi|15599007|ref|NP_252501.1| iron-binding protein IscA [Pseudomonas aeruginosa PAO1]
 gi|107103332|ref|ZP_01367250.1| hypothetical protein PaerPA_01004401 [Pseudomonas aeruginosa PACS2]
 gi|116051837|ref|YP_789320.1| putative iron-binding protein IscA [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152988741|ref|YP_001346685.1| iron-sulfur cluster assembly protein IscA [Pseudomonas aeruginosa
           PA7]
 gi|218889904|ref|YP_002438768.1| putative iron-binding protein IscA [Pseudomonas aeruginosa LESB58]
 gi|254236716|ref|ZP_04930039.1| hypothetical protein PACG_02726 [Pseudomonas aeruginosa C3719]
 gi|254242503|ref|ZP_04935825.1| hypothetical protein PA2G_03253 [Pseudomonas aeruginosa 2192]
 gi|296387672|ref|ZP_06877147.1| iron-sulfur cluster assembly protein IscA [Pseudomonas aeruginosa
           PAb1]
 gi|9949986|gb|AAG07199.1|AE004799_5 probable iron-binding protein IscA [Pseudomonas aeruginosa PAO1]
 gi|115587058|gb|ABJ13073.1| putative iron-binding protein IscA [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126168647|gb|EAZ54158.1| hypothetical protein PACG_02726 [Pseudomonas aeruginosa C3719]
 gi|126195881|gb|EAZ59944.1| hypothetical protein PA2G_03253 [Pseudomonas aeruginosa 2192]
 gi|150963899|gb|ABR85924.1| iron-sulfur cluster assembly protein IscA [Pseudomonas aeruginosa
           PA7]
 gi|218770127|emb|CAW25889.1| probable iron-binding protein IscA [Pseudomonas aeruginosa LESB58]
          Length = 107

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   ++  +   +GK +GIR+ ++  GC+GL Y+++ V D     D + E  GV
Sbjct: 3   ISMTEAAAKHVQRSL-EGRGKGEGIRLGVRTTGCSGLAYVLEFV-DELAAEDLVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFTREGLNEGFKFNNPNVRGECGCGESFNV 107


>gi|34581605|ref|ZP_00143085.1| hesB protein [Rickettsia sibirica 246]
 gi|157828603|ref|YP_001494845.1| Iron-sulfur cluster assembly accessory protein [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165933317|ref|YP_001650106.1| HesB protein family [Rickettsia rickettsii str. Iowa]
 gi|229586812|ref|YP_002845313.1| Iron-sulfur cluster assembly accessory protein [Rickettsia africae
           ESF-5]
 gi|238650789|ref|YP_002916644.1| HesB protein family protein [Rickettsia peacockii str. Rustic]
 gi|28262990|gb|EAA26494.1| hesB protein [Rickettsia sibirica 246]
 gi|157801084|gb|ABV76337.1| Iron-sulfur cluster assembly accessory protein [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165908404|gb|ABY72700.1| HesB protein family [Rickettsia rickettsii str. Iowa]
 gi|228021862|gb|ACP53570.1| Iron-sulfur cluster assembly accessory protein [Rickettsia africae
           ESF-5]
 gi|238624887|gb|ACR47593.1| HesB protein family protein [Rickettsia peacockii str. Rustic]
          Length = 110

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 71/111 (63%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T++A  ++K ++        GIR+ +K GGCAG  Y V+   D+    D+++E
Sbjct: 1   MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGVKSGGCAGQTYYVEYA-DSKNQFDEVVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+E+D+   K  S F F NPN+ + CGCG+S  +
Sbjct: 60  EKGVRILIDPKALMYILGSEMDYVETKFKSQFTFTNPNEKANCGCGKSFSV 110


>gi|148979598|ref|ZP_01815603.1| HesB family protein [Vibrionales bacterium SWAT-3]
 gi|145961683|gb|EDK26980.1| HesB family protein [Vibrionales bacterium SWAT-3]
          Length = 107

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT+ A  R++  + N +GK  G+R+++K  GC+G+ Y+++ V D   + D + E  GV
Sbjct: 3   ITMTDTAASRVQAFLDN-RGKGIGLRLAVKTTGCSGMAYVLEFV-DELNEEDQVFEHSGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDYVKEGLNEGFEFNNPNAKGGCGCGESFNV 107


>gi|326317575|ref|YP_004235247.1| iron-sulfur cluster assembly protein IscA [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323374411|gb|ADX46680.1| iron-sulfur cluster assembly protein IscA [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 107

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA   +   + + +GK  G+R+ +K  GC+GL Y ++ V D P   D + E  GV
Sbjct: 3   ITLTEAAARHVSRYL-SRRGKGLGVRLGVKTTGCSGLAYKLEYV-DAPEPEDVVFEDHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GT++DF  E L  GF F+NPN+   CGCG+S  +
Sbjct: 61  KVLIDPKSLAYIDGTQLDFVREGLNEGFRFNNPNERDRCGCGESFRV 107


>gi|71066034|ref|YP_264761.1| HesB/YadR/YfhF family protein [Psychrobacter arcticus 273-4]
 gi|71039019|gb|AAZ19327.1| possible HesB/YadR/YfhF family protein [Psychrobacter arcticus
           273-4]
          Length = 106

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ MTE A   ++E + N +GK +GIR+ ++  GC+GL Y+++ V D P + D   E  G
Sbjct: 1   MIEMTERAAQHVREFLDN-RGKGEGIRVGIRTAGCSGLAYVLEFV-DIPDENDTRYESLG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V ++ID  SL+Y+ G  +D++ E L  GF F NPNQ   CGCG+S  +
Sbjct: 59  VSIFIDPKSLVYLDGLLMDYEKEGLNEGFKFSNPNQKGECGCGESFTV 106


>gi|255727102|ref|XP_002548477.1| hypothetical protein CTRG_02774 [Candida tropicalis MYA-3404]
 gi|240134401|gb|EER33956.1| hypothetical protein CTRG_02774 [Candida tropicalis MYA-3404]
          Length = 269

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 71/105 (67%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++  AV  ++ ++  +Q + + IRI ++  GC+GL Y ++ V D P   D+L+E+DG
Sbjct: 165 LITLSPTAVEHLRALL--NQPEPKLIRIGVRNRGCSGLTYNLEYV-DKPGKFDELVEQDG 221

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV IDS +L  ++G+E+D+  +KL S F+F NPN    CGCG+S
Sbjct: 222 VKVLIDSKALFSIVGSEMDWLDDKLSSKFIFKNPNSKGTCGCGES 266


>gi|67459235|ref|YP_246859.1| Iron-sulfur cluster assembly accessory protein [Rickettsia felis
           URRWXCal2]
 gi|67004768|gb|AAY61694.1| Iron-sulfur cluster assembly accessory protein [Rickettsia felis
           URRWXCal2]
          Length = 110

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 71/111 (63%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T++A  ++K ++        GIR+ +K GGCAG  Y V+   D+    D+++E
Sbjct: 1   MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGVKAGGCAGQTYYVEYA-DSKNQFDEVVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+E+D+   K  S F F NPN+ + CGCG+S  +
Sbjct: 60  EKGVRILIDPKALMYILGSEMDYVETKFKSQFTFTNPNEKANCGCGKSFNV 110


>gi|237808762|ref|YP_002893202.1| iron-sulfur cluster assembly protein IscA [Tolumonas auensis DSM
           9187]
 gi|237501023|gb|ACQ93616.1| iron-sulfur cluster assembly protein IscA [Tolumonas auensis DSM
           9187]
          Length = 107

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+K  + N +GK  G+R+ +K  GC+G+ Y+++ V D   + D + +  GV
Sbjct: 3   ITLSDSAAERVKRFLTN-RGKGVGLRLGVKTSGCSGMAYVLEFV-DEVHEEDQVFDDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID+ SL Y+ GTE+DF  E L  GF F+NPN   ACGCG+S  +
Sbjct: 61  KVIIDAKSLSYLDGTELDFVKEGLNEGFKFNNPNVKDACGCGESFTV 107


>gi|46202563|ref|ZP_00052993.2| COG0316: Uncharacterized conserved protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 106

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 70/108 (64%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQ-GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +T+T+AA  R+K ++   +GK   GIRI ++  GC+G+ Y ++   D     D+++E  G
Sbjct: 1   MTITDAAAERVK-VLLEKRGKPSVGIRIGVRSKGCSGMSYTLEYA-DEKTQFDEILEDKG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V V ID  + +++LGTE+DF  +K+ SGFVF NPN+   CGCG+S  +
Sbjct: 59  VTVLIDPKANMFILGTEMDFVEDKMQSGFVFKNPNEKGRCGCGESFHV 106


>gi|148244678|ref|YP_001219372.1| iron-sulfur cluster assembly protein [Candidatus Vesicomyosocius
           okutanii HA]
 gi|146326505|dbj|BAF61648.1| iron-sulfur cluster assembly protein [Candidatus Vesicomyosocius
           okutanii HA]
          Length = 107

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE AV RI E + N +G   GIR+ ++  GC+GL Y ++ V D   D D + E +GV
Sbjct: 3   VTLTEHAVERIVEFLTN-RGSGIGIRLRVQTTGCSGLGYNMEFV-DYTFDDDTVFEDNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D+ SL+Y+ GT++D+  + L  GF F+NPN  + CGCG+S  +
Sbjct: 61  KIIVDAKSLIYLDGTQVDYVKKGLNEGFEFNNPNAKAECGCGESFTV 107


>gi|50286831|ref|XP_445845.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49525151|emb|CAG58764.1| unnamed protein product [Candida glabrata]
          Length = 222

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++++T AAV  ++ +    Q + + IRIS K  GCAGL Y +  + D P   D+++E+D
Sbjct: 117 QLISLTPAAVAHLRSLC--QQPEPKLIRISAKHRGCAGLSYDLSYI-DAPGKFDEVVEQD 173

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GV+V IDS +L  ++G+E+D+   +L+S FVF NPN    CGCG+S  I
Sbjct: 174 GVRVVIDSKALFSVVGSEMDWVENRLFSKFVFKNPNSKGTCGCGESFMI 222


>gi|226328022|ref|ZP_03803540.1| hypothetical protein PROPEN_01913 [Proteus penneri ATCC 35198]
 gi|225203726|gb|EEG86080.1| hypothetical protein PROPEN_01913 [Proteus penneri ATCC 35198]
          Length = 107

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE+A  R++  + N +GK +G+R+ ++  GC+G+ Y+++   D   D D + E  GV
Sbjct: 3   ISLTESAANRVRSFLSN-RGKGEGLRLGVRTSGCSGMAYVLEFA-DVINDEDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  S++Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  KVIVDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGESFTV 107


>gi|282600099|ref|ZP_05972990.2| iron-sulfur cluster assembly protein IscA [Providencia rustigianii
           DSM 4541]
 gi|282566389|gb|EFB71924.1| iron-sulfur cluster assembly protein IscA [Providencia rustigianii
           DSM 4541]
          Length = 135

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE+A  RI+  + N +GK +G+R+ ++  GC+G+ Y+++   D   + D + E  GV
Sbjct: 31  ISLTESAAQRIQAFLKN-RGKGEGLRLGVRTSGCSGMAYVLEF-ADVINEEDTVFEDKGV 88

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  S++Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 89  KVIIDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVNSECGCGESFHV 135


>gi|32034039|ref|ZP_00134283.1| COG0316: Uncharacterized conserved protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208405|ref|YP_001053630.1| iron-binding protein IscA [Actinobacillus pleuropneumoniae L20]
 gi|165976348|ref|YP_001651941.1| iron-binding protein [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|190150256|ref|YP_001968781.1| iron-binding protein IscA [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|303251400|ref|ZP_07337577.1| iron-binding protein [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|303252972|ref|ZP_07339127.1| iron-binding protein [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|307245840|ref|ZP_07527925.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307247916|ref|ZP_07529950.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|307250171|ref|ZP_07532130.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|307252554|ref|ZP_07534449.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307254813|ref|ZP_07536639.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307256982|ref|ZP_07538758.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307259255|ref|ZP_07540984.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307261416|ref|ZP_07543089.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307263594|ref|ZP_07545208.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|126097197|gb|ABN74025.1| iron-binding protein IscA [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|165876449|gb|ABY69497.1| iron-binding protein [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|189915387|gb|ACE61639.1| iron-binding protein IscA [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|302648163|gb|EFL78364.1| iron-binding protein [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|302649754|gb|EFL79933.1| iron-binding protein [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306853200|gb|EFM85420.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306855566|gb|EFM87735.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306857802|gb|EFM89899.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306859959|gb|EFM91977.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306862184|gb|EFM94152.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306864466|gb|EFM96373.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306866622|gb|EFM98481.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306868873|gb|EFN00677.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306871057|gb|EFN02787.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 107

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R++  + N +GK  G+R+ +K  GC+GL Y+++ V D   + D + E+ GV
Sbjct: 3   ITLTETAANRVRTFLEN-RGKGIGLRLGVKTSGCSGLAYVLEFV-DVLNEDDHVFEQHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF ++NPN   +CGCG+S  +
Sbjct: 61  KVIVDEKSLTYLDGTELDFVKEGLNEGFKYNNPNVKDSCGCGESFNV 107


>gi|134095418|ref|YP_001100493.1| factor involved in Fe-S cluster assembly and activation
           [Herminiimonas arsenicoxydans]
 gi|133739321|emb|CAL62371.1| Iron-binding protein iscA (Iron-sulfur cluster assembly protein)
           [Herminiimonas arsenicoxydans]
          Length = 107

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   I   +   +GK  G+R  ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAKHINRYM-ERRGKGIGLRFGVRTTGCSGLAYKLEYV-DESASEDSVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+DF  E L  GF FHNPN    CGCG+S  I
Sbjct: 61  KVFVDPKSLPYIDGTELDFAREGLNEGFKFHNPNVKDECGCGESFRI 107


>gi|148653429|ref|YP_001280522.1| iron-sulfur cluster assembly protein IscA [Psychrobacter sp.
           PRwf-1]
 gi|148572513|gb|ABQ94572.1| iron-sulfur cluster assembly protein IscA [Psychrobacter sp.
           PRwf-1]
          Length = 106

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 70/108 (64%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   +K+ + N +G  +GIR++++  GC+GL Y+++ V D+P   D+  E +G
Sbjct: 1   MIELTERAAKHVKDYLDN-RGHGEGIRVAIRTAGCSGLAYVLEFV-DDPDSSDEKFESNG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V +++D  S++Y+ G  +D+ TE L  GF F NPNQ   CGCG+S  +
Sbjct: 59  VNIFVDPKSMVYLDGLLMDYVTEGLNEGFKFTNPNQKGECGCGESFTV 106


>gi|219870333|ref|YP_002474708.1| iron-binding protein, HesB family iron-sulfur (Fe-S) cluster
           formation protein [Haemophilus parasuis SH0165]
 gi|219690537|gb|ACL31760.1| iron-binding protein, HesB family iron-sulfur (Fe-S) cluster
           formation protein [Haemophilus parasuis SH0165]
          Length = 107

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R++  + N +GK  G+R+ +K  GC+GL Y+++ V D   + D + E+ GV
Sbjct: 3   ITLTETAADRVRTFLEN-RGKGIGLRLGVKTSGCSGLAYVLEFV-DVLNEDDHVFEQHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL+Y+ GTE+DF  E L  GF ++NPN  + CGCG+S  +
Sbjct: 61  KIIVDEKSLVYLSGTELDFVKEGLNEGFKYNNPNVKNECGCGESFNV 107


>gi|167856665|ref|ZP_02479356.1| iron-binding protein IscA [Haemophilus parasuis 29755]
 gi|167852210|gb|EDS23533.1| iron-binding protein IscA [Haemophilus parasuis 29755]
          Length = 107

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R++  + N +GK  G+R+ +K  GC+GL Y+++ V D   + D + E+ GV
Sbjct: 3   ITLTETAADRVRTFLEN-RGKGIGLRLGVKTSGCSGLAYVLEFV-DVLNEDDHVFEQQGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL+Y+ GTE+DF  E L  GF ++NPN  + CGCG+S  +
Sbjct: 61  KIIVDEKSLVYLSGTELDFVKEGLNEGFKYNNPNVKNECGCGESFNV 107


>gi|121635087|ref|YP_975332.1| HesB-like protein [Neisseria meningitidis FAM18]
 gi|218768398|ref|YP_002342910.1| HesB-like protein [Neisseria meningitidis Z2491]
 gi|254805177|ref|YP_003083398.1| HesB/YadR/YfhF family protein [Neisseria meningitidis alpha14]
 gi|120866793|emb|CAM10546.1| HesB-like protein [Neisseria meningitidis FAM18]
 gi|121052406|emb|CAM08739.1| HesB-like protein [Neisseria meningitidis Z2491]
 gi|254668719|emb|CBA06517.1| HesB/YadR/YfhF family protein [Neisseria meningitidis alpha14]
 gi|254669833|emb|CBA04217.1| HesB family protein [Neisseria meningitidis alpha153]
 gi|254672260|emb|CBA05277.1| HesB family protein [Neisseria meningitidis alpha275]
 gi|261392345|emb|CAX49881.1| putative IscA-like protein [Neisseria meningitidis 8013]
 gi|319410645|emb|CBY91015.1| putative IscA-like protein [Neisseria meningitidis WUE 2594]
 gi|325128429|gb|EGC51310.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           N1568]
 gi|325132425|gb|EGC55118.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           M6190]
 gi|325134382|gb|EGC57027.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           M13399]
 gi|325136460|gb|EGC59066.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           M0579]
 gi|325138414|gb|EGC60982.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           ES14902]
 gi|325140400|gb|EGC62921.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           CU385]
 gi|325142585|gb|EGC64980.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           961-5945]
 gi|325144684|gb|EGC66982.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           M01-240013]
 gi|325198526|gb|ADY93982.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           G2136]
 gi|325199999|gb|ADY95454.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           H44/76]
 gi|325201908|gb|ADY97362.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           M01-240149]
 gi|325204375|gb|ADY99828.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           M01-240355]
 gi|325205852|gb|ADZ01305.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           M04-240196]
 gi|325208340|gb|ADZ03792.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           NZ-05/33]
          Length = 106

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 69/109 (63%), Gaps = 4/109 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKD 62
           ++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V  +  DGDDLI E  
Sbjct: 1   MITLTENAAKHINDYL-AKRGKGLGVRLGVKTSGCSGMAYNLEFV--DEADGDDLIFEGH 57

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 58  GARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|240949681|ref|ZP_04754016.1| hesB family protein [Actinobacillus minor NM305]
 gi|257465485|ref|ZP_05629856.1| hesB family protein [Actinobacillus minor 202]
 gi|240295939|gb|EER46615.1| hesB family protein [Actinobacillus minor NM305]
 gi|257451145|gb|EEV25188.1| hesB family protein [Actinobacillus minor 202]
          Length = 107

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA  R+K  + N +GK  G+R+ +K  GC+GL Y+++ V D   + D + E+ GV
Sbjct: 3   ITLTEAAANRVKTFLEN-RGKGIGLRLGVKTSGCSGLAYVLEFV-DVLNEDDHVFEQHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GT++DF  E L  GF + NPN  + CGCG+S  +
Sbjct: 61  KVIVDEKSLTYLDGTQLDFVKEGLNEGFKYTNPNVKNECGCGESFSV 107


>gi|580773|emb|CAA31980.1| unnamed protein product [Bradyrhizobium japonicum]
          Length = 118

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 69/110 (62%), Gaps = 1/110 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T++A+  IK  + +S+ +A G+R+ ++ GGC G +Y +  + D P   D +I+ DG
Sbjct: 1   MINLTDSALNAIKSAISSSERRAGGLRVMIEAGGCNGFKYKMG-IADEPKPDDTVIDCDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
           +KV++DS S  ++ GT IDF      SGF FHNPN  + C CG+S   ++
Sbjct: 60  LKVFVDSKSREHLAGTTIDFVLAPESSGFTFHNPNAATNCSCGKSFGCRK 109


>gi|217970605|ref|YP_002355839.1| iron-sulfur cluster assembly protein IscA [Thauera sp. MZ1T]
 gi|217507932|gb|ACK54943.1| iron-sulfur cluster assembly protein IscA [Thauera sp. MZ1T]
          Length = 107

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E+A   +   +   +GK  GIR+ +K  GC+G+ Y ++ V D   D D++ E  GV
Sbjct: 3   VTLSESAARHVSNFI-AKRGKGFGIRLGVKTSGCSGMAYKLEFV-DQTEDEDEVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVIDPKSLAYLDGTELDFVKEGLNEGFKFNNPNVKDQCGCGESFNV 107


>gi|194098844|ref|YP_002001907.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae NCCP11945]
 gi|240013961|ref|ZP_04720874.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae DGI18]
 gi|240016403|ref|ZP_04722943.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae FA6140]
 gi|240080522|ref|ZP_04725065.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae FA19]
 gi|240113110|ref|ZP_04727600.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae MS11]
 gi|240118164|ref|ZP_04732226.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID1]
 gi|240121530|ref|ZP_04734492.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID24-1]
 gi|240125903|ref|ZP_04738789.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae SK-92-679]
 gi|254493907|ref|ZP_05107078.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae 1291]
 gi|260440319|ref|ZP_05794135.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae DGI2]
 gi|268594966|ref|ZP_06129133.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae 35/02]
 gi|268596655|ref|ZP_06130822.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae FA19]
 gi|268599194|ref|ZP_06133361.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae MS11]
 gi|268601541|ref|ZP_06135708.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID18]
 gi|268603879|ref|ZP_06138046.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID1]
 gi|268682343|ref|ZP_06149205.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID332]
 gi|268684500|ref|ZP_06151362.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae SK-92-679]
 gi|291043613|ref|ZP_06569329.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae DGI2]
 gi|293398922|ref|ZP_06643087.1| iron-sulfur cluster assembly protein IscA [Neisseria gonorrhoeae
           F62]
 gi|193934134|gb|ACF29958.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae NCCP11945]
 gi|226512947|gb|EEH62292.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae 1291]
 gi|268548355|gb|EEZ43773.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae 35/02]
 gi|268550443|gb|EEZ45462.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae FA19]
 gi|268583325|gb|EEZ48001.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae MS11]
 gi|268585672|gb|EEZ50348.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID18]
 gi|268588010|gb|EEZ52686.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID1]
 gi|268622627|gb|EEZ55027.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID332]
 gi|268624784|gb|EEZ57184.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae SK-92-679]
 gi|291012076|gb|EFE04065.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae DGI2]
 gi|291610336|gb|EFF39446.1| iron-sulfur cluster assembly protein IscA [Neisseria gonorrhoeae
           F62]
 gi|317164423|gb|ADV07964.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 126

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EK 61
           +++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V +   +GDDLI E 
Sbjct: 20  NMITLTENAAKHINDYLA-KRGKGLGVRLGVKTSGCSGMAYNLEFVDE--ANGDDLIFEG 76

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 77  HGARIYIDPKSLVYLDGTQVDYTKEDLQEGFKFENPNVKDSCGCGESFHV 126


>gi|146342271|ref|YP_001207319.1| Iron-binding protein IscA [Bradyrhizobium sp. ORS278]
 gi|146195077|emb|CAL79102.1| Iron-binding protein IscA (iron-sulfur cluster assembly protein)
           [Bradyrhizobium sp. ORS278]
          Length = 106

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T++AV  ++  +  S     G+RI ++ GGCAGL+Y + LV+ +  + D +IE++G
Sbjct: 1   MINLTDSAVNAVRNAITTSDKPVDGLRIMVEAGGCAGLKYNMGLVSGSEPE-DTVIEREG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           V+V +D  SL Y+ GT IDF      SGF F NPN  S+CGCG+S
Sbjct: 60  VRVLVDHKSLEYLEGTTIDFVVALEGSGFTFENPNAKSSCGCGKS 104


>gi|255318953|ref|ZP_05360178.1| iron-sulfur cluster assembly protein IscA [Acinetobacter
           radioresistens SK82]
 gi|262378311|ref|ZP_06071468.1| iron-sulfur cluster assembly protein IscA [Acinetobacter
           radioresistens SH164]
 gi|255303970|gb|EET83162.1| iron-sulfur cluster assembly protein IscA [Acinetobacter
           radioresistens SK82]
 gi|262299596|gb|EEY87508.1| iron-sulfur cluster assembly protein IscA [Acinetobacter
           radioresistens SH164]
          Length = 106

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 70/108 (64%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I+  + N +GK +GIRI +K  GC+GL Y+++ V D+  + D + ++ G
Sbjct: 1   MIHLTETAATHIRNYLQN-RGKGEGIRIGVKTSGCSGLAYVLEFV-DDINEHDQVFDQAG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ G E+D+    L  GF F+NPNQ   CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLNGLEMDYVKNGLNEGFEFNNPNQKGECGCGESFTV 106


>gi|322514678|ref|ZP_08067706.1| iron-sulfur cluster assembly protein IscA [Actinobacillus ureae
           ATCC 25976]
 gi|322119376|gb|EFX91485.1| iron-sulfur cluster assembly protein IscA [Actinobacillus ureae
           ATCC 25976]
          Length = 107

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R++  + N +GK  G+R+ +K  GC+GL Y+++ V D   + D + E+ GV
Sbjct: 3   ITLTETAANRVRTFLEN-RGKGIGLRLGVKTSGCSGLAYVLEFV-DVLNEDDQVFEQHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF ++NPN   +CGCG+S  +
Sbjct: 61  KVIVDEKSLAYLDGTELDFVKEGLNEGFKYNNPNVKDSCGCGESFNV 107


>gi|225682593|gb|EEH20877.1| iron sulfur assembly protein [Paracoccidioides brasiliensis Pb03]
          Length = 260

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 70/104 (67%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV  +++++F    K   IR+ +K  GC+GL Y ++ V D P   D+++E+DGV
Sbjct: 157 LTITPEAVSHLRKLIFFLDPKL--IRVGVKNRGCSGLSYNLEYV-DKPAPFDEVVEQDGV 213

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+ +DS +L  ++G+E+D++ +KL S FVF NPN    CGCG+S
Sbjct: 214 KILVDSKALFSIIGSEMDWQEDKLASRFVFKNPNIKDQCGCGES 257


>gi|77361584|ref|YP_341159.1| Fe-S cluster assembly/activation protein [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76876495|emb|CAI87717.1| Fe-S cluster assembly and activation protein (possibly as
           alternative scaffold for Fe-S cluster assembly)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 107

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+AA  R++  + N +GK  G+R+ +K  GC+GL Y+++ V D   D D+     GV
Sbjct: 3   VTLTDAAANRVQSFLAN-RGKGLGLRVGIKTTGCSGLAYVLEFV-DELNDDDETFVAKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D+ SL+Y+ GT++D+  E L  GF F NPNQ   CGCG+S  +
Sbjct: 61  TLIVDAKSLVYIDGTQLDYTKEGLNEGFKFTNPNQADECGCGESFTV 107


>gi|222148977|ref|YP_002549934.1| hypothetical protein Avi_2678 [Agrobacterium vitis S4]
 gi|221735963|gb|ACM36926.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 110

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           +  VT+++ A  RI +IV +S+     +R+S++ GGC+G  Y  DL    P DGD +IE+
Sbjct: 3   TQTVTVSKNAAKRIAKIV-SSENDKHALRVSVEGGGCSGFSYKFDL-DQGPQDGDLVIER 60

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           DG  + ID  SL+YM G+EIDF    +   F   NPN V++CGCG S
Sbjct: 61  DGATLLIDPVSLVYMAGSEIDFVDNLMGQSFQITNPNAVASCGCGTS 107


>gi|254361066|ref|ZP_04977211.1| HesB family iron-sulfur (Fe-S) cluster formation protein
           [Mannheimia haemolytica PHL213]
 gi|261493607|ref|ZP_05990127.1| hesB family protein [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261495445|ref|ZP_05991893.1| hesB family protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153092552|gb|EDN73607.1| HesB family iron-sulfur (Fe-S) cluster formation protein
           [Mannheimia haemolytica PHL213]
 gi|261308950|gb|EEY10205.1| hesB family protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261310789|gb|EEY11972.1| hesB family protein [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 107

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA  R++  + N +GK  G+R+ +K  GC+GL Y+++ V D   + D + E+ GV
Sbjct: 3   ITLTEAAANRVRTFLEN-RGKGIGLRLGVKTSGCSGLAYVLEFV-DVLNEDDQVFEQHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GT++DF  E L  GF + NPN  + CGCG+S  +
Sbjct: 61  KVIVDEKSLTYLNGTQLDFVKEGLNEGFKYTNPNVKNECGCGESFSV 107


>gi|325130464|gb|EGC53224.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           OX99.30304]
          Length = 106

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 69/109 (63%), Gaps = 4/109 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKD 62
           ++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V  +  DGDDLI E  
Sbjct: 1   MITLTENAAKHINDYL-AKRGKGLGVRLGVKTSGCSGIAYNLEFV--DEADGDDLIFEGH 57

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 58  GARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|242769736|ref|XP_002341832.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Talaromyces stipitatus ATCC 10500]
 gi|218725028|gb|EED24445.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Talaromyces stipitatus ATCC 10500]
          Length = 240

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV +++ ++  SQ   + IR+ +K  GC+GL Y ++ V D P   D+++E+DGV
Sbjct: 137 MTLTPTAVSQLRSML--SQPDPKMIRVGVKNRGCSGLAYNLEYV-DKPGKFDEVVEQDGV 193

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV IDS +L  ++G+E+D+  +KL   FVF NPN    CGCG+S
Sbjct: 194 KVLIDSKALFSIIGSEMDWHEDKLSQRFVFRNPNIKEQCGCGES 237


>gi|212710630|ref|ZP_03318758.1| hypothetical protein PROVALCAL_01696 [Providencia alcalifaciens DSM
           30120]
 gi|212686711|gb|EEB46239.1| hypothetical protein PROVALCAL_01696 [Providencia alcalifaciens DSM
           30120]
          Length = 107

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE+A  RI+  + N +GK +G+R+ ++  GC+G+ Y+++   D   + D + E  GV
Sbjct: 3   ISLTESAAQRIQSFLKN-RGKGEGLRLGVRTSGCSGMAYVLEF-ADVINEEDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  S++Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIVDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVNSECGCGESFHV 107


>gi|153009681|ref|YP_001370896.1| iron-sulfur cluster assembly accessory protein [Ochrobactrum
           anthropi ATCC 49188]
 gi|151561569|gb|ABS15067.1| iron-sulfur cluster assembly accessory protein [Ochrobactrum
           anthropi ATCC 49188]
          Length = 108

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  RI +I+ +  GK   +R+S++ GGC+G  Y  DLV D   D D +IEK G 
Sbjct: 4   ITVSDSAAKRIAKILGSEPGKT-ALRVSVEGGGCSGFSYKYDLV-DEQTDDDIVIEKLGA 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS S+ YM G+EIDF  + +   F   NPN  SACGCG S  I
Sbjct: 62  KVLIDSISVPYMDGSEIDFVDDLMGQSFQIRNPNATSACGCGTSFAI 108


>gi|239831754|ref|ZP_04680083.1| iron-sulfur cluster assembly accessory protein [Ochrobactrum
           intermedium LMG 3301]
 gi|239824021|gb|EEQ95589.1| iron-sulfur cluster assembly accessory protein [Ochrobactrum
           intermedium LMG 3301]
          Length = 108

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  RI +I+ +  GK   +R+S++ GGC+G  Y  DLV D   D D +IEK G 
Sbjct: 4   ITVSDSAAKRIAKILGSEPGKT-ALRVSVEGGGCSGFSYKYDLV-DEQADDDIVIEKLGA 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS S+ YM G+EIDF  + +   F   NPN  SACGCG S  I
Sbjct: 62  KVLIDSISVPYMDGSEIDFVDDLMGQSFQIRNPNATSACGCGTSFAI 108


>gi|167563356|ref|ZP_02356272.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           oklahomensis EO147]
 gi|167570526|ref|ZP_02363400.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           oklahomensis C6786]
          Length = 107

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D  V+ D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGLGLRLGVRTTGCSGLAYKLEYVDDCAVE-DQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVFVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|91205760|ref|YP_538115.1| Iron-sulfur cluster assembly accessory protein [Rickettsia bellii
           RML369-C]
 gi|157827114|ref|YP_001496178.1| Iron-sulfur cluster assembly accessory protein [Rickettsia bellii
           OSU 85-389]
 gi|91069304|gb|ABE05026.1| Iron-sulfur cluster assembly accessory protein [Rickettsia bellii
           RML369-C]
 gi|157802418|gb|ABV79141.1| Iron-sulfur cluster assembly accessory protein [Rickettsia bellii
           OSU 85-389]
          Length = 111

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 69/108 (63%), Gaps = 1/108 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++T++A  +++ ++        GIR+ +K GGCAG  Y V+   DN    D+++E+ G
Sbjct: 5   VISLTDSAAKQVQLLIEKRNKPTYGIRVGVKSGGCAGQTYYVEYA-DNKNQFDEVVEEKG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V++ ID  +L+Y+LG+E+D+   K  S F F NPN+ + CGCG+S  +
Sbjct: 64  VRILIDPKALMYILGSEMDYVETKFKSQFTFTNPNEKANCGCGKSFSV 111


>gi|257455229|ref|ZP_05620464.1| iron-sulfur cluster assembly protein IscA [Enhydrobacter aerosaccus
           SK60]
 gi|257447191|gb|EEV22199.1| iron-sulfur cluster assembly protein IscA [Enhydrobacter aerosaccus
           SK60]
          Length = 113

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 67/110 (60%), Gaps = 2/110 (1%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           S ++ ++  A   +++ + N +G  +GIR+ ++  GC+GL Y+++ V D P   D   E 
Sbjct: 6   SKVIELSNDAAQHVRDFLQN-RGHGEGIRVGIRTAGCSGLAYVLEFV-DEPDPNDQRFES 63

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +GV V+ID  SL+Y+ G ++DF  E L  GF F NPNQ   CGCG+S  +
Sbjct: 64  NGVSVFIDPKSLVYLNGLKMDFVKEGLNEGFKFSNPNQKGECGCGESFTV 113


>gi|183599752|ref|ZP_02961245.1| hypothetical protein PROSTU_03257 [Providencia stuartii ATCC 25827]
 gi|188022013|gb|EDU60053.1| hypothetical protein PROSTU_03257 [Providencia stuartii ATCC 25827]
          Length = 107

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE+A  RI+  +  S+GK +G+R+ ++  GC+G+ Y+++   D   + D + E  GV
Sbjct: 3   ISLTESAAQRIQAFL-ASRGKGEGLRLGVRTSGCSGMAYILEF-ADIINEEDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  S++Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIVDGKSIVYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFHV 107


>gi|123441404|ref|YP_001005391.1| iron-sulfur cluster assembly protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|238758820|ref|ZP_04619993.1| Iron-binding protein iscA [Yersinia aldovae ATCC 35236]
 gi|332162653|ref|YP_004299230.1| iron-sulfur cluster assembly protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|166215529|sp|A1JKQ4|ISCA_YERE8 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|122088365|emb|CAL11156.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238702928|gb|EEP95472.1| Iron-binding protein iscA [Yersinia aldovae ATCC 35236]
 gi|318606759|emb|CBY28257.1| iron binding protein IscA for iron-sulfur cluster assembly
           [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325666883|gb|ADZ43527.1| iron-sulfur cluster assembly protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
          Length = 107

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++++A  R+   + N++GK  G+R+ ++  GC+G+ Y+++ V D   D D + E  GV
Sbjct: 3   ISISDSAAQRVSAFL-NNRGKGLGLRLGVRTSGCSGMAYILEFV-DEMNDDDIVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  S++Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFNV 107


>gi|241251061|ref|XP_002403434.1| iron-sulfur protein Isa2, putative [Ixodes scapularis]
 gi|241998666|ref|XP_002433976.1| iron-sulfur protein Isa2, putative [Ixodes scapularis]
 gi|215495735|gb|EEC05376.1| iron-sulfur protein Isa2, putative [Ixodes scapularis]
 gi|215496508|gb|EEC06148.1| iron-sulfur protein Isa2, putative [Ixodes scapularis]
          Length = 129

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 72/107 (67%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AAV RI+ ++ +++G A G+R+ +K  GC GL Y++D  T+     D  + +DGV
Sbjct: 25  LVLTKAAVERIQRLL-STKGDAIGLRVGVKHRGCNGLTYVLDYATEKG-RFDVEVHQDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++DS + L +LGTE+DF   +L S FVF+NPN    CGCG+S  +
Sbjct: 83  KVFVDSKAQLSLLGTEMDFVETELSSEFVFNNPNVKGTCGCGESFTL 129


>gi|319943703|ref|ZP_08017984.1| iron-sulfur cluster assembly protein IscA [Lautropia mirabilis ATCC
           51599]
 gi|319742936|gb|EFV95342.1| iron-sulfur cluster assembly protein IscA [Lautropia mirabilis ATCC
           51599]
          Length = 107

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TEAA   I   +   +GK  G+R+ +K  GC+GL Y ++   D+  + D + E  GV
Sbjct: 3   VTLTEAAARHIDRYI-ARRGKGIGLRLGVKTSGCSGLSYKLEYA-DSQQESDLVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+ID  SL Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  I
Sbjct: 61  RVFIDPKSLAYIDGTELDFVREGLNEGFKFNNPNVRNECGCGESFNI 107


>gi|170033040|ref|XP_001844387.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167873501|gb|EDS36884.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 130

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 71/109 (65%), Gaps = 6/109 (5%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQ--GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +T+T AAV RIK+++   QGK++  G+++ +++ GC GL Y +D  T      D+ + +D
Sbjct: 26  LTLTPAAVNRIKQLL---QGKSEYIGLKVGVRQRGCNGLSYTLDYATTKD-KMDEEVVQD 81

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVKV ID  + L +LGTE+DF   KL + FVF+NPN    CGCG+S  I
Sbjct: 82  GVKVLIDKKAQLSLLGTEMDFVENKLSAEFVFNNPNIKGTCGCGESFSI 130


>gi|126135146|ref|XP_001384097.1| Iron Sulfur Assembly [Scheffersomyces stipitis CBS 6054]
 gi|126091295|gb|ABN66068.1| Iron Sulfur Assembly [Scheffersomyces stipitis CBS 6054]
          Length = 119

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 69/105 (65%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T  AV  ++ ++   Q K   IRI ++  GC+GL Y ++ V D P   D+LIE+DG
Sbjct: 15  LITLTSNAVDHLQALLNQPQPKL--IRIGVRNRGCSGLTYNLEYV-DQPGKFDELIEQDG 71

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV IDS +L  ++G+E+D+  +KL S F+F NPN    CGCG+S
Sbjct: 72  VKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGES 116


>gi|68473290|ref|XP_719203.1| hypothetical protein CaO19.12967 [Candida albicans SC5314]
 gi|68473523|ref|XP_719086.1| hypothetical protein CaO19.5521 [Candida albicans SC5314]
 gi|46440887|gb|EAL00188.1| hypothetical protein CaO19.5521 [Candida albicans SC5314]
 gi|46441010|gb|EAL00310.1| hypothetical protein CaO19.12967 [Candida albicans SC5314]
          Length = 269

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 70/105 (66%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T +AV  ++ ++   Q   + IRI ++  GC+GL Y ++ V D P   D+L+E+DG
Sbjct: 165 LITLTSSAVQHLQGLL--DQPDPKLIRIGVRNRGCSGLTYNLEYV-DKPGKFDELVEQDG 221

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV IDS +L  ++G+E+D+  +KL S F+F NPN    CGCG+S
Sbjct: 222 VKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGES 266


>gi|308454527|ref|XP_003089882.1| hypothetical protein CRE_21045 [Caenorhabditis remanei]
 gi|308267972|gb|EFP11925.1| hypothetical protein CRE_21045 [Caenorhabditis remanei]
          Length = 129

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV RI+ ++   Q  A  ++I +++ GC GL Y ++   +     D+ +E+DG+
Sbjct: 25  LTLTNDAVNRIR-VLLAQQNDANALKIGVRQKGCNGLTYTLEYARERQ-KFDEEVEQDGI 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KVWI+  + L +LG+E+D+ T+KL S FVF NPN    CGCG+S  I
Sbjct: 83  KVWIEPKAQLSLLGSEMDYVTDKLSSEFVFRNPNIKGTCGCGESFSI 129


>gi|295669196|ref|XP_002795146.1| iron-binding protein iscA [Paracoccidioides brasiliensis Pb01]
 gi|226285080|gb|EEH40646.1| iron-binding protein iscA [Paracoccidioides brasiliensis Pb01]
          Length = 260

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 70/104 (67%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV  +++++   Q   + IR+ +K  GC+GL Y ++ V D P   D+++E+DGV
Sbjct: 157 LTITPEAVSHLRKLI--DQPDPKLIRVGVKNRGCSGLSYNLEYV-DKPAPFDEVVEQDGV 213

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+ +DS +L  ++G+E+D++ +KL S FVF NPN    CGCG+S
Sbjct: 214 KILVDSKALFSIIGSEMDWQEDKLASRFVFKNPNIKDQCGCGES 257


>gi|241956608|ref|XP_002421024.1| iron sulfur assembly protein, putative [Candida dubliniensis CD36]
 gi|223644367|emb|CAX41180.1| iron sulfur assembly protein, putative [Candida dubliniensis CD36]
          Length = 265

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 70/105 (66%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T +AV  ++ ++   Q   + IRI ++  GC+GL Y ++ V D P   D+L+E+DG
Sbjct: 161 LITLTSSAVQHLQGLL--DQPDPKLIRIGVRNRGCSGLTYNLEYV-DKPGKFDELVEQDG 217

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV IDS +L  ++G+E+D+  +KL S F+F NPN    CGCG+S
Sbjct: 218 VKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGES 262


>gi|148257172|ref|YP_001241757.1| Iron-binding protein IscA [Bradyrhizobium sp. BTAi1]
 gi|146409345|gb|ABQ37851.1| Iron-binding protein IscA (iron-sulfur cluster assembly protein)
           [Bradyrhizobium sp. BTAi1]
          Length = 107

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T++A+  ++  +  S     G+RI ++ GGCAGL+Y + LV+ +  + D +IE++G
Sbjct: 2   MINLTDSAINAVRNAITTSDKPVDGLRIMVEAGGCAGLKYNMGLVSGSEPE-DTVIEREG 60

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           V+V +D  SL Y+ GT IDF      SGF F NPN  S+CGCG+S
Sbjct: 61  VRVLVDHKSLEYLEGTTIDFVVALEGSGFTFENPNAKSSCGCGKS 105


>gi|238883113|gb|EEQ46751.1| hypothetical protein CAWG_05116 [Candida albicans WO-1]
          Length = 269

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 70/105 (66%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T +AV  ++ ++   Q   + IRI ++  GC+GL Y ++ V D P   D+L+E+DG
Sbjct: 165 LITLTSSAVQHLQGLL--DQPDPKLIRIGVRNRGCSGLTYNLEYV-DKPGKFDELVEQDG 221

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV IDS +L  ++G+E+D+  +KL S F+F NPN    CGCG+S
Sbjct: 222 VKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGES 266


>gi|312113059|ref|YP_004010655.1| iron-sulfur cluster assembly accessory protein [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311218188|gb|ADP69556.1| iron-sulfur cluster assembly accessory protein [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 111

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++E A  RI+EIV ++QG+   +RIS++ GGC+G  Y  ++V +   D D +IEK G 
Sbjct: 7   ISVSERAANRIREIVGSAQGE-NALRISVQGGGCSGFSYNFEIVLEAAAD-DIVIEKSGA 64

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V ID  S+ +M G+EIDF  + + S F   NPN  ++CGCG S  I
Sbjct: 65  RVVIDPVSVPFMAGSEIDFIDDLMGSSFKITNPNATASCGCGTSFSI 111


>gi|311278541|ref|YP_003940772.1| iron-sulfur cluster assembly protein IscA [Enterobacter cloacae
           SCF1]
 gi|308747736|gb|ADO47488.1| iron-sulfur cluster assembly protein IscA [Enterobacter cloacae
           SCF1]
          Length = 107

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D P D D + E  GV
Sbjct: 3   ITLSDSAAARVSTFLAN-RGKGFGLRLGVRTSGCSGMAYVLEFV-DEPADEDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL ++ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVVVDGKSLQFLNGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFNV 107


>gi|145589672|ref|YP_001156269.1| iron-sulfur cluster assembly protein IscA [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145048078|gb|ABP34705.1| iron-sulfur cluster assembly protein IscA [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 107

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+ A   +   +   +GK  G+R+ ++  GC+GL Y ++ V D P   D + E +GV
Sbjct: 3   ITLTDKAAKHVNRNL-EKRGKGCGLRLGVRTTGCSGLAYQLEYV-DEPAPEDQVFESNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV+ID  SL Y+ GTE+DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVFIDPKSLAYLDGTELDFVREGLNEGFKFQNPNVKDECGCGESFRV 107


>gi|268593198|ref|ZP_06127419.1| iron-sulfur cluster assembly protein IscA [Providencia rettgeri DSM
           1131]
 gi|291311246|gb|EFE51699.1| iron-sulfur cluster assembly protein IscA [Providencia rettgeri DSM
           1131]
          Length = 107

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE+A  RI+  + N +GK +G+R+ ++  GC+G+ Y+++   D   + D + E  GV
Sbjct: 3   ISLTESAAQRIQSFLQN-RGKGEGLRLGVRTSGCSGMAYVLEF-ADIINEEDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  S++Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIVDGKSIVYLDGTELDFVKEGLNEGFKFNNPNVNSECGCGESFHV 107


>gi|198282960|ref|YP_002219281.1| iron-sulfur cluster assembly protein IscA [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218665449|ref|YP_002425163.1| iron-sulfur cluster assembly protein IscA [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198247481|gb|ACH83074.1| iron-sulfur cluster assembly protein IscA [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218517662|gb|ACK78248.1| iron-sulfur cluster assembly protein IscA [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 107

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 68/104 (65%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++E+A  ++++ +   +GK  GIRI +K  GC+GL Y+++ V D P   D +   D V
Sbjct: 3   LTLSESAARQVRKSI-AKRGKGLGIRIGVKTSGCSGLSYVMEFV-DVPNPEDLVFPHDDV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            +++D  SL+Y+ GTE+DF  E L  GF F+NPN   ACGCG+S
Sbjct: 61  NLFVDPKSLIYLDGTELDFTREGLNEGFRFNNPNVKDACGCGES 104


>gi|118594584|ref|ZP_01551931.1| Iron-sulphur cluster assembly protein IscA [Methylophilales
           bacterium HTCC2181]
 gi|118440362|gb|EAV46989.1| Iron-sulphur cluster assembly protein IscA [Methylophilales
           bacterium HTCC2181]
          Length = 107

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+ A  R+ E    S+GK  G+++++K  GC+G+ Y+++   + P + D + E  G+
Sbjct: 3   ITLTKKAAERV-EKYLESRGKGVGLKLAVKTTGCSGMAYVLEFSDEIPAE-DQVFESHGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL+Y+ GTE+DF  E L  GF F+NPN   +CGCG+S  +
Sbjct: 61  KIMVDPKSLIYIDGTELDFAKEGLNEGFQFNNPNVKDSCGCGESFTV 107


>gi|241763767|ref|ZP_04761814.1| iron-sulfur cluster assembly protein IscA [Acidovorax delafieldii
           2AN]
 gi|241366986|gb|EER61382.1| iron-sulfur cluster assembly protein IscA [Acidovorax delafieldii
           2AN]
          Length = 107

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA   +   +   +GK  G+R+ +K  GC+GL Y ++ V D   + D + E  GV
Sbjct: 3   ITLTEAAARHVTRYL-ARRGKGLGVRLGVKTTGCSGLAYKLEYVDDAEPE-DIVFENHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+DF  E L  GF F+NPN+   CGCG+S  +
Sbjct: 61  KVLIDPKSLAYIDGTELDFVREGLNEGFRFNNPNERDRCGCGESFRV 107


>gi|149236257|ref|XP_001524006.1| hypothetical protein LELG_04819 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146452382|gb|EDK46638.1| hypothetical protein LELG_04819 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 310

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 71/105 (67%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T +A+  ++ ++  +Q   + IRI ++  GC+GL Y +D V + P   D+LIE+DG
Sbjct: 206 LITLTPSAISHLEGLM--NQPTPKLIRIGVRNRGCSGLTYDLDYV-EKPGKFDELIEQDG 262

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV IDS +L  ++G+E+D+  +KL S F+F NPN    CGCG+S
Sbjct: 263 VKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGES 307


>gi|40063435|gb|AAR38246.1| iron-sulfur cluster assembly accessory protein [uncultured marine
           bacterium 580]
          Length = 107

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTE A  R K  + +S+GK  G+++ +K  GC+G+ Y+++ V D     D + E  G+
Sbjct: 3   ISMTEKAANRAKSYL-DSRGKGVGLKLGVKTTGCSGMAYVLEFV-DEASPEDQIFESHGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL+Y+ GTE+DF  E L  GF F+NPN   +CGCG+S  +
Sbjct: 61  KILVDPKSLIYIDGTELDFVREGLNEGFQFNNPNVKDSCGCGESFTV 107


>gi|320162973|gb|EFW39872.1| ATP synthase subunit delta [Capsaspora owczarzaki ATCC 30864]
          Length = 221

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 71/108 (65%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T AA  ++K ++   Q  + G+RI +KK GC+GL Y +D   D  +  D+ ++ +G
Sbjct: 21  LMTVTAAAAAQLK-VLLAEQPGSYGMRIGVKKRGCSGLSYTLDFA-DKKLPLDEEVKAEG 78

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + V IDS +L  ++GTE+D+ +++L S FVF NPN  S CGCG+S  +
Sbjct: 79  LNVLIDSKALFSLIGTEMDYVSDRLRSEFVFTNPNVKSMCGCGESFNV 126


>gi|329904113|ref|ZP_08273679.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327548135|gb|EGF32851.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 107

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   I   +   +GK  G+R  ++  GC+GL Y ++ V ++  + D + E  GV
Sbjct: 3   ITLTEKAAKHISRYM-ERRGKGIGLRFGVRTTGCSGLAYKLEYVDESATE-DSMFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++D  SL Y+ GTE+DF  E L  GF F+NPN   ACGCG+S  I
Sbjct: 61  KLFVDPKSLPYIDGTELDFAREGLNEGFKFYNPNVKDACGCGESFRI 107


>gi|253997042|ref|YP_003049106.1| iron-sulfur cluster assembly protein IscA [Methylotenera mobilis
           JLW8]
 gi|253983721|gb|ACT48579.1| iron-sulfur cluster assembly protein IscA [Methylotenera mobilis
           JLW8]
          Length = 107

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+++ + N +GK  G+R+ +K  GC+G+ Y ++ V D     D   E  GV
Sbjct: 3   ITLTETAASRVEKFLAN-RGKGVGLRLGVKTTGCSGMAYTLEFV-DEMHPEDVAFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFTKEGLNEGFKFNNPNVKDECGCGESFTV 107


>gi|226290008|gb|EEH45492.1| iron-binding protein iscA [Paracoccidioides brasiliensis Pb18]
          Length = 260

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 70/104 (67%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV  +++++   Q   + IR+ +K  GC+GL Y ++ V D P   D+++E+DGV
Sbjct: 157 LTITPEAVSHLRKLI--DQPDPKLIRVGVKNRGCSGLSYNLEYV-DKPAPFDEVVEQDGV 213

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+ +DS +L  ++G+E+D++ +KL S FVF NPN    CGCG+S
Sbjct: 214 KILVDSKALFSIIGSEMDWQEDKLASRFVFKNPNIKDQCGCGES 257


>gi|50553450|ref|XP_504136.1| YALI0E19206p [Yarrowia lipolytica]
 gi|49650005|emb|CAG79731.1| YALI0E19206p [Yarrowia lipolytica]
          Length = 250

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 70/108 (64%), Gaps = 3/108 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++  AV  +K+++   Q + + IRI ++  GC+GL Y +D V D P   D+ + +DG
Sbjct: 146 VITLSPTAVKHLKDLL--DQPEPKLIRIGVRNRGCSGLTYHIDYV-DKPAKFDEEVVQDG 202

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V+V IDS +L  ++G+E+D+  +KL S F+F NPN    CGCG+S  +
Sbjct: 203 VRVLIDSKALFSIIGSEMDWLDDKLSSRFIFRNPNSKGECGCGESFMV 250


>gi|260950671|ref|XP_002619632.1| hypothetical protein CLUG_00791 [Clavispora lusitaniae ATCC 42720]
 gi|238847204|gb|EEQ36668.1| hypothetical protein CLUG_00791 [Clavispora lusitaniae ATCC 42720]
          Length = 266

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 69/105 (65%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++  AV  ++ ++   Q   Q IRI ++  GC+GL Y ++ V D P   D+L+E+DG
Sbjct: 162 LITLSPGAVEHLRALL--DQPNPQLIRIGVRNRGCSGLTYHLEYV-DKPGKFDELVEQDG 218

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           V+V IDS +L  ++G+E+D+  +KL S F+F NPN    CGCG+S
Sbjct: 219 VQVLIDSKALFSIVGSEMDWIDDKLSSRFIFKNPNSKGTCGCGES 263


>gi|311279426|ref|YP_003941657.1| FeS assembly scaffold SufA [Enterobacter cloacae SCF1]
 gi|308748621|gb|ADO48373.1| FeS assembly scaffold SufA [Enterobacter cloacae SCF1]
          Length = 124

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 66/108 (61%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T AA   ++E+   ++   QGIR+ +K+ GCAG  Y++D VT+ P D D L E DG 
Sbjct: 18  IHLTPAAAAHVRELA--AKQDVQGIRLGVKQSGCAGFAYVLDTVTE-PHDDDLLFESDGA 74

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           K+W+   ++ ++ GTE+D+  E L   F FHNP     CGCG+S  ++
Sbjct: 75  KLWVSLKAMPFIDGTEVDYVREGLNQIFKFHNPKAQHECGCGESFGVQ 122


>gi|238795102|ref|ZP_04638693.1| Iron-binding protein iscA [Yersinia intermedia ATCC 29909]
 gi|238725550|gb|EEQ17113.1| Iron-binding protein iscA [Yersinia intermedia ATCC 29909]
          Length = 107

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D   D D + E  GV
Sbjct: 3   ISISDSAAQRVSAFL-NHRGKGLGLRLGVRTSGCSGMAYVLEFV-DEMNDDDVIFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  S++Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFNV 107


>gi|212542107|ref|XP_002151208.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Penicillium marneffei ATCC 18224]
 gi|210066115|gb|EEA20208.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Penicillium marneffei ATCC 18224]
          Length = 240

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV +++ ++  SQ   + IR+ +K  GC+GL Y ++ V D P   D+++E+DGV
Sbjct: 137 MTLTPTAVSQLQSML--SQPDPKMIRVGVKNRGCSGLAYSLEYV-DKPGKFDEVVEQDGV 193

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV IDS +L  ++G+E+D+  +KL   FVF NPN    CGCG+S
Sbjct: 194 KVLIDSKALFSIIGSEMDWHEDKLSQRFVFRNPNIKEQCGCGES 237


>gi|226953089|ref|ZP_03823553.1| iron-binding protein possibly involved in Fe-S protein formation or
           repair [Acinetobacter sp. ATCC 27244]
 gi|226836181|gb|EEH68564.1| iron-binding protein possibly involved in Fe-S protein formation or
           repair [Acinetobacter sp. ATCC 27244]
          Length = 106

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 70/109 (64%), Gaps = 4/109 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVD-GDDLIEKD 62
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V D  VD  D++ E+ 
Sbjct: 1   MIHLTENAATHISNYLQN-RGKGEGIRVGVKTSGCSGLAYVLEFVDD--VDTHDEVFEQF 57

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVKV++D  SL+Y+ G E+D+    L  GF F+NPNQ   CGCG+S  +
Sbjct: 58  GVKVFVDPKSLVYLEGLEMDYVKNGLNEGFEFNNPNQKGECGCGESFTV 106


>gi|330722244|gb|EGH00126.1| Iron binding protein IscA for iron-sulfur cluster assembly [gamma
           proteobacterium IMCC2047]
          Length = 107

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT  A   + + +   +GK  G+R+ ++  GC+GL Y+++ V D   +GD + E  GV
Sbjct: 3   ITMTATAAEHVTKHL-AQRGKGIGVRVGVRTSGCSGLAYVLEFV-DKADEGDQIFEDHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y+ GTE+DF TE L  GF F NPN    CGCG+S  +
Sbjct: 61  KIVVDEKSLAYLDGTELDFVTEGLNEGFKFTNPNVSGECGCGESFNV 107


>gi|157803650|ref|YP_001492199.1| Iron-sulfur cluster assembly accessory protein [Rickettsia
           canadensis str. McKiel]
 gi|157784913|gb|ABV73414.1| Iron-sulfur cluster assembly accessory protein [Rickettsia
           canadensis str. McKiel]
          Length = 110

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 69/111 (62%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T++A  +IK ++        GIR+ +K GGCAG  Y V+   D+    D+++E
Sbjct: 1   MKNVISLTDSAAKQIKLLIAKRDKPTFGIRVGVKSGGCAGQTYYVEYA-DSKNQFDEIVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GV++ ID  +L+Y+LG+++D+   K  S F F NPN+   CGCG+S  +
Sbjct: 60  AKGVRILIDPKALMYILGSKMDYVETKFKSQFTFTNPNEKGNCGCGKSFSV 110


>gi|242240167|ref|YP_002988348.1| iron-sulfur cluster assembly protein IscA [Dickeya dadantii Ech703]
 gi|242132224|gb|ACS86526.1| iron-sulfur cluster assembly protein IscA [Dickeya dadantii Ech703]
          Length = 107

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+   + N +GK  G+R+ +K  GC+G+ Y+++ V D   + D + E  GV
Sbjct: 3   ITLSDSAAQRVSNFLVN-RGKGIGLRLGVKTSGCSGMAYVLEFV-DELSEDDVVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GT++DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDGKSLVYLDGTQLDFIKEGLNEGFKFNNPNVSSECGCGESFNV 107


>gi|294140364|ref|YP_003556342.1| HesB/YadR/YfhF family protein [Shewanella violacea DSS12]
 gi|293326833|dbj|BAJ01564.1| HesB/YadR/YfhF family protein [Shewanella violacea DSS12]
          Length = 107

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MT AA  R+K  + N +GK  G+R+ LK  GC+G+ Y+++ V D+  D D++ E   V
Sbjct: 3   ISMTPAAADRVKSFLSN-RGKGIGLRLGLKTSGCSGMVYVIEFV-DDLNDDDEVYEVADV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID+ S +Y+ G E+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIIDAKSFIYLQGIELDFVKEGLNEGFQFNNPNAKGECGCGESFTV 107


>gi|259487334|tpe|CBF85927.1| TPA: iron-sulfur cluster assembly accessory protein Isa1, putative
           (AFU_orthologue; AFUA_4G10690) [Aspergillus nidulans
           FGSC A4]
          Length = 242

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 72/104 (69%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T  AV ++++++  SQ + + IR+ +K  GC+GL Y ++ V D P   D+++E+DGV
Sbjct: 139 MKLTPIAVEQLRKLL--SQPEPRLIRVGVKNRGCSGLAYHLEYV-DKPGTFDEVVEQDGV 195

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV IDS +L  ++G+E+D++ +KL + FVF NPN    CGCG+S
Sbjct: 196 KVLIDSKALFSIIGSEMDWQEDKLSARFVFRNPNIKEECGCGES 239


>gi|53802540|ref|YP_112784.1| HesB/YadR/YfhF family protein [Methylococcus capsulatus str. Bath]
 gi|53756301|gb|AAU90592.1| HesB/YadR/YfhF family protein [Methylococcus capsulatus str. Bath]
          Length = 107

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+ A  ++++ +  ++G   G+R+++K  GC+GL Y ++ V D P   D   E  GV
Sbjct: 3   VTLTQKAAAQVQKHL-AARGTGVGLRVAVKTSGCSGLAYALEFV-DEPAPEDQRFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  SL+Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  TVLVDPKSLVYLEGTELDFVREGLNEGFKFNNPNVKNECGCGESFNV 107


>gi|255020954|ref|ZP_05293010.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Acidithiobacillus caldus ATCC 51756]
 gi|254969745|gb|EET27251.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Acidithiobacillus caldus ATCC 51756]
          Length = 107

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 65/104 (62%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +TE A  +++  +   +GK QGIRI +K  GC+GL Y+++ V D P   D +     V
Sbjct: 3   IVLTERAAEQVRRSI-AKRGKGQGIRIGVKTSGCSGLSYVMEFV-DEPRPEDRVFSHADV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++D  SL+Y+ G E+DF  E L  GF F+NPN  + CGCG+S
Sbjct: 61  RLFVDPKSLIYLDGMEVDFTREGLNQGFRFNNPNVKNTCGCGES 104


>gi|91775159|ref|YP_544915.1| iron-sulfur cluster assembly protein IscA [Methylobacillus
           flagellatus KT]
 gi|91709146|gb|ABE49074.1| iron-sulfur cluster assembly protein IscA [Methylobacillus
           flagellatus KT]
          Length = 107

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE A  R+++ + N +GK  G+R+ +K  GC+G+ Y ++ V +  V+ D + E  GV
Sbjct: 3   ISLTETAAKRVQKFLAN-RGKGVGLRLGVKTTGCSGMAYTLEFVDEIQVE-DLVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDPKSLVYIDGTELDFAKEGLNEGFKFNNPNVKDECGCGESFTV 107


>gi|253988845|ref|YP_003040201.1| iron-sulfur cluster assembly protein [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253780295|emb|CAQ83456.1| iron-binding protein isca (iron-sulfur cluster assembly protein)
           [Photorhabdus asymbiotica]
          Length = 107

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE+A  R+   + N +GK  G+R+ ++  GC+G+ Y+++   D   + D + E  GV
Sbjct: 3   ISLTESAAQRVSSFLSN-RGKGVGLRLGVRTSGCSGMAYLLEF-ADVINEDDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  S++Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFNV 107


>gi|238788185|ref|ZP_04631980.1| Iron-binding protein iscA [Yersinia frederiksenii ATCC 33641]
 gi|238723772|gb|EEQ15417.1| Iron-binding protein iscA [Yersinia frederiksenii ATCC 33641]
          Length = 107

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D   D D + E  GV
Sbjct: 3   ISISDSAAQRVSAFL-NHRGKGLGLRLGVRTSGCSGMAYVLEFV-DEMNDDDIVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  S++Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFNV 107


>gi|59801060|ref|YP_207772.1| hypothetical protein NGO0632 [Neisseria gonorrhoeae FA 1090]
 gi|239999131|ref|ZP_04719055.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae 35/02]
 gi|240115866|ref|ZP_04729928.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID18]
 gi|240123712|ref|ZP_04736668.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID332]
 gi|59717955|gb|AAW89360.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
          Length = 106

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 69/109 (63%), Gaps = 4/109 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKD 62
           ++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V  +  +GDDLI E  
Sbjct: 1   MITLTENAAKHINDYL-AKRGKGLGVRLGVKTSGCSGMAYNLEFV--DEANGDDLIFEGH 57

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 58  GARIYIDPKSLVYLDGTQVDYTKEDLQEGFKFENPNVKDSCGCGESFHV 106


>gi|238921051|ref|YP_002934566.1| iron-sulfur cluster assembly protein IscA, [Edwardsiella ictaluri
           93-146]
 gi|259493871|sp|C5BEU3|ISCA_EDWI9 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|238870620|gb|ACR70331.1| iron-sulfur cluster assembly protein IscA, putative [Edwardsiella
           ictaluri 93-146]
          Length = 107

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 73/108 (67%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDG 63
           +TM+++A  R++  + N +GK  G+R+ +K  GC+G+ Y+++ V  + ++ DD++ E  G
Sbjct: 3   ITMSDSAAKRVQTFLTN-RGKGLGLRLGVKTSGCSGMAYVLEFV--DVLNEDDVVFEDQG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV +D  SL+Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 60  VKVIVDGKSLVYLDGTELDFVKEGLNEGFKFNNPNVKNECGCGESFNV 107


>gi|269140156|ref|YP_003296857.1| iron-sulfur cluster assembly protein [Edwardsiella tarda EIB202]
 gi|294637702|ref|ZP_06715979.1| iron-sulfur cluster assembly protein IscA [Edwardsiella tarda ATCC
           23685]
 gi|267985817|gb|ACY85646.1| iron-sulfur cluster assembly protein [Edwardsiella tarda EIB202]
 gi|291089132|gb|EFE21693.1| iron-sulfur cluster assembly protein IscA [Edwardsiella tarda ATCC
           23685]
 gi|304559990|gb|ADM42654.1| Iron binding protein IscA [Edwardsiella tarda FL6-60]
          Length = 107

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 74/108 (68%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD-G 63
           +TM+++A  R++  + N +GK  G+R+ +K  GC+G+ Y+++ V  + ++ DD++ +D G
Sbjct: 3   ITMSDSAAKRVQTFLTN-RGKGLGLRLGVKTSGCSGMAYVLEFV--DVLNEDDVVFEDKG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV +D  SL+Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 60  VKVIVDGKSLVYLDGTELDFVKEGLNEGFKFNNPNVKNECGCGESFNV 107


>gi|57335889|emb|CAH25346.1| Fe-S assembly protein 1 [Guillardia theta]
          Length = 237

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 69/109 (63%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK-D 62
           ++T+TE A  R+ E++ +      G+R+ ++  GC GL Y ++ V D P   DD++E  D
Sbjct: 130 VLTLTERAKERLAELMASKSPSPAGVRLGVRTRGCNGLSYTMNYV-DEPPKLDDVVEAGD 188

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +KV++D  +++Y+LG+ +DF  + + + FVF NPN   +CGCG+S  +
Sbjct: 189 NIKVYVDPKAVMYLLGSVMDFVEDTVRAEFVFQNPNAKGSCGCGESFNV 237


>gi|209963822|ref|YP_002296737.1| Iron-sulfur cluster assembly accessory protein [Rhodospirillum
           centenum SW]
 gi|209957288|gb|ACI97924.1| Iron-sulfur cluster assembly accessory protein [Rhodospirillum
           centenum SW]
          Length = 117

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA  R++ ++  S     G+R+ +K  GC+G+ Y V+   D     ++++E  GV
Sbjct: 12  LTLTDAAAERVRLLMARSSEPILGLRVGVKARGCSGMSYFVEYAKDRK-KFEEVVEDKGV 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + ID A+ +++LG+E+D+  ++  SGF F NPN+ + CGCG+S  +
Sbjct: 71  TILIDPAATMFLLGSEMDYVEDRFQSGFTFRNPNEKARCGCGESFTV 117


>gi|33152208|ref|NP_873561.1| hesB family protein [Haemophilus ducreyi 35000HP]
 gi|33148430|gb|AAP95950.1| hesB family protein [Haemophilus ducreyi 35000HP]
          Length = 107

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R++  + N +GK  G+R+ +K  GC+GL Y+++ V D   + D + E+ G+
Sbjct: 3   ITLTETAANRVRTFLEN-RGKGIGLRLGVKTSGCSGLAYVLEFV-DVLNEDDHVFEQHGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF + NPN  + CGCG+S  +
Sbjct: 61  KVIVDEKSLTYLDGTELDFVKEGLNEGFKYSNPNVKNECGCGESFSV 107


>gi|148261253|ref|YP_001235380.1| iron-sulfur cluster assembly accessory protein [Acidiphilium
           cryptum JF-5]
 gi|326404667|ref|YP_004284749.1| iron-binding protein IscA [Acidiphilium multivorum AIU301]
 gi|146402934|gb|ABQ31461.1| iron-sulfur cluster assembly accessory protein [Acidiphilium
           cryptum JF-5]
 gi|325051529|dbj|BAJ81867.1| iron-binding protein IscA [Acidiphilium multivorum AIU301]
          Length = 123

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 68/111 (61%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           +  ++ +T+AA  R++ +  N Q + + +RIS+   GC+GL Y ++ V D P   D+ + 
Sbjct: 15  LPPLMQLTDAAADRLRALYENGQ-QGRLLRISVGTKGCSGLSYEMNWV-DEPAPTDEQVS 72

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GV V ID  + L+++GT +D+K EK  SGF F NPN+   CGCG+S  +
Sbjct: 73  DKGVTVLIDRKATLFLIGTVMDYKVEKFTSGFTFENPNEKGRCGCGESFHV 123


>gi|157964661|ref|YP_001499485.1| Iron-sulfur cluster assembly accessory protein [Rickettsia
           massiliae MTU5]
 gi|157844437|gb|ABV84938.1| Iron-sulfur cluster assembly accessory protein [Rickettsia
           massiliae MTU5]
          Length = 117

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 70/111 (63%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T +A  ++K ++        GIR+ +K GGCAG  Y V+   D+    D+++E
Sbjct: 1   MKNVISLTASAAKQVKLLIAKRAKPTFGIRVGVKSGGCAGQTYYVEYA-DSKNQFDEVVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+++D+   K  S F F NPN+ + CGCG+S  +
Sbjct: 60  EKGVRILIDPKALMYILGSKMDYVETKFKSQFTFTNPNEKANCGCGKSFSM 110


>gi|284006764|emb|CBA72022.1| iron-binding protein (iron-sulfur cluster assembly protein)
           [Arsenophonus nasoniae]
          Length = 129

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE A  RI   + N +GK +G+R+ ++  GC+G+ Y+++ V D   + D + E  GV
Sbjct: 25  ISLTENAAERILTFLHN-RGKGEGLRLGVRTSGCSGMAYVLEFV-DVINEDDTVFEDKGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  S++Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 83  KVIIDGKSMIYLNGTELDFVKEGLNEGFKFNNPNSKNECGCGESFNV 129


>gi|296444641|ref|ZP_06886605.1| iron-sulfur cluster assembly accessory protein [Methylosinus
           trichosporium OB3b]
 gi|296257909|gb|EFH04972.1| iron-sulfur cluster assembly accessory protein [Methylosinus
           trichosporium OB3b]
          Length = 106

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 69/106 (65%), Gaps = 3/106 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKD 62
           ++ +T++A+  ++  +  +  + +G+RI ++ GGCAG +YM+ LV + NP D   L E+D
Sbjct: 1   MIELTDSALNAVRSAISGAGQEVEGLRIMVEAGGCAGFKYMMGLVNEANPAD--HLFERD 58

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           GVKV+++  SL Y+ GT++DF      SGF F NP   S+C CG+S
Sbjct: 59  GVKVFVEEGSLAYLDGTKVDFVNGLEGSGFTFENPQAKSSCSCGKS 104


>gi|307132075|ref|YP_003884091.1| FeS cluster assembly protein [Dickeya dadantii 3937]
 gi|306529604|gb|ADM99534.1| FeS cluster assembly protein [Dickeya dadantii 3937]
          Length = 107

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V +   D D + E  GV
Sbjct: 3   ISLSDSAAQRVNAFMVN-RGKGVGLRLGVRTSGCSGMAYVLEFVDELNTD-DVVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDGKSLVYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFNV 107


>gi|290476017|ref|YP_003468914.1| putative regulator [Xenorhabdus bovienii SS-2004]
 gi|289175347|emb|CBJ82150.1| putative regulator believed to be involved in Fe-S cluster assembly
           and activation [Xenorhabdus bovienii SS-2004]
          Length = 107

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE+A  RI   + N +GK  G+R+ ++  GC+G+ Y+++   D   + D + E  GV
Sbjct: 3   ISLTESAAQRILAFLDN-RGKGVGLRLGVRTSGCSGMAYILEF-ADTVNEEDQVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  S++Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIVDGKSIVYLDGTELDFAKEGLNEGFKFNNPNVSSECGCGESFHV 107


>gi|319405602|emb|CBI79225.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 107

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +++ A  +I +I+    GK   +RI+++ GGC+G  Y  DLV++N  D D +I+KDG 
Sbjct: 3   VNISDVAAKQIAQILAEQPGKT-ALRITVEGGGCSGFSYKYDLVSENKED-DLIIKKDGA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V+IDS SL +M G EIDF  + +   F  HNPN  S+CGCG S  I
Sbjct: 61  IVFIDSISLPFMEGAEIDFVDDLMGQSFQIHNPNATSSCGCGISFSI 107


>gi|288961960|ref|YP_003452270.1| hypothetical protein AZL_c04330 [Azospirillum sp. B510]
 gi|288914240|dbj|BAI75726.1| hypothetical protein AZL_c04330 [Azospirillum sp. B510]
          Length = 114

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 70/107 (65%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA  R+K ++  +  +  G+RI +K  GC+GL Y V    +  +  D+++E  GV
Sbjct: 9   ITITDAAAERVKALMSKATDEMIGLRIGVKARGCSGLSYDVQYAKEK-MKFDEVVEDKGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + ID A++++++G+E+D+  +K  +GFVF NPN+   CGCG+S  +
Sbjct: 68  TILIDPAAVMFLIGSEMDYVDDKFQTGFVFKNPNEKGRCGCGESFHV 114


>gi|121594491|ref|YP_986387.1| iron-sulfur cluster assembly protein IscA [Acidovorax sp. JS42]
 gi|222110834|ref|YP_002553098.1| iron-sulfur cluster assembly protein isca [Acidovorax ebreus TPSY]
 gi|120606571|gb|ABM42311.1| iron-sulfur cluster assembly protein IscA [Acidovorax sp. JS42]
 gi|221730278|gb|ACM33098.1| iron-sulfur cluster assembly protein IscA [Acidovorax ebreus TPSY]
          Length = 107

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA   +   +   +GK  G+R+ +K  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEAAARHVTRYL-ARRGKGVGVRLGVKTTGCSGLAYKLEYV-DEQAPEDVVFENHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+DF  E L  GF F+NPN+   CGCG+S  +
Sbjct: 61  KVLIDPKSLAYIDGTELDFVREGLNEGFRFNNPNERDRCGCGESFRV 107


>gi|91091584|ref|XP_968263.1| PREDICTED: similar to conserved hypothetical protein [Tribolium
           castaneum]
 gi|270001035|gb|EEZ97482.1| hypothetical protein TcasGA2_TC011316 [Tribolium castaneum]
          Length = 129

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T AAV R+KEI    Q    G++I +K+ GC GL Y +D V D     D+ + +DGV
Sbjct: 25  LVLTPAAVNRVKEI-LKGQDNYVGLKIGVKQRGCNGLSYTLDYV-DKKDKMDEEVVQDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +++ID  + L +LGTE+D+   KL S FVF+NPN    CGCG+S  I
Sbjct: 83  RIFIDKKAQLTLLGTEMDYVQNKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|196008961|ref|XP_002114346.1| expressed hypothetical protein [Trichoplax adhaerens]
 gi|190583365|gb|EDV23436.1| expressed hypothetical protein [Trichoplax adhaerens]
          Length = 136

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 68/105 (64%), Gaps = 2/105 (1%)

Query: 8   TEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVW 67
           T AAV ++ E++ N+   A  +RI ++  GC GL+Y ++   D     D+ + +DGVK++
Sbjct: 34  TRAAVDKVMELMNNNPAMA-ALRIGVRARGCNGLQYTLEYA-DTKKKFDEEVSQDGVKIY 91

Query: 68  IDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           IDS + L +LGTE+D+ +  L SGFVF+NPN    CGCG+S  +K
Sbjct: 92  IDSKAQLTILGTEMDYTSNILDSGFVFNNPNITGTCGCGESFSVK 136


>gi|77463210|ref|YP_352714.1| HesB/YadR/YfhF family protein [Rhodobacter sphaeroides 2.4.1]
 gi|126462084|ref|YP_001043198.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221639070|ref|YP_002525332.1| Iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides KD131]
 gi|77387628|gb|ABA78813.1| HesB/YadR/YfhF family protein [Rhodobacter sphaeroides 2.4.1]
 gi|126103748|gb|ABN76426.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221159851|gb|ACM00831.1| Iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides KD131]
          Length = 108

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 66/105 (62%), Gaps = 3/105 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T+ A  R+ EI   + G+ + +R++++ GGC+G +Y + L  D+P   D ++EKDG KV
Sbjct: 7   VTDRAFARLAEIA-EASGETRALRVAVEGGGCSGFQYEIKL--DDPGSDDLVLEKDGQKV 63

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            ID  SL ++   EID+  E + S FV HNPN  S+CGCG S  I
Sbjct: 64  LIDQVSLPFLANAEIDYTDELIGSRFVIHNPNASSSCGCGTSFSI 108


>gi|294668743|ref|ZP_06733836.1| iron-sulfur cluster assembly protein IscA [Neisseria elongata
           subsp. glycolytica ATCC 29315]
 gi|291309260|gb|EFE50503.1| iron-sulfur cluster assembly protein IscA [Neisseria elongata
           subsp. glycolytica ATCC 29315]
          Length = 106

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 70/109 (64%), Gaps = 4/109 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKD 62
           ++T+TE A   IK  +   +GK  G+R+ +K  GC+G+ Y ++ V +   D +DL+ E++
Sbjct: 1   MITITENAANYIKNFL-EKRGKGIGVRLGVKTSGCSGMAYNLEFVDE--ADPEDLVFEQN 57

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G KV+ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 58  GAKVYIDPKSLVYLDGTQMDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|49474354|ref|YP_032396.1| hypothetical protein BQ07680 [Bartonella quintana str. Toulouse]
 gi|49239858|emb|CAF26252.1| hypothetical protein BQ07680 [Bartonella quintana str. Toulouse]
          Length = 107

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +++ A  RI +I+ +   K  G+RIS++ GGC+G  Y  +LV++   D D +++KDG 
Sbjct: 3   VNISDVAAKRIAQILLSETDKI-GLRISVEGGGCSGFSYKYNLVSETSED-DLVLKKDGA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V+IDS SL +M G EIDF  + +   F  HNPN VS+CGCG S  I
Sbjct: 61  VVFIDSLSLPFMEGAEIDFVDDLMGQSFQIHNPNAVSSCGCGVSFSI 107


>gi|313902275|ref|ZP_07835680.1| iron-sulfur cluster assembly accessory protein [Thermaerobacter
           subterraneus DSM 13965]
 gi|313467426|gb|EFR62935.1| iron-sulfur cluster assembly accessory protein [Thermaerobacter
           subterraneus DSM 13965]
          Length = 124

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 66/109 (60%), Gaps = 1/109 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T  AV ++KE++   Q     +R+ ++ GGC+G  Y + L + N  D D +I++DG
Sbjct: 1   MITLTPEAVAKVKELLAERQRDDLALRVFIQPGGCSGFNYGLALDS-NLHDDDTVIDQDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           V+V +DSAS  ++ G  +D+      SGF  HNPN V  CGCGQS   +
Sbjct: 60  VRVVVDSASARFLKGARVDYVESLSGSGFAIHNPNAVHTCGCGQSFRTR 108


>gi|149927872|ref|ZP_01916123.1| iron-sulfur cluster assembly protein IscA [Limnobacter sp. MED105]
 gi|149823494|gb|EDM82725.1| iron-sulfur cluster assembly protein IscA [Limnobacter sp. MED105]
          Length = 107

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   I + +   +GK  G+RI ++  GC+G+ Y ++ V D   D D++ E  GV
Sbjct: 3   ITLTERAADHISKFL-TKRGKGIGLRIGVRTTGCSGMAYKLEFV-DAVADEDNVFEAHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++D  S+ Y+ G E+DF  E L  GF F+NPN+ + CGCG+S  +
Sbjct: 61  KLFVDPKSMPYLEGIELDFAREGLNEGFKFNNPNEKARCGCGESFTV 107


>gi|50084579|ref|YP_046089.1| iron-binding protein [Acinetobacter sp. ADP1]
 gi|49530555|emb|CAG68267.1| iron-binding protein , believed to be involved in Fe-S protein
           formation or repair [Acinetobacter sp. ADP1]
          Length = 106

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 70/108 (64%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   ++  + N +GK +GIR+ +K  GC+GL Y+++ V D+  + D + E+ G
Sbjct: 1   MIHLTETAANHVRNYLLN-RGKGEGIRVGVKTSGCSGLAYVLEFV-DDINEYDQVFEQHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  S++Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSIVYLDGLEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|288575701|ref|ZP_06393902.1| iron-sulfur cluster assembly protein IscA [Neisseria mucosa ATCC
           25996]
 gi|288567127|gb|EFC88687.1| iron-sulfur cluster assembly protein IscA [Neisseria mucosa ATCC
           25996]
          Length = 114

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 69/109 (63%), Gaps = 4/109 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKD 62
           ++T+TE A   I   +   +GK  G+R+ +K  GC+G+ Y ++ V  + V+ DDLI E+ 
Sbjct: 9   MITITENAAKHINSYL-TKRGKGLGVRLGVKTSGCSGMAYNLEFV--DEVNDDDLIFEEH 65

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +V+ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 66  GARVYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 114


>gi|330807638|ref|YP_004352100.1| iron-binding protein IscA; HesB family protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327375746|gb|AEA67096.1| putative iron-binding protein IscA; HesB family protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 107

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + MTEAA   I+  +   +GK +GIR+ ++  GC+GL Y+++ V D   + D + E  G 
Sbjct: 3   IQMTEAAANHIQRSL-AGRGKGEGIRLGVRTTGCSGLAYVLEFV-DEVGEDDQVFESHGQ 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  I
Sbjct: 61  KVIIDPKSLTYLDGTELDFVKEGLNEGFKFNNPNVRGECGCGESFNI 107


>gi|294083589|ref|YP_003550346.1| Iron-sulfur cluster assembly protein [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663161|gb|ADE38262.1| Iron-sulfur cluster assembly protein [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 116

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDN-PVDGDDLIEKD 62
           IVT+T+ A   ++ ++  ++    G+R+ +K  GC+G++Y V   T+  P +  D +E+ 
Sbjct: 8   IVTLTDKAALHVQSLMNKAESDVIGLRVGIKTTGCSGMQYDVQFATEQKPFE--DKVEEK 65

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GV ++ID  ++++++G+E+D++ +K  + FVF+NPN+++ CGCG+S  +
Sbjct: 66  GVTLFIDPTAVMFLIGSEMDWQEDKFAARFVFNNPNEIARCGCGESFSV 114


>gi|262372255|ref|ZP_06065534.1| iron-sulfur cluster assembly protein IscA [Acinetobacter junii
           SH205]
 gi|262312280|gb|EEY93365.1| iron-sulfur cluster assembly protein IscA [Acinetobacter junii
           SH205]
          Length = 106

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 69/109 (63%), Gaps = 4/109 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVD-GDDLIEKD 62
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V D  VD  D + E+ 
Sbjct: 1   MIHLTENAATHISNYLQN-RGKGEGIRVGVKTSGCSGLAYVLEFVDD--VDTHDQVFEQF 57

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVKV++D  SL+Y+ G E+D+    L  GF F+NPNQ   CGCG+S  +
Sbjct: 58  GVKVFVDPKSLVYLEGLEMDYVKNGLNEGFEFNNPNQKGECGCGESFTV 106


>gi|251788736|ref|YP_003003457.1| iron-sulfur cluster assembly protein [Dickeya zeae Ech1591]
 gi|247537357|gb|ACT05978.1| iron-sulfur cluster assembly protein IscA [Dickeya zeae Ech1591]
          Length = 107

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V +   D D + E  GV
Sbjct: 3   ISLSDSAAQRVNAFMAN-RGKGVGLRLGVRTSGCSGMAYVLEFVDELNTD-DVVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDGKSLVYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFNV 107


>gi|118602582|ref|YP_903797.1| iron-sulfur cluster assembly protein IscA [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
 gi|118567521|gb|ABL02326.1| iron-sulfur cluster assembly protein IscA [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 107

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+ AV R+ + + N +G   GIR+S++  GC+GL Y ++ V DN  + D + E + +
Sbjct: 3   ITLTDRAVERVADFLTN-RGFGIGIRLSVQTTGCSGLGYNIEFV-DNTNNDDTVFEGNDI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D+ SL+Y+ GT++D+  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  KVIVDAKSLIYLDGTQVDYIKEGLNEGFEFNNPNAKAECGCGESFTV 107


>gi|171057730|ref|YP_001790079.1| iron-sulfur cluster assembly protein IscA [Leptothrix cholodnii
           SP-6]
 gi|170775175|gb|ACB33314.1| iron-sulfur cluster assembly protein IscA [Leptothrix cholodnii
           SP-6]
          Length = 110

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TEAA   +   +   +GK  G+R+ +K  GC+GL Y ++   +   D D + E  GV
Sbjct: 6   VTLTEAAAKHVSRYI-ARRGKGVGVRLGVKTTGCSGLAYKLEYADEITPD-DHVFEGHGV 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF FHNP +   CGCG+S  +
Sbjct: 64  KVLVDPKSLPYIDGTELDFVREGLNEGFKFHNPREKDRCGCGESFRV 110


>gi|83644263|ref|YP_432698.1| hypothetical protein HCH_01411 [Hahella chejuensis KCTC 2396]
 gi|83632306|gb|ABC28273.1| uncharacterized conserved protein [Hahella chejuensis KCTC 2396]
          Length = 121

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 64/108 (59%), Gaps = 1/108 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AA   I++ +      AQG R+ LK  GC+G +Y+VDLV     D    +  D +
Sbjct: 12  LRITDAAAEHIRKQL-RQHPDAQGFRLGLKASGCSGFKYIVDLVKTPSDDDRKFVLADDI 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
            V++D+ SL Y+ G EIDF  E L   F F+NPN  S+CGCG+S  IK
Sbjct: 71  PVYVDAKSLPYINGAEIDFVKEGLNYAFKFNNPNVDSSCGCGESFSIK 118


>gi|271501583|ref|YP_003334609.1| iron-sulfur cluster assembly protein IscA [Dickeya dadantii Ech586]
 gi|270345138|gb|ACZ77903.1| iron-sulfur cluster assembly protein IscA [Dickeya dadantii Ech586]
          Length = 107

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V +   D D + E  GV
Sbjct: 3   ISLSDSAAQRVNAFMAN-RGKGIGLRLGVRTSGCSGMAYVLEFVDELNTD-DVVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDGKSLVYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFNV 107


>gi|281208989|gb|EFA83164.1| iron-sulfur cluster assembly protein [Polysphondylium pallidum
           PN500]
          Length = 141

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 71/111 (63%), Gaps = 3/111 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQ--GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           I +MT++AV +I+E++   +GK    G+++ +K+ GC+GL Y +D     P   D+++  
Sbjct: 17  IFSMTDSAVNKIRELM-KQEGKENFLGMKLGVKQKGCSGLAYTLDFTNQPPNKLDEVVTD 75

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
            GV V +DS +L+ ++GTE+D+  E +   F+F NPN  + CGCG+S  +K
Sbjct: 76  KGVTVVVDSKALMSVIGTEMDYIEEPIKKEFIFINPNATNTCGCGESFTVK 126


>gi|332307515|ref|YP_004435366.1| iron-sulfur cluster assembly protein IscA [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332174844|gb|AEE24098.1| iron-sulfur cluster assembly protein IscA [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 107

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + ++EAA  R    + N +G   G+R+ +K  GC+GL Y+++ V D   + D + E +GV
Sbjct: 3   IKISEAAAQRATSFLQN-RGSGLGLRLGVKTTGCSGLAYVLEFV-DELNEDDHVFEDNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDGKSLVYLDGTELDFAKEGLNEGFQFNNPNANGECGCGESFNV 107


>gi|160899431|ref|YP_001565013.1| iron-sulfur cluster assembly protein IscA [Delftia acidovorans
           SPH-1]
 gi|160365015|gb|ABX36628.1| iron-sulfur cluster assembly protein IscA [Delftia acidovorans
           SPH-1]
 gi|222875129|gb|EEF12260.1| predicted protein [Populus trichocarpa]
          Length = 107

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T++A   +   + + +GK  G+R+ +K  GC+GL Y ++ V D  +  D + E  G+
Sbjct: 3   ISLTDSAARHVSRYL-SRRGKGIGVRLGVKTTGCSGLAYKLEYV-DEQLPEDVIFEDHGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF FHNPN+   CGCG+S  I
Sbjct: 61  KVLVDPKSLAYIDGTELDFVREGLNEGFKFHNPNERDRCGCGESFRI 107


>gi|319787277|ref|YP_004146752.1| iron-sulfur cluster assembly accessory protein [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465789|gb|ADV27521.1| iron-sulfur cluster assembly accessory protein [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 121

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 68/110 (61%), Gaps = 2/110 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA+ R++  +     +A G+R  +++ GC+G  ++ DL  D   +GD + E  GV
Sbjct: 14  ITLTPAALERVQRFL-QRDPQALGLRFGVERTGCSGWGHVADLARDQ-REGDTVFEHAGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           ++++D+ SL  + GTEIDF  + L  GFVF NPN  + CGCG+S   + A
Sbjct: 72  RIYVDATSLPLVDGTEIDFARQGLGEGFVFRNPNAKAECGCGESFTTQPA 121


>gi|171463239|ref|YP_001797352.1| iron-sulfur cluster assembly protein IscA [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|171192777|gb|ACB43738.1| iron-sulfur cluster assembly protein IscA [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 107

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+ A   +   +   +GK  G+R+ ++  GC+GL Y ++ V D P   D + E +G+
Sbjct: 3   ITLTDKAAAHVNRNL-EKRGKGCGLRLGVRTTGCSGLAYQLEYV-DEPAAEDQVFESNGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVFVDPKSLAYLDGTELDFVREGLNEGFKFQNPNVKDECGCGESFRV 107


>gi|332558087|ref|ZP_08412409.1| Iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides WS8N]
 gi|332275799|gb|EGJ21114.1| Iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides WS8N]
          Length = 108

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 66/105 (62%), Gaps = 3/105 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T+ A  R+ EI   + G+ + +R++++ GGC+G +Y + L  D+P   D ++EKDG KV
Sbjct: 7   VTDRAFARLAEIA-EASGETRALRVAVEGGGCSGFQYEIKL--DDPGADDLVLEKDGQKV 63

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            ID  SL ++   EID+  E + S FV HNPN  S+CGCG S  I
Sbjct: 64  LIDQVSLPFLANAEIDYTDELIGSRFVIHNPNASSSCGCGTSFSI 108


>gi|294948968|ref|XP_002785986.1| iron-sulfur cluster assembly protein, putative [Perkinsus marinus
           ATCC 50983]
 gi|239900094|gb|EER17782.1| iron-sulfur cluster assembly protein, putative [Perkinsus marinus
           ATCC 50983]
          Length = 130

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 72/109 (66%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQ-GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++T+T AA  RIK+++     ++  G+R+ L K GC  + Y ++   +     D+++E +
Sbjct: 23  VMTVTPAAASRIKDLMNKKHDESIIGLRVGLAKKGCENMSYTMNYAKEIG-KLDEVVESE 81

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVKV +DS +L+Y++GTE+D+    L S FVF+NPNQ S+CGCG+S  +
Sbjct: 82  GVKVVVDSNALMYLIGTEMDYVDNDLASEFVFNNPNQKSSCGCGKSFSV 130


>gi|20804091|emb|CAD31294.1| HYPOTHETICAL CONSERVED PROTEIN [Mesorhizobium loti R7A]
          Length = 106

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE AV  IK  +  +   A+G RI ++ GGCAGL+Y++ L + +  +GD ++E DG
Sbjct: 1   MITLTENAVAAIKTALSRADEPAEGFRIMVEAGGCAGLKYLLGLESVSR-EGDAIMETDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            KV++D+ S  ++ G  +DF T+   SGFVF NPN    C CG+S
Sbjct: 60  FKVFVDANSQPHLAGMTVDFVTDLESSGFVFDNPNARDKCACGKS 104


>gi|50288207|ref|XP_446532.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49525840|emb|CAG59459.1| unnamed protein product [Candida glabrata]
          Length = 250

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 69/105 (65%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++  A+Y +K ++   + K   IR+  K  GC+GL Y +  +T+ P   D+++E+DG
Sbjct: 146 VITLSPKAIYHLKALLDEPEPKL--IRVGAKNRGCSGLTYDLQYITE-PGKFDEVVEQDG 202

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VK+ IDS +L  ++G+E+D+  +KL S FVF NPN    CGCG+S
Sbjct: 203 VKIVIDSKALFSVVGSEMDWVDDKLASKFVFKNPNSKGTCGCGES 247


>gi|241760165|ref|ZP_04758263.1| iron-sulfur cluster assembly protein IscA [Neisseria flavescens
           SK114]
 gi|319638123|ref|ZP_07992886.1| HesB/YadR/YfhF family protein [Neisseria mucosa C102]
 gi|241319619|gb|EER56049.1| iron-sulfur cluster assembly protein IscA [Neisseria flavescens
           SK114]
 gi|317400396|gb|EFV81054.1| HesB/YadR/YfhF family protein [Neisseria mucosa C102]
          Length = 106

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 69/109 (63%), Gaps = 4/109 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKD 62
           ++T+TE A   I   +   +GK  G+R+ +K  GC+G+ Y ++ V  + V+ DDLI E+ 
Sbjct: 1   MITITENAAKHINSYL-TKRGKGLGVRLGVKTSGCSGMAYNLEFV--DEVNEDDLIFEEH 57

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +V+ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 58  GARVYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|296104214|ref|YP_003614360.1| iron-sulfur cluster assembly protein [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058673|gb|ADF63411.1| iron-sulfur cluster assembly protein [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295097926|emb|CBK87016.1| iron-sulfur cluster assembly protein IscA [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 107

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D P   D + E  GV
Sbjct: 3   ITLSDSAAARVSSFLAN-RGKGFGLRLGVRTSGCSGMAYVLEFV-DEPASDDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL ++ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVVVDGKSLQFLNGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV 107


>gi|167837166|ref|ZP_02464049.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           thailandensis MSMB43]
          Length = 107

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGLGLRLGVRTTGCSGLAYKLEYV-DELAPEDQMFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVFVDPKSLAYIDGTELDFAREGLNEGFRFNNPNVKDECGCGESFRV 107


>gi|114799698|ref|YP_760749.1| iron-sulfur cluster assembly accessory protein [Hyphomonas
           neptunium ATCC 15444]
 gi|114739872|gb|ABI77997.1| iron-sulfur cluster assembly accessory protein [Hyphomonas
           neptunium ATCC 15444]
          Length = 113

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 64/108 (59%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEKDG 63
           VT+T +A  RI  I+    G A  +R+S++ GGC+G  Y  D      V+ DD+ IE+DG
Sbjct: 9   VTLTASAAKRINAILAKQDGAAY-LRVSVEGGGCSGFSYKFDFAP--AVNADDVVIERDG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             V ID  SL ++ G+EIDF TE + + F   NPN  +ACGCG S  +
Sbjct: 66  ASVLIDEMSLEFLQGSEIDFSTELIGAAFKIKNPNATAACGCGTSFSV 113


>gi|74317184|ref|YP_314924.1| Iron-sulfur cluster assembly protein IscA [Thiobacillus
           denitrificans ATCC 25259]
 gi|74056679|gb|AAZ97119.1| Iron-sulphur cluster assembly protein IscA [Thiobacillus
           denitrificans ATCC 25259]
          Length = 107

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E A   +   +   +GK  GIR+ ++  GC+G+ Y ++   + P +GD++    GV
Sbjct: 3   VTLSERAAQHVTNFL-AKRGKGVGIRLGVRTSGCSGMAYKLEFADETP-EGDEVFTSHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V++D  SL Y+ GTE+D+  E L  GF F+NPN   ACGCG+S  +
Sbjct: 61  TVFVDPKSLPYIDGTELDYTREGLNEGFKFNNPNVKDACGCGESFNV 107


>gi|152978542|ref|YP_001344171.1| iron-sulfur cluster assembly protein IscA [Actinobacillus
           succinogenes 130Z]
 gi|150840265|gb|ABR74236.1| iron-sulfur cluster assembly protein IscA [Actinobacillus
           succinogenes 130Z]
          Length = 107

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++E A+ R++  + N +G   G+R+ +K  GC+GL Y+++ V D   D D + ++D V
Sbjct: 3   ITLSETALNRVRTFLQN-RGSGIGLRLGVKTSGCSGLAYVLEFV-DQLSDEDQIFQQDDV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KIIVDKKSLVYLDGTQLDFVKEGLNEGFKFTNPNIKDQCGCGESFSV 107


>gi|117926340|ref|YP_866957.1| iron-sulfur cluster assembly accessory protein [Magnetococcus sp.
           MC-1]
 gi|117610096|gb|ABK45551.1| iron-sulfur cluster assembly accessory protein [Magnetococcus sp.
           MC-1]
          Length = 113

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE A  ++++++         +RI +   GC+G  Y ++   D   +GD + E  GV
Sbjct: 8   VTITEKAAAQVQKMLQGRGTPDAAVRIGVGTSGCSGFSYKLEYA-DQLEEGDMVYEAHGV 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V +DS SLLYM GT++D+ TE   SGF F NP + S CGCG+S ++
Sbjct: 67  RVVVDSKSLLYMAGTQMDYVTENFKSGFTFTNPKETSRCGCGESFKV 113


>gi|301632488|ref|XP_002945317.1| PREDICTED: iron-binding protein iscA-like [Xenopus (Silurana)
           tropicalis]
          Length = 107

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T+AA   +   +   +GK  G+R+ +K  GC+GL Y ++ V +   + D + E  G+
Sbjct: 3   ISLTDAAARHVSRYL-ARRGKGIGVRLGVKTTGCSGLAYKLEYVDEQSPE-DVVFENHGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF FHNPN+   CGCG+S  I
Sbjct: 61  KVLVDPKSLAYIDGTELDFVREGLNEGFKFHNPNERDRCGCGESFRI 107


>gi|109897565|ref|YP_660820.1| iron-sulfur cluster assembly protein IscA [Pseudoalteromonas
           atlantica T6c]
 gi|109699846|gb|ABG39766.1| iron-sulfur cluster assembly protein IscA [Pseudoalteromonas
           atlantica T6c]
          Length = 107

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + ++EAA  R    + N +G   G+R+ +K  GC+GL Y+++ V D   + D + E +GV
Sbjct: 3   IKISEAAAQRASSFLQN-RGSGLGLRLGVKTTGCSGLAYVLEFV-DELNEDDHVFEDNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIIDGKSLVYLDGTELDFAKEGLNEGFQFNNPNANGECGCGESFNV 107


>gi|300724153|ref|YP_003713470.1| putative regulator [Xenorhabdus nematophila ATCC 19061]
 gi|75396868|sp|Q8GLE6|ISCA_XENNA RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|23345069|gb|AAN17747.1| IscA [Xenorhabdus nematophila]
 gi|297630687|emb|CBJ91352.1| putative regulator believed to be involved in Fe-S cluster assembly
           and activation [Xenorhabdus nematophila ATCC 19061]
          Length = 107

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE+A  RI   + N +GK  G+R+ ++  GC+G+ Y+++   D   + D + E  GV
Sbjct: 3   ISLTESAAQRIVAFLDN-RGKGVGLRLGVRTSGCSGMAYVLEF-ADVVNEEDQVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  S+LY+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIVDGKSILYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFHV 107


>gi|154244064|ref|YP_001415022.1| iron-sulfur cluster assembly accessory protein [Xanthobacter
           autotrophicus Py2]
 gi|154158149|gb|ABS65365.1| iron-sulfur cluster assembly accessory protein [Xanthobacter
           autotrophicus Py2]
          Length = 106

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T++A++ +++ +  +     G+RI ++ GGCAG +Y + LV+D   D D ++E++G
Sbjct: 1   MINLTDSALHAVRDAILGADQPVSGLRIMVETGGCAGYQYKMGLVSDAEPD-DTVVEREG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV++D+ S   + GT IDF      SGF F NPN  S+C CG+S
Sbjct: 60  VKVFVDNQSHELLAGTVIDFVVALEGSGFTFENPNATSSCSCGKS 104


>gi|189218502|ref|YP_001939143.1| Fe-S cluster assembly scaffold protein [Methylacidiphilum
           infernorum V4]
 gi|189185360|gb|ACD82545.1| Fe-S cluster assembly scaffold protein [Methylacidiphilum
           infernorum V4]
          Length = 122

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 67/108 (62%), Gaps = 1/108 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +  ++E A  ++KE++  S  K   ++IS+  GGCAGL+Y +DLV D P + D LIE  G
Sbjct: 16  LCAISEKAAEKLKELLSQSSRKEGALKISVVGGGCAGLQYEMDLV-DGPEEKDILIESRG 74

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VK+ ID  S L++ G+ +D+  E    GFV  NPN +S C CG+S  +
Sbjct: 75  VKLVIDPKSALFISGSILDYSEELQNEGFVVKNPNALSHCSCGKSFAV 122


>gi|121609332|ref|YP_997139.1| iron-sulfur cluster assembly protein IscA [Verminephrobacter
           eiseniae EF01-2]
 gi|121553972|gb|ABM58121.1| iron-sulfur cluster assembly protein IscA [Verminephrobacter
           eiseniae EF01-2]
          Length = 107

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA   +   +   +GK  G+R+ ++  GC+GL Y ++ V D+    D + E  GV
Sbjct: 3   ITLTQAAARHVSRYL-ARRGKGLGVRLGVRTTGCSGLAYKLEYV-DDAAPEDIVFEHHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+DF  E L  GF F+NPN+   CGCG+S  +
Sbjct: 61  KVLIDPKSLAYIDGTELDFVREGLNEGFKFNNPNERDRCGCGESFRV 107


>gi|91784246|ref|YP_559452.1| Iron-sulphur cluster assembly protein IscA [Burkholderia xenovorans
           LB400]
 gi|91688200|gb|ABE31400.1| Iron-sulphur cluster assembly protein IscA [Burkholderia xenovorans
           LB400]
          Length = 111

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ + N +GK  G+R+ ++  GC+GL Y ++ V D     D++ E +GV
Sbjct: 7   ITLTEKAAQHVQKYL-NRRGKGVGLRVGVRTTGCSGLAYKLEYV-DELAPEDEVFECNGV 64

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 65  KIIVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 111


>gi|238765522|ref|ZP_04626438.1| Iron-binding protein iscA [Yersinia kristensenii ATCC 33638]
 gi|238696261|gb|EEP89062.1| Iron-binding protein iscA [Yersinia kristensenii ATCC 33638]
          Length = 107

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D   D D + E  GV
Sbjct: 3   ISISDSAAQRVSAFL-NHRGKGLGLRLGVRTSGCSGMAYVLEFV-DEMNDDDIVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  S++Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  KVIIDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGESFNV 107


>gi|53723801|ref|YP_103326.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           ATCC 23344]
 gi|76810479|ref|YP_334117.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1710b]
 gi|83719700|ref|YP_442407.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           thailandensis E264]
 gi|121600391|ref|YP_993527.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei
           SAVP1]
 gi|124384395|ref|YP_001029046.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei NCTC
           10229]
 gi|126441573|ref|YP_001059623.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 668]
 gi|126448283|ref|YP_001081034.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei NCTC
           10247]
 gi|126452485|ref|YP_001066906.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1106a]
 gi|134277980|ref|ZP_01764695.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 305]
 gi|167000651|ref|ZP_02266462.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei
           PRL-20]
 gi|167581328|ref|ZP_02374202.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           thailandensis TXDOH]
 gi|167720351|ref|ZP_02403587.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei DM98]
 gi|167824953|ref|ZP_02456424.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 9]
 gi|167846471|ref|ZP_02471979.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei B7210]
 gi|167895049|ref|ZP_02482451.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 7894]
 gi|167903436|ref|ZP_02490641.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei NCTC 13177]
 gi|167911684|ref|ZP_02498775.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 112]
 gi|167919684|ref|ZP_02506775.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei BCC215]
 gi|217420992|ref|ZP_03452497.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 576]
 gi|226195463|ref|ZP_03791051.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei Pakistan 9]
 gi|237813017|ref|YP_002897468.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei MSHR346]
 gi|238561627|ref|ZP_00441748.2| iron-sulfur cluster assembly protein IscA [Burkholderia mallei GB8
           horse 4]
 gi|242317210|ref|ZP_04816226.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1106b]
 gi|254177525|ref|ZP_04884180.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei ATCC
           10399]
 gi|254184368|ref|ZP_04890958.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1655]
 gi|254191402|ref|ZP_04897906.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254195801|ref|ZP_04902227.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei S13]
 gi|254200284|ref|ZP_04906650.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei FMH]
 gi|254209360|ref|ZP_04915706.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei JHU]
 gi|254259198|ref|ZP_04950252.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1710a]
 gi|254297032|ref|ZP_04964485.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 406e]
 gi|254357969|ref|ZP_04974242.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei
           2002721280]
 gi|257138609|ref|ZP_05586871.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           thailandensis E264]
 gi|52427224|gb|AAU47817.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           ATCC 23344]
 gi|76579932|gb|ABA49407.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1710b]
 gi|83653525|gb|ABC37588.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           thailandensis E264]
 gi|121229201|gb|ABM51719.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei
           SAVP1]
 gi|124292415|gb|ABN01684.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei NCTC
           10229]
 gi|126221066|gb|ABN84572.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 668]
 gi|126226127|gb|ABN89667.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1106a]
 gi|126241153|gb|ABO04246.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei NCTC
           10247]
 gi|134251630|gb|EBA51709.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 305]
 gi|147749880|gb|EDK56954.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei FMH]
 gi|147750133|gb|EDK57204.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei JHU]
 gi|148027096|gb|EDK85117.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei
           2002721280]
 gi|157806842|gb|EDO84012.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 406e]
 gi|157939074|gb|EDO94744.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160698564|gb|EDP88534.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei ATCC
           10399]
 gi|169652546|gb|EDS85239.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei S13]
 gi|184214899|gb|EDU11942.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1655]
 gi|217396404|gb|EEC36421.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 576]
 gi|225932423|gb|EEH28422.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei Pakistan 9]
 gi|237506489|gb|ACQ98807.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei MSHR346]
 gi|238524235|gb|EEP87669.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei GB8
           horse 4]
 gi|242140449|gb|EES26851.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1106b]
 gi|243063459|gb|EES45645.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei
           PRL-20]
 gi|254217887|gb|EET07271.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1710a]
          Length = 107

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGLGLRLGVRTTGCSGLAYKLEYV-DELTPEDQMFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVFVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|146312666|ref|YP_001177740.1| iron-sulfur cluster assembly protein [Enterobacter sp. 638]
 gi|166973717|sp|A4WDA9|ISCA_ENT38 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|145319542|gb|ABP61689.1| iron-sulfur cluster assembly protein IscA [Enterobacter sp. 638]
          Length = 107

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D P   D + E  GV
Sbjct: 3   ITLSDSAAARVSSFLEN-RGKGYGLRLGVRTSGCSGMAYVLEFV-DEPATDDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL ++ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVVIDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV 107


>gi|302698621|ref|XP_003038989.1| hypothetical protein SCHCODRAFT_34794 [Schizophyllum commune H4-8]
 gi|300112686|gb|EFJ04087.1| hypothetical protein SCHCODRAFT_34794 [Schizophyllum commune H4-8]
          Length = 119

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 67/108 (62%), Gaps = 3/108 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I   +  AV R++ +  +     Q IRI ++  GCAG+ Y ++ V D P   D+++E+DG
Sbjct: 15  IPRQSPTAVERLRTL--SKSPTPQLIRIGVRNKGCAGMSYHLEYV-DKPGRFDEVVEQDG 71

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V+V IDS +L  ++G+E+D+K + L S F F NPN V ACGCG S  +
Sbjct: 72  VRVLIDSKALFSIIGSEMDWKEDALSSKFTFKNPNVVDACGCGDSFSV 119


>gi|213408130|ref|XP_002174836.1| iron sulfur assembly protein [Schizosaccharomyces japonicus yFS275]
 gi|212002883|gb|EEB08543.1| iron sulfur assembly protein [Schizosaccharomyces japonicus yFS275]
          Length = 194

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 71/106 (66%), Gaps = 4/106 (3%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +++++T  AV ++KE++  SQ K   +RI +K+ GCAG  Y  + V D P   D+++E+D
Sbjct: 87  NVISITPVAVDKLKELLL-SQDKL--LRIGVKQKGCAGQSYSFEYV-DQPDKFDEIVEQD 142

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           GV+V +   +LL ++G+ +DFK + L S FVF NPN  S CGCG+S
Sbjct: 143 GVRVIVQRRALLQIIGSSMDFKDDDLQSRFVFSNPNVKSTCGCGES 188


>gi|294654557|ref|XP_456615.2| DEHA2A06710p [Debaryomyces hansenii CBS767]
 gi|199428975|emb|CAG84571.2| DEHA2A06710p [Debaryomyces hansenii]
          Length = 275

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 70/105 (66%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T +  AV  +K ++   Q + Q IRI ++  GC+GL Y ++ V++ P   D+ +E+DG
Sbjct: 171 LITFSANAVDHLKNLL--DQPEPQLIRIGVQNRGCSGLTYNLEYVSE-PGKFDEKVEQDG 227

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV+IDS +L  ++G+E+D+  +KL S F+F NPN    CGCG+S
Sbjct: 228 VKVYIDSKALFSIVGSEMDWLDDKLSSRFIFRNPNSKGTCGCGES 272


>gi|296158333|ref|ZP_06841164.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp. Ch1-1]
 gi|295891277|gb|EFG71064.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp. Ch1-1]
          Length = 107

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ + N +GK  G+R+ ++  GC+GL Y ++ V D     D++ E +GV
Sbjct: 3   ITLTEKAAQHVQKYL-NRRGKGVGLRVGVRTTGCSGLAYKLEYV-DELAPEDEVFECNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|56479097|ref|YP_160686.1| IscA protein involved in Fe-S cluster synthesis [Aromatoleum
           aromaticum EbN1]
 gi|56315140|emb|CAI09785.1| IscA protein involved in Fe-S cluster synthesis [Aromatoleum
           aromaticum EbN1]
          Length = 107

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++  A   + E +   +GK  GIR+ +K  GC+G+ Y ++ V D+  D D + E  GV
Sbjct: 3   VTLSTNAAKHVSEFM-AKRGKGVGIRLGVKTSGCSGMAYRLEFV-DDMHDEDLIFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN   ACGCG+S  +
Sbjct: 61  KVIVDPQSLAYLDGTELDFVREGLNEGFKFNNPNVKDACGCGESFNV 107


>gi|13474947|ref|NP_106517.1| hypothetical protein mll5942 [Mesorhizobium loti MAFF303099]
 gi|14025703|dbj|BAB52303.1| mll5942 [Mesorhizobium loti MAFF303099]
          Length = 106

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE AV  +K  +  +   A+G RI ++ GGCAGL+Y++ L + +  +GD ++E DG
Sbjct: 1   MITLTENAVAAVKAALSRADEPAEGFRIMVEAGGCAGLKYLMGLESVSR-EGDAIMETDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            KV++D+ S  ++ G  +DF T+   SGFVF NPN    C CG+S
Sbjct: 60  FKVFVDANSQPHLAGMTVDFVTDLESSGFVFDNPNARDKCACGKS 104


>gi|329119441|ref|ZP_08248126.1| iron-sulfur cluster assembly protein IscA [Neisseria bacilliformis
           ATCC BAA-1200]
 gi|327464374|gb|EGF10674.1| iron-sulfur cluster assembly protein IscA [Neisseria bacilliformis
           ATCC BAA-1200]
          Length = 106

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 66/108 (61%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A   I   +   +GK  G+R+ +K  GC+G+ Y ++ V D P   D + E+ G
Sbjct: 1   MITITENAAKYINSYL-TKRGKGLGVRLGVKTSGCSGMAYNLEFV-DEPNAEDLVFEEHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            KV+ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 59  AKVFIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|237747465|ref|ZP_04577945.1| iron-binding protein iscA [Oxalobacter formigenes HOxBLS]
 gi|229378816|gb|EEO28907.1| iron-binding protein iscA [Oxalobacter formigenes HOxBLS]
          Length = 107

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 67/108 (62%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDG 63
           +T+TE A   I   +   +GK  G+R  ++  GC+G+ Y ++ V D P D DD++ E +G
Sbjct: 3   ITLTEKAANHISRFL-ERRGKGIGLRFGVQTTGCSGMSYKLEYV-DEP-DADDIVYESNG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VK+++D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG S ++
Sbjct: 60  VKIFVDPKSLPYLDGTELDFAREGLNEGFKFNNPNVKDTCGCGNSFKV 107


>gi|158425033|ref|YP_001526325.1| iron-sulfur cluster assembly accessory protein [Azorhizobium
           caulinodans ORS 571]
 gi|158331922|dbj|BAF89407.1| iron-sulfur cluster assembly accessory protein [Azorhizobium
           caulinodans ORS 571]
          Length = 106

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T++A+  ++  + ++ G   G+RI ++ GGCAG +Y + LV D   D D +IE++G
Sbjct: 1   MINLTDSALNAVRTAIGSAGGPVGGLRIQVEAGGCAGYKYQMGLVVDAEPD-DTVIEREG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV++D+ S  Y+ GT IDF      SGF F NPN  ++C CG+S
Sbjct: 60  VKVFVDNKSHEYLAGTTIDFVVALEGSGFTFDNPNANNSCSCGKS 104


>gi|297539153|ref|YP_003674922.1| iron-sulfur cluster assembly protein IscA [Methylotenera sp. 301]
 gi|297258500|gb|ADI30345.1| iron-sulfur cluster assembly protein IscA [Methylotenera sp. 301]
          Length = 107

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE A  R+++ + N +GK  G+R+ +K  GC+G+ Y ++ V D     D   E  GV
Sbjct: 3   ISLTETAANRVEKFLAN-RGKGIGLRLGVKTTGCSGMAYTLEFV-DEMHPEDTAFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDPKSLVYIDGTELDFTKEGLNEGFKFNNPNVKDECGCGESFTV 107


>gi|22125235|ref|NP_668658.1| iron-sulfur cluster assembly protein [Yersinia pestis KIM 10]
 gi|45442340|ref|NP_993879.1| iron-sulfur cluster assembly protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51597173|ref|YP_071364.1| iron-sulfur cluster assembly protein [Yersinia pseudotuberculosis
           IP 32953]
 gi|108808329|ref|YP_652245.1| iron-sulfur cluster assembly protein [Yersinia pestis Antiqua]
 gi|108811406|ref|YP_647173.1| iron-sulfur cluster assembly protein [Yersinia pestis Nepal516]
 gi|145599511|ref|YP_001163587.1| iron-sulfur cluster assembly protein [Yersinia pestis Pestoides F]
 gi|149365353|ref|ZP_01887388.1| FeS cluster assembly protein [Yersinia pestis CA88-4125]
 gi|153949035|ref|YP_001400151.1| iron-sulfur cluster assembly protein [Yersinia pseudotuberculosis
           IP 31758]
 gi|162421389|ref|YP_001605038.1| iron-sulfur cluster assembly protein [Yersinia pestis Angola]
 gi|165928246|ref|ZP_02224078.1| iron-sulfur cluster assembly protein IscA [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165937056|ref|ZP_02225621.1| iron-sulfur cluster assembly protein IscA [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166008058|ref|ZP_02228956.1| iron-sulfur cluster assembly protein IscA [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166212394|ref|ZP_02238429.1| iron-sulfur cluster assembly protein IscA [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167421449|ref|ZP_02313202.1| iron-sulfur cluster assembly protein IscA [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167423256|ref|ZP_02315009.1| iron-sulfur cluster assembly protein IscA [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167468078|ref|ZP_02332782.1| iron-sulfur cluster assembly protein IscA [Yersinia pestis FV-1]
 gi|170023524|ref|YP_001720029.1| iron-sulfur cluster assembly protein [Yersinia pseudotuberculosis
           YPIII]
 gi|186896267|ref|YP_001873379.1| iron-sulfur cluster assembly protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|218929953|ref|YP_002347828.1| iron-sulfur cluster assembly protein [Yersinia pestis CO92]
 gi|229838478|ref|ZP_04458637.1| FeS cluster assembly protein [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229895483|ref|ZP_04510654.1| FeS cluster assembly protein [Yersinia pestis Pestoides A]
 gi|229899047|ref|ZP_04514191.1| FeS cluster assembly protein [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229901660|ref|ZP_04516782.1| FeS cluster assembly protein [Yersinia pestis Nepal516]
 gi|270489852|ref|ZP_06206926.1| iron-sulfur cluster assembly protein IscA [Yersinia pestis KIM D27]
 gi|81593923|sp|Q8ZCS3|ISCA_YERPE RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|81638852|sp|Q667Y3|ISCA_YERPS RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|122383054|sp|Q1C5H2|ISCA_YERPA RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|122384967|sp|Q1CKA7|ISCA_YERPN RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|166215530|sp|A4TMV2|ISCA_YERPP RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|166973719|sp|A7FFX3|ISCA_YERP3 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711606|sp|B2K9R5|ISCA_YERPB RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711607|sp|A9R816|ISCA_YERPG RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711608|sp|B1JRZ0|ISCA_YERPY RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|21958104|gb|AAM84909.1|AE013736_5 putative regulator [Yersinia pestis KIM 10]
 gi|45437204|gb|AAS62756.1| conserved hypothetical protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51590455|emb|CAH22095.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108775054|gb|ABG17573.1| hypothetical protein YPN_1243 [Yersinia pestis Nepal516]
 gi|108780242|gb|ABG14300.1| hypothetical protein YPA_2335 [Yersinia pestis Antiqua]
 gi|115348564|emb|CAL21505.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145211207|gb|ABP40614.1| hypothetical protein YPDSF_2239 [Yersinia pestis Pestoides F]
 gi|149291766|gb|EDM41840.1| FeS cluster assembly protein [Yersinia pestis CA88-4125]
 gi|152960530|gb|ABS47991.1| iron-sulfur cluster assembly protein IscA [Yersinia
           pseudotuberculosis IP 31758]
 gi|162354204|gb|ABX88152.1| iron-sulfur cluster assembly protein IscA [Yersinia pestis Angola]
 gi|165914919|gb|EDR33531.1| iron-sulfur cluster assembly protein IscA [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165919753|gb|EDR37086.1| iron-sulfur cluster assembly protein IscA [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165992440|gb|EDR44741.1| iron-sulfur cluster assembly protein IscA [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166206325|gb|EDR50805.1| iron-sulfur cluster assembly protein IscA [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166960938|gb|EDR56959.1| iron-sulfur cluster assembly protein IscA [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167057426|gb|EDR67172.1| iron-sulfur cluster assembly protein IscA [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169750058|gb|ACA67576.1| iron-sulfur cluster assembly protein IscA [Yersinia
           pseudotuberculosis YPIII]
 gi|186699293|gb|ACC89922.1| iron-sulfur cluster assembly protein IscA [Yersinia
           pseudotuberculosis PB1/+]
 gi|229681589|gb|EEO77683.1| FeS cluster assembly protein [Yersinia pestis Nepal516]
 gi|229687992|gb|EEO80064.1| FeS cluster assembly protein [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229694844|gb|EEO84891.1| FeS cluster assembly protein [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229701289|gb|EEO89317.1| FeS cluster assembly protein [Yersinia pestis Pestoides A]
 gi|262362460|gb|ACY59181.1| iron-sulfur cluster assembly protein [Yersinia pestis D106004]
 gi|270338356|gb|EFA49133.1| iron-sulfur cluster assembly protein IscA [Yersinia pestis KIM D27]
 gi|320016037|gb|ADV99608.1| FeS cluster assembly protein [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 107

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D   D D + E  GV
Sbjct: 3   ISISDSAAQRVSAFL-NHRGKGLGLRLGVRTSGCSGMAYVLEFV-DEINDDDIVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  S++Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  KVIIDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGESFNV 107


>gi|319898839|ref|YP_004158932.1| hypothetical protein BARCL_0673 [Bartonella clarridgeiae 73]
 gi|319402803|emb|CBI76354.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 107

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +++ A  +I +I+    GK   +RIS++ GGC+G  Y  DLV++N  D D +I+KDG 
Sbjct: 3   VNISDFAAKQIAKILAGQPGKI-ALRISVEGGGCSGFSYKYDLVSENKED-DFIIKKDGA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V+IDS SL +M G EIDF  + +   F  HNPN  S+CGCG S  I
Sbjct: 61  VVFIDSISLPFMEGAEIDFVDDLMGQSFQIHNPNARSSCGCGVSFSI 107


>gi|163857087|ref|YP_001631385.1| hypothetical protein Bpet2775 [Bordetella petrii DSM 12804]
 gi|163260815|emb|CAP43117.1| conserved hypothetical protein [Bordetella petrii]
          Length = 107

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+ A   I   +   +GK  G+R+ ++  GC+G+ Y ++ V D+P   D + E  GV
Sbjct: 3   VTLTQQAASHIGRYL-QKRGKGVGLRLGVRTTGCSGMAYKLEYV-DDPAPEDMVFESFGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  S  Y+ GTE+D+  E L  GF F NPN+ + CGCG+S  +
Sbjct: 61  KVFVDPKSFAYLDGTELDYAREGLNEGFKFRNPNEKATCGCGESFTV 107


>gi|269468723|gb|EEZ80345.1| hypothetical protein Sup05_1107 [uncultured SUP05 cluster
           bacterium]
          Length = 107

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+ A  R+   + +S+G   GIR+S++  GC+GL Y ++ V D   + D + E  GV
Sbjct: 3   ITLTKEASKRMAGFL-SSRGSGVGIRLSVQTTGCSGLGYNIEFV-DAVNEDDTVFEDSGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D+ SL+Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  KVIVDAKSLIYIDGTEVDFVKEGLNEGFEFNNPNAKAECGCGESFTV 107


>gi|295696477|ref|YP_003589715.1| iron-sulfur cluster assembly accessory protein [Bacillus tusciae
           DSM 2912]
 gi|295412079|gb|ADG06571.1| iron-sulfur cluster assembly accessory protein [Bacillus tusciae
           DSM 2912]
          Length = 118

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 65/105 (61%), Gaps = 2/105 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+ A  +++E++ +   +   +R+ +K GGC+G  Y + L  D P + D+++E +G
Sbjct: 1   MITLTQEAAGKLRELIADKGSEDLAVRVFIKAGGCSGFSYGMAL--DEPKNEDNVVESEG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           V+V ID  S  Y+ G EID+      +GF  HNPN VS CGCG S
Sbjct: 59  VRVVIDPMSAPYLTGAEIDYVDTLTGAGFKIHNPNAVSTCGCGHS 103


>gi|325579027|ref|ZP_08148983.1| iron-sulfur cluster assembly protein IscA [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325159262|gb|EGC71396.1| iron-sulfur cluster assembly protein IscA [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 122

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 72/108 (66%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDG 63
           +T+TE A  R++  + N +GK  G+R+ +K  GC+GL Y+++ V  + ++ DDL+ E+ G
Sbjct: 18  ITLTEKAAQRVRTFLEN-RGKGIGLRLGVKTSGCSGLGYVLEFV--DVLNDDDLVFEQHG 74

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV +D  SL+Y+ G E+D+  E L  GF ++NPN   +CGCG+S  +
Sbjct: 75  VKVVVDPKSLVYLDGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV 122


>gi|298244865|ref|ZP_06968671.1| iron-sulfur cluster assembly accessory protein [Ktedonobacter
           racemifer DSM 44963]
 gi|297552346|gb|EFH86211.1| iron-sulfur cluster assembly accessory protein [Ktedonobacter
           racemifer DSM 44963]
          Length = 133

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 68/112 (60%), Gaps = 4/112 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMT  A  ++ E++        G+RI +  GGC+GL+Y + L  D   +GD +I   G
Sbjct: 14  VITMTPTAAVKVNELLQQENDPGLGLRIFVAGGGCSGLQYGMTL--DEEQEGDTVINMSG 71

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           +KV++D  S+ Y+ G+E+D+    + +GF  +NPN VS+CGCG S   K AD
Sbjct: 72  IKVFVDEMSISYINGSEVDYVDSLMGAGFTVNNPNAVSSCGCGHS--FKTAD 121


>gi|221115690|ref|XP_002155514.1| PREDICTED: similar to GK25017 [Hydra magnipapillata]
          Length = 130

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV R+KE++   +  + G+RI +++ GC GL Y ++  T+     D+++++D V
Sbjct: 26  ITLTSSAVQRVKELL-KEKPSSVGLRIGVRERGCNGLSYTLEYATEKN-KFDEVVKQDDV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ IDS +L+ ++GTE+D+    L S FVF+NPN    CGCG+S  I
Sbjct: 84  QIMIDSKALMSLIGTEMDYSQNLLASEFVFNNPNIKGTCGCGESFHI 130


>gi|37527161|ref|NP_930505.1| iron-sulfur cluster assembly protein [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|81418810|sp|Q7N226|ISCA_PHOLL RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|36786595|emb|CAE15655.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 107

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE+A  R+   + + +GK  G+R+ ++  GC+G+ Y+++   D   + D + E  GV
Sbjct: 3   ISLTESAAQRVSSFL-SHRGKGVGLRLGVRTSGCSGMAYLLEF-ADMINEDDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  S++Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIVDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFNV 107


>gi|328543966|ref|YP_004304075.1| HesB-like domain [polymorphum gilvum SL003B-26A1]
 gi|326413709|gb|ADZ70772.1| HesB-like domain, putative [Polymorphum gilvum SL003B-26A1]
          Length = 113

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 67/108 (62%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEKDG 63
           VT+++ A  RI  I+      +  +R+S++ GGC+GL+Y  D+V  N  + DDL IE+DG
Sbjct: 9   VTVSDRAARRIARILAGEPAGSM-LRVSVEGGGCSGLQYKYDVV--NERESDDLAIERDG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V V +D+ SL YM G+EIDF  + +   F   NPN V+ CGCG S  I
Sbjct: 66  VTVLVDAVSLQYMTGSEIDFVDDLIGQSFQIRNPNAVAGCGCGTSFTI 113


>gi|53719897|ref|YP_108883.1| HesB family protein [Burkholderia pseudomallei K96243]
 gi|167739343|ref|ZP_02412117.1| HesB family protein [Burkholderia pseudomallei 14]
 gi|167816558|ref|ZP_02448238.1| HesB family protein [Burkholderia pseudomallei 91]
 gi|52210311|emb|CAH36290.1| HesB family protein [Burkholderia pseudomallei K96243]
          Length = 107

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYL-ARRGKGLGLRLGVRTTGCSGLAYKLEYV-DELTPEDQMFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVFVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|206577407|ref|YP_002237119.1| iron-sulfur cluster assembly protein IscA [Klebsiella pneumoniae
           342]
 gi|226711596|sp|B5XNJ9|ISCA_KLEP3 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|206566465|gb|ACI08241.1| iron-sulfur cluster assembly protein IscA [Klebsiella pneumoniae
           342]
          Length = 107

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D P   D + E  GV
Sbjct: 3   ITLSDSAAARVNSFLAN-RGKGFGLRLGVRTSGCSGMAYVLEFV-DEPAAEDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL ++ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVVIDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFNV 107


>gi|319762897|ref|YP_004126834.1| iron-sulfur cluster assembly protein isca [Alicycliphilus
           denitrificans BC]
 gi|330824976|ref|YP_004388279.1| iron-sulfur cluster assembly protein IscA [Alicycliphilus
           denitrificans K601]
 gi|317117458|gb|ADU99946.1| iron-sulfur cluster assembly protein IscA [Alicycliphilus
           denitrificans BC]
 gi|329310348|gb|AEB84763.1| iron-sulfur cluster assembly protein IscA [Alicycliphilus
           denitrificans K601]
          Length = 107

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA   +   +   +GK  G+R+ +K  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEAAARHVTRYL-ARRGKGLGVRLGVKTTGCSGLAYKLEYV-DEQAPEDIVFENHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+DF  E L  GF F NPN+   CGCG+S  +
Sbjct: 61  KVLIDPKSLAYIDGTELDFVREGLNEGFRFINPNERDRCGCGESFRV 107


>gi|146277243|ref|YP_001167402.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145555484|gb|ABP70097.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 108

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 66/105 (62%), Gaps = 3/105 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T+ A  R+ EI   + G+ + +R++++ GGC+G +Y + L  D+P   D +IEKDG KV
Sbjct: 7   VTDRAFARLAEIA-EASGETRALRVAVEGGGCSGFQYEIKL--DDPGSDDLVIEKDGQKV 63

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            ID  SL ++   EID+  E + S FV +NPN  S+CGCG S  I
Sbjct: 64  LIDQVSLPFLANAEIDYADELIGSRFVINNPNATSSCGCGTSFSI 108


>gi|238750356|ref|ZP_04611857.1| Iron-binding protein iscA [Yersinia rohdei ATCC 43380]
 gi|238711287|gb|EEQ03504.1| Iron-binding protein iscA [Yersinia rohdei ATCC 43380]
          Length = 107

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D   D D + E  GV
Sbjct: 3   ISISDSAAQRVSAFL-NHRGKGLGLRLGVRTSGCSGMAYVLEFV-DEMNDDDIVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  S++Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSGECGCGESFNV 107


>gi|152981602|ref|YP_001352944.1| [Fe-S] cluster formation/repair protein [Janthinobacterium sp.
           Marseille]
 gi|151281679|gb|ABR90089.1| [Fe-S] cluster formation/repair protein [Janthinobacterium sp.
           Marseille]
          Length = 107

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   I   +   +GK  G+R  ++  GC+GL Y ++ V D   + D + E  G+
Sbjct: 3   ITLTEKAAKHITRYM-ERRGKGIGLRFGVRTTGCSGLAYKLEYV-DESANEDSVFESHGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+DF  E L  GF F NPN    CGCG+S  I
Sbjct: 61  KVFVDPKSLPYIDGTELDFAREGLNEGFKFRNPNVKDECGCGESFRI 107


>gi|187924554|ref|YP_001896196.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           phytofirmans PsJN]
 gi|187715748|gb|ACD16972.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           phytofirmans PsJN]
          Length = 107

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ + N +GK  G+R+ ++  GC+GL Y ++ V D     D++ E +GV
Sbjct: 3   ITLTEKAAQHVQKYL-NRRGKGVGLRVGVRTTGCSGLAYKLEYV-DELAPEDEVFECNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KLIVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|152971391|ref|YP_001336500.1| iron-sulfur cluster assembly protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238895985|ref|YP_002920721.1| iron-sulfur cluster assembly protein [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262040267|ref|ZP_06013518.1| iron-binding protein IscA [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288934080|ref|YP_003438139.1| iron-sulfur cluster assembly protein IscA [Klebsiella variicola
           At-22]
 gi|290508276|ref|ZP_06547647.1| iron-sulfur cluster assembly protein IscA [Klebsiella sp. 1_1_55]
 gi|330007734|ref|ZP_08306060.1| iron-sulfur cluster assembly protein IscA [Klebsiella sp. MS 92-3]
 gi|166215528|sp|A6TCE9|ISCA_KLEP7 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|150956240|gb|ABR78270.1| iron-sulfur cluster assembly protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238548303|dbj|BAH64654.1| iron-sulfur cluster assembly protein [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259042376|gb|EEW43396.1| iron-binding protein IscA [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288888809|gb|ADC57127.1| iron-sulfur cluster assembly protein IscA [Klebsiella variicola
           At-22]
 gi|289777670|gb|EFD85667.1| iron-sulfur cluster assembly protein IscA [Klebsiella sp. 1_1_55]
 gi|328535347|gb|EGF61830.1| iron-sulfur cluster assembly protein IscA [Klebsiella sp. MS 92-3]
          Length = 107

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D P   D + E  GV
Sbjct: 3   ITLSDSAAARVNAFLAN-RGKGFGLRLGVRTSGCSGMAYVLEFV-DEPAAEDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL ++ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVVIDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFNV 107


>gi|115391347|ref|XP_001213178.1| iron sulfur assembly protein 1 [Aspergillus terreus NIH2624]
 gi|114194102|gb|EAU35802.1| iron sulfur assembly protein 1 [Aspergillus terreus NIH2624]
          Length = 244

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 70/102 (68%), Gaps = 3/102 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  AV ++++++  SQ + + IR+ +K  GC+GL Y ++ V + P   D+++E+DGVKV
Sbjct: 143 LTPVAVEQLRKLL--SQPEPKMIRVGVKNRGCSGLAYHLEYV-EKPGMFDEVVEQDGVKV 199

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            IDS +L  ++G+E+D++ +KL   FVF NPN    CGCG+S
Sbjct: 200 LIDSKALFSIIGSEMDWQEDKLSRRFVFRNPNIKEQCGCGES 241


>gi|301155746|emb|CBW15214.1| FeS cluster assembly protein [Haemophilus parainfluenzae T3T1]
          Length = 107

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 72/108 (66%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDG 63
           +T+TE A  R++  + N +GK  G+R+ +K  GC+GL Y+++ V  + ++ DDL+ E+ G
Sbjct: 3   ITLTEKAAERVRTFLEN-RGKGIGLRLGVKTSGCSGLGYVLEFV--DVLNDDDLVFEQHG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV +D  SL+Y+ G E+D+  E L  GF ++NPN   +CGCG+S  +
Sbjct: 60  VKVIVDPKSLVYLDGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV 107


>gi|293608206|ref|ZP_06690509.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828779|gb|EFF87141.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325122063|gb|ADY81586.1| hypothetical protein BDGL_001000 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 106

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 69/108 (63%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V D+  + D + E+ G
Sbjct: 1   MIHLTENAATHISNYLKN-RGKGEGIRVGVKTSGCSGLAYVLEFV-DSVDEHDQVFEQFG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLEGLEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|237732508|ref|ZP_04562989.1| iron-sulfur cluster assembly protein [Citrobacter sp. 30_2]
 gi|226908047|gb|EEH93965.1| iron-sulfur cluster assembly protein [Citrobacter sp. 30_2]
          Length = 107

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D P   D + E  GV
Sbjct: 3   ITLSDSAAARVNTFLAN-RGKGFGLRLGVRTSGCSGMAYVLEFV-DEPAAEDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL ++ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVVIDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV 107


>gi|332971656|gb|EGK10605.1| iron-sulfur cluster assembly protein IscA [Psychrobacter sp.
           1501(2011)]
          Length = 106

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 67/108 (62%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   + + + N++G  +GIR+ ++  GC+GL Y+++ V D P   D+  E  G
Sbjct: 1   MIELTERAAKHVTDYL-NNRGHGEGIRVGIRTAGCSGLAYVLEFV-DEPDSVDEKFESHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V +++D  S++Y+ G  +D+ TE L  GF F NPNQ   CGCG+S  +
Sbjct: 59  VNIFVDPKSMVYLDGLLMDYVTEGLNEGFKFTNPNQKGECGCGESFTV 106


>gi|332283996|ref|YP_004415907.1| hypothetical protein PT7_0743 [Pusillimonas sp. T7-7]
 gi|330427949|gb|AEC19283.1| hypothetical protein PT7_0743 [Pusillimonas sp. T7-7]
          Length = 107

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+ A   I   +   +GK  G+R+++K  GC+GL Y ++ V D P   D L E+ GV
Sbjct: 3   ITLTQQAADHINRYI-EKRGKGLGLRLAVKTTGCSGLAYKLEYV-DEPNPEDLLCEQLGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+ID  SL ++ GT++D+  E L  GF F NPN+ ++CGCG+S  +
Sbjct: 61  RVYIDQKSLPFVDGTQLDYAREGLNEGFKFSNPNEKASCGCGESFTV 107


>gi|303257499|ref|ZP_07343511.1| iron-sulfur cluster assembly protein IscA [Burkholderiales
           bacterium 1_1_47]
 gi|331000237|ref|ZP_08323921.1| iron-sulfur cluster assembly protein IscA [Parasutterella
           excrementihominis YIT 11859]
 gi|302859469|gb|EFL82548.1| iron-sulfur cluster assembly protein IscA [Burkholderiales
           bacterium 1_1_47]
 gi|329572403|gb|EGG54056.1| iron-sulfur cluster assembly protein IscA [Parasutterella
           excrementihominis YIT 11859]
          Length = 107

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE A   ++E +   +GK  G+R+ +K  GC+G+ Y ++   D     D + E  G+
Sbjct: 3   VTLTEKAASHVEEFL-RKRGKGVGLRVGVKTSGCSGMAYALEFA-DKIEPEDQVYESYGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L +GF F NPN+  +CGCG+S  +
Sbjct: 61  KVIVDPKSLPYINGTELDFVREGLNTGFKFKNPNEKESCGCGKSFHV 107


>gi|84500941|ref|ZP_00999176.1| Iron-sulfur cluster assembly family protein [Oceanicola batsensis
           HTCC2597]
 gi|84391008|gb|EAQ03426.1| Iron-sulfur cluster assembly family protein [Oceanicola batsensis
           HTCC2597]
          Length = 107

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 67/105 (63%), Gaps = 4/105 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T+ A  R+ EI   +QG+A  +R++++ GGC+G +Y  D+  D+P DGD ++E +G +V
Sbjct: 7   VTDRAFERLSEIGAGAQGQA--LRVAVEGGGCSGFQY--DIKLDDPSDGDLVLEGNGERV 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  SL ++ G  IDF  E + + FV  NPN  S+CGCG S  I
Sbjct: 63  VVDDVSLPFLAGATIDFADELIGARFVIENPNATSSCGCGTSFSI 107


>gi|169624826|ref|XP_001805818.1| hypothetical protein SNOG_15677 [Phaeosphaeria nodorum SN15]
 gi|111055932|gb|EAT77052.1| hypothetical protein SNOG_15677 [Phaeosphaeria nodorum SN15]
          Length = 246

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 71/108 (65%), Gaps = 3/108 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ ++ +AV  ++E++  +Q + + IRI  +  GC+GL Y ++ V D P   D+ +E+DG
Sbjct: 141 VMKLSPSAVAHLRELL--NQPEPKLIRIGTRAKGCSGLAYHLEYV-DKPNALDEQVEQDG 197

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV ID+ +LL ++G+E+D+  +KL   F+F NPN    CGCG+S  +
Sbjct: 198 VKVLIDNKALLNIIGSEMDWLEDKLNERFIFRNPNITEQCGCGESFSV 245


>gi|85709859|ref|ZP_01040924.1| hypothetical protein NAP1_13278 [Erythrobacter sp. NAP1]
 gi|85688569|gb|EAQ28573.1| hypothetical protein NAP1_13278 [Erythrobacter sp. NAP1]
          Length = 122

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T+ A  RI E++  +   A G+++S  + GC+GL Y VD VT+     D+ IE  G 
Sbjct: 17  VILTKGAEARIAELMSKAPDDAIGVKLSTPRRGCSGLAYSVDFVTEE-AKFDEKIETPGG 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
             +ID AS+LY++G+ +D+  +   +GFVF NPN   ACGCG+S
Sbjct: 76  TFYIDGASVLYLVGSTMDWVEDDFTAGFVFDNPNAKGACGCGES 119


>gi|16761455|ref|NP_457072.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16765861|ref|NP_461476.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29140848|ref|NP_804190.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56412581|ref|YP_149656.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62181105|ref|YP_217522.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161502304|ref|YP_001569416.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161612695|ref|YP_001586660.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167549432|ref|ZP_02343191.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|167992666|ref|ZP_02573762.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168232114|ref|ZP_02657172.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168238279|ref|ZP_02663337.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168243325|ref|ZP_02668257.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168261417|ref|ZP_02683390.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168466703|ref|ZP_02700557.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|168821479|ref|ZP_02833479.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194450767|ref|YP_002046602.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194472708|ref|ZP_03078692.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194735933|ref|YP_002115603.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197247724|ref|YP_002147496.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197262585|ref|ZP_03162659.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197361516|ref|YP_002141152.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|198243888|ref|YP_002216606.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200388574|ref|ZP_03215186.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204929515|ref|ZP_03220589.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205353640|ref|YP_002227441.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207857949|ref|YP_002244600.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213028536|ref|ZP_03342983.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
 gi|213161571|ref|ZP_03347281.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213425313|ref|ZP_03358063.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213580751|ref|ZP_03362577.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213610149|ref|ZP_03369975.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213646427|ref|ZP_03376480.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213861456|ref|ZP_03385926.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224582919|ref|YP_002636717.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238912662|ref|ZP_04656499.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289803582|ref|ZP_06534211.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
 gi|289825406|ref|ZP_06544643.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|75481674|sp|Q57LH1|ISCA_SALCH RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|81362036|sp|Q5PNG5|ISCA_SALPA RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|81416275|sp|Q7CQ12|ISCA_SALTY RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|81628008|sp|Q8XFZ8|ISCA_SALTI RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|189044740|sp|A9MHJ6|ISCA_SALAR RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|189044741|sp|A9N1X7|ISCA_SALPB RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711598|sp|B5F1B8|ISCA_SALA4 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711599|sp|B5FR83|ISCA_SALDC RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711600|sp|B5R5A0|ISCA_SALEP RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711601|sp|B5RD10|ISCA_SALG2 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711602|sp|B4TDB4|ISCA_SALHS RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711604|sp|B5BAW8|ISCA_SALPK RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711605|sp|B4TRX3|ISCA_SALSV RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|254806052|sp|C0PYK9|ISCA_SALPC RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|25310148|pir||AD0824 conserved hypothetical protein STY2787 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16421086|gb|AAL21435.1| putative regulator [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16503755|emb|CAD02744.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29136473|gb|AAO68039.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56126838|gb|AAV76344.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62128738|gb|AAX66441.1| putative regulator [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|160863651|gb|ABX20274.1| hypothetical protein SARI_00335 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161362059|gb|ABX65827.1| hypothetical protein SPAB_00392 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194409071|gb|ACF69290.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194459072|gb|EDX47911.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194711435|gb|ACF90656.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|195630735|gb|EDX49327.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197092992|emb|CAR58424.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197211427|gb|ACH48824.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197240840|gb|EDY23460.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197288801|gb|EDY28174.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|197938404|gb|ACH75737.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199605672|gb|EDZ04217.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204321234|gb|EDZ06434.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205273421|emb|CAR38396.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205325260|gb|EDZ13099.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205329147|gb|EDZ15911.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205333536|gb|EDZ20300.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205337636|gb|EDZ24400.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205341931|gb|EDZ28695.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|205349649|gb|EDZ36280.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|206709752|emb|CAR34104.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224467446|gb|ACN45276.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|261247737|emb|CBG25565.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267994662|gb|ACY89547.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301159090|emb|CBW18604.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312913530|dbj|BAJ37504.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320087039|emb|CBY96808.1| putative iron-sulfur cluster insertion protein erpA [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
 gi|321222755|gb|EFX47826.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322613311|gb|EFY10253.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620485|gb|EFY17350.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625047|gb|EFY21876.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629509|gb|EFY26285.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322633896|gb|EFY30635.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635502|gb|EFY32213.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322639822|gb|EFY36501.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644292|gb|EFY40836.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322652259|gb|EFY48616.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322654833|gb|EFY51150.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658239|gb|EFY54505.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322661690|gb|EFY57908.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669670|gb|EFY65816.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673323|gb|EFY69428.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322674888|gb|EFY70975.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682911|gb|EFY78929.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322685572|gb|EFY81567.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322715595|gb|EFZ07166.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323130871|gb|ADX18301.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323194683|gb|EFZ79873.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323200367|gb|EFZ85448.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323201267|gb|EFZ86334.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323208337|gb|EFZ93277.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211587|gb|EFZ96425.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323216019|gb|EGA00751.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221908|gb|EGA06302.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225593|gb|EGA09820.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229310|gb|EGA13434.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235375|gb|EGA19459.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237439|gb|EGA21502.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245194|gb|EGA29195.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323248768|gb|EGA32695.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323254052|gb|EGA37873.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255618|gb|EGA39372.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262022|gb|EGA45587.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323267806|gb|EGA51287.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269635|gb|EGA53087.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326624361|gb|EGE30706.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326628742|gb|EGE35085.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|332989468|gb|AEF08451.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 107

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D P   D + E  GV
Sbjct: 3   ITLSDSAAARVNTFLAN-RGKGFGLRLGVRTSGCSGMAYVLEFV-DEPTAEDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL ++ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVVVDGKSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV 107


>gi|260550149|ref|ZP_05824363.1| iron-sulfur cluster assembly protein IscA [Acinetobacter sp.
           RUH2624]
 gi|260406904|gb|EEX00383.1| iron-sulfur cluster assembly protein IscA [Acinetobacter sp.
           RUH2624]
          Length = 106

 Score = 87.4 bits (215), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 69/108 (63%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V D+  + D + E+ G
Sbjct: 1   MIHLTENAATHISNYLKN-RGKGEGIRVGVKTSGCSGLAYVLEFV-DDIDEHDQVFEQFG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLEGLEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|154287670|ref|XP_001544630.1| iron-binding protein iscA [Ajellomyces capsulatus NAm1]
 gi|150408271|gb|EDN03812.1| iron-binding protein iscA [Ajellomyces capsulatus NAm1]
          Length = 285

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 66/102 (64%), Gaps = 3/102 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A+  ++++    Q   + +R+ +K  GC+GL Y ++ V D P   D+++E+DGVK+
Sbjct: 184 ITPEAILHLRQLT--DQPDPKLVRVGVKNRGCSGLSYHLEYV-DKPAPFDEVVEQDGVKI 240

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            IDS +L  ++GTE+D++ + L S FVF NPN    CGCG+S
Sbjct: 241 LIDSKALFSIIGTEMDWQEDSLASRFVFKNPNIKDQCGCGES 282


>gi|40889628|pdb|1R94|A Chain A, Crystal Structure Of Isca (Mercury Derivative)
 gi|40889629|pdb|1R94|B Chain B, Crystal Structure Of Isca (Mercury Derivative)
 gi|40889630|pdb|1R95|A Chain A, Crystal Structure Of Isca (Native)
 gi|40889631|pdb|1R95|B Chain B, Crystal Structure Of Isca (Native)
          Length = 118

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 68/110 (61%), Gaps = 2/110 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D P   D + E  GV
Sbjct: 3   ITLSDSAAARVNTFLAN-RGKGFGLRLGVRTSGCSGMAYVLEFV-DEPTPEDIVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           KV +D  SL ++ GT++DF  E L  GF F NPN    CGCG+S ++  A
Sbjct: 61  KVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFKLAAA 110


>gi|71280094|ref|YP_267877.1| iron-sulfur cluster assembly protein [Colwellia psychrerythraea
           34H]
 gi|71145834|gb|AAZ26307.1| iron-sulfur cluster assembly protein [Colwellia psychrerythraea
           34H]
          Length = 107

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMT AA  R++  + N +GK  G+R+ +K  GC+GL Y+++ V D   D D L     V
Sbjct: 3   VTMTPAAAERVQSFMQN-RGKGLGLRLGIKTTGCSGLAYVLEFVDDLNED-DQLFNIKDV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + ID+ SL+Y+ G E+DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  NIIIDAKSLVYLDGIELDFTKEGLNEGFKFTNPNAKGECGCGESFNV 107


>gi|163749692|ref|ZP_02156938.1| HesB/YadR/YfhF family protein [Shewanella benthica KT99]
 gi|161330505|gb|EDQ01463.1| HesB/YadR/YfhF family protein [Shewanella benthica KT99]
          Length = 103

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 65/105 (61%), Gaps = 2/105 (1%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           MT AA  R+K  + N +GK  G+R+ LK  GC+G+ Y+++ V D   D D++ E   VK+
Sbjct: 1   MTPAAADRVKSFLSN-RGKGIGLRLGLKTSGCSGMVYVIEFV-DELNDDDEVYEVADVKI 58

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            ID+ S +Y+ G E+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 59  IIDAKSFIYLQGIELDFVKEGLNEGFQFNNPNAKGECGCGESFTV 103


>gi|169633486|ref|YP_001707222.1| iron-binding protein, believed to be involved in Fe-S protein
           formation or repair [Acinetobacter baumannii SDF]
 gi|169796096|ref|YP_001713889.1| iron-binding protein, believed to be involved in Fe-S protein
           formation or repair [Acinetobacter baumannii AYE]
 gi|213157171|ref|YP_002319216.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           AB0057]
 gi|215483551|ref|YP_002325770.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           AB307-0294]
 gi|239501902|ref|ZP_04661212.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           AB900]
 gi|260555145|ref|ZP_05827366.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           ATCC 19606]
 gi|301345051|ref|ZP_07225792.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           AB056]
 gi|301510362|ref|ZP_07235599.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           AB058]
 gi|301595501|ref|ZP_07240509.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           AB059]
 gi|332851747|ref|ZP_08433672.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           6013150]
 gi|332865878|ref|ZP_08436658.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           6013113]
 gi|169149023|emb|CAM86900.1| iron-binding protein , believed to be involved in Fe-S protein
           formation or repair [Acinetobacter baumannii AYE]
 gi|169152278|emb|CAP01188.1| iron-binding protein , believed to be involved in Fe-S protein
           formation or repair [Acinetobacter baumannii]
 gi|193077273|gb|ABO12057.2| hypothetical protein A1S_1630 [Acinetobacter baumannii ATCC 17978]
 gi|213056331|gb|ACJ41233.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           AB0057]
 gi|213987221|gb|ACJ57520.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           AB307-0294]
 gi|260411687|gb|EEX04984.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           ATCC 19606]
 gi|332729754|gb|EGJ61089.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           6013150]
 gi|332734928|gb|EGJ66014.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           6013113]
          Length = 106

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 69/108 (63%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V D+  + D + E+ G
Sbjct: 1   MIHLTENAATHISNYLKN-RGKGEGIRVGVKTSGCSGLAYVLEFV-DDIDEHDQIFEQFG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLDGLEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|327263395|ref|XP_003216505.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Anolis carolinensis]
          Length = 129

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK+++ +      G+++ ++  GC GL Y ++  T +  D D+ +E+DGV
Sbjct: 25  LTLTPSAVNKIKQLLKDKPDHV-GVKVGVRTRGCNGLSYTLEY-TKSKGDSDEEVEQDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 83  KVFIEKKAQLTLLGTEMDYIEDKLTSEFVFNNPNIKGTCGCGESFNI 129


>gi|320451379|ref|YP_004203475.1| iron-sulfur cluster biosynthesis protein IscA [Thermus scotoductus
           SA-01]
 gi|320151548|gb|ADW22926.1| iron-sulfur cluster biosynthesis protein IscA [Thermus scotoductus
           SA-01]
          Length = 126

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 64/109 (58%), Gaps = 1/109 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T  A  + KEI+     +   IR+ +K GGC+G +Y +  V +  ++GD L+E  G
Sbjct: 8   VIRITPLAAEKAKEILARYGKEHAAIRVYIKSGGCSGFQYGM-AVDERELEGDTLVEMHG 66

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           V++ +D  SL Y++G+EID+    +  GF  HNPN  S CGCG S   K
Sbjct: 67  VRLVVDPMSLPYLVGSEIDWVESLMGGGFTVHNPNAASTCGCGHSFRTK 115


>gi|256271954|gb|EEU06973.1| Isa1p [Saccharomyces cerevisiae JAY291]
          Length = 250

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 71/105 (67%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++  A+  ++ ++  +Q + + IR+S +  GC+GL Y +  +T+ P   D+++E+DG
Sbjct: 146 LITLSPKAIKHLRALL--AQPEPKLIRVSARNRGCSGLTYDLQYITE-PGKFDEVVEQDG 202

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VK+ IDS +L  ++G+E+D+  +KL S FVF NPN    CGCG+S
Sbjct: 203 VKIVIDSKALFSIIGSEMDWVDDKLASKFVFKNPNSKGTCGCGES 247


>gi|89095326|ref|ZP_01168244.1| Putative hesB family protein [Oceanospirillum sp. MED92]
 gi|89080401|gb|EAR59655.1| Putative hesB family protein [Oceanospirillum sp. MED92]
          Length = 108

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT+AA   +   +  ++G   GIR+ ++  GC+G+ Y+++ V D   + +  +    V
Sbjct: 3   ITMTDAAASHVARYL-ETRGHGAGIRLGVRTSGCSGMAYVLEFVDDVQDEDEIFVGPQDV 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SLLY+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 62  KIVIDPKSLLYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFNV 108


>gi|184157977|ref|YP_001846316.1| hypothetical protein ACICU_01657 [Acinetobacter baumannii ACICU]
 gi|332874436|ref|ZP_08442339.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           6014059]
 gi|183209571|gb|ACC56969.1| uncharacterized conserved protein [Acinetobacter baumannii ACICU]
 gi|322508295|gb|ADX03749.1| iscA [Acinetobacter baumannii 1656-2]
 gi|323517921|gb|ADX92302.1| hypothetical protein ABTW07_1873 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332737280|gb|EGJ68204.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           6014059]
          Length = 106

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 69/108 (63%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V D+  + D + E+ G
Sbjct: 1   MIHLTENAASHISNYLKN-RGKGEGIRVGVKTSGCSGLAYVLEFV-DDIDEHDQIFEQFG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLDGLEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|330817659|ref|YP_004361364.1| Iron-sulfur cluster assembly protein IscA [Burkholderia gladioli
           BSR3]
 gi|327370052|gb|AEA61408.1| Iron-sulfur cluster assembly protein IscA [Burkholderia gladioli
           BSR3]
          Length = 107

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D   + D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGLGLRLGVRTTGCSGLAYKLEYVDDVATE-DQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|260461251|ref|ZP_05809499.1| iron-sulfur cluster assembly accessory protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259032788|gb|EEW34051.1| iron-sulfur cluster assembly accessory protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 120

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+ AV  +K  +  +   A+G RI ++ GGC+G +Y + L    P +GD ++E DG
Sbjct: 15  MITLTDKAVAAVKTALSAATEPAEGFRIMVQPGGCSGFKYSIGL-ESVPREGDAILETDG 73

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +KV++D+ S  ++ G  +DF T    SGFVF NPN  + C CG+S
Sbjct: 74  IKVFLDAGSQPHVAGMTVDFVTGLESSGFVFDNPNARAKCSCGKS 118


>gi|238028018|ref|YP_002912249.1| Iron-sulfur cluster assembly protein IscA [Burkholderia glumae
           BGR1]
 gi|237877212|gb|ACR29545.1| Iron-sulfur cluster assembly protein IscA [Burkholderia glumae
           BGR1]
          Length = 107

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D   + D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGLGLRLGVRTTGCSGLAYKLEYVDDVAAE-DQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|319785428|ref|YP_004144904.1| iron-sulfur cluster assembly accessory protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317171316|gb|ADV14854.1| iron-sulfur cluster assembly accessory protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 106

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+ AV  +K  +  +   A+G RI ++ GGC+G +Y + L    P +GD ++E DG
Sbjct: 1   MITLTDKAVAAVKTALSAATEPAEGFRIMVQPGGCSGFKYSIGL-ESVPREGDAILETDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +KV++D+ S  ++ G  +DF T    SGFVF NPN  + C CG+S
Sbjct: 60  IKVFLDAGSQPHVAGMTVDFVTGLESSGFVFDNPNARAKCSCGKS 104


>gi|194445485|ref|YP_002041802.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|226711603|sp|B4T0S0|ISCA_SALNS RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|194404148|gb|ACF64370.1| iron-sulfur cluster assembly protein IscA [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
          Length = 107

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+  I   ++GK  G+R+ ++  GC+G+ Y+++ V D P+  D + E  GV
Sbjct: 3   ITLSDSAAARVN-IFLANRGKGFGLRLGVRTSGCSGMAYVLEFV-DEPMAEDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL ++ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVVVDGKSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV 107


>gi|220923904|ref|YP_002499206.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           nodulans ORS 2060]
 gi|219948511|gb|ACL58903.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           nodulans ORS 2060]
          Length = 106

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 65/105 (61%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++T+ AV  +K  +  + G   G+RI ++ GGCAG +YM+ L+      GD +IE+DG
Sbjct: 1   MISLTDNAVSAVKNALSQASGAPTGLRIMVEAGGCAGFKYMI-LLESTQRRGDLVIEQDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           V+++++  S   + G  IDF T    SGFVF NPN  S C CG+S
Sbjct: 60  VRLFVEGRSQSLVSGLRIDFVTALNNSGFVFENPNAASKCACGKS 104


>gi|260598920|ref|YP_003211491.1| iron-sulfur cluster assembly protein [Cronobacter turicensis z3032]
 gi|260218097|emb|CBA32865.1| Iron-binding protein iscA [Cronobacter turicensis z3032]
          Length = 107

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+++ A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D P+  D + E  GV
Sbjct: 3   ITLSDTAAARVNAFLAN-RGKGFGLRLGVRTSGCSGMAYVLEFV-DAPLPEDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL ++ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVVVDGKSLQFLNGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFNV 107


>gi|187478012|ref|YP_786036.1| iron-sulfur cluster assembly protein [Bordetella avium 197N]
 gi|115422598|emb|CAJ49123.1| iron-sulfur cluster assembly protein [Bordetella avium 197N]
          Length = 107

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+ A   +   +   +GK  G+R+ ++  GC+G+ Y ++ V D+P   D + E  GV
Sbjct: 3   VTLTQQAANHVSRYL-QKRGKGIGLRLGVRTTGCSGMAYKLEYV-DDPDAEDVVFESFGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+D+  E L  GF F NPN+ + CGCG+S  +
Sbjct: 61  KVFVDPKSLAYLEGTELDYAREGLNEGFKFSNPNEKATCGCGESFTV 107


>gi|294901574|ref|XP_002777419.1| iron-sulfur cluster assembly protein, putative [Perkinsus marinus
           ATCC 50983]
 gi|239885055|gb|EER09235.1| iron-sulfur cluster assembly protein, putative [Perkinsus marinus
           ATCC 50983]
          Length = 483

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 72/109 (66%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQ-GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++T+T AA  RIK+++     ++  G+R+ L K GC  + Y ++   +     D+++E +
Sbjct: 376 VMTVTPAAASRIKDLMNKKHDESIIGLRVGLAKKGCENMSYTMNYAKEI-GKLDEVVESE 434

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVKV +DS +L+Y++GTE+D+    L S FVF+NPNQ S+CGCG+S  +
Sbjct: 435 GVKVVVDSNALMYLIGTEMDYVDNDLASEFVFNNPNQKSSCGCGKSFSV 483


>gi|283786143|ref|YP_003366008.1| iron-binding protein (iron-sulfur cluster assembly protein)
           [Citrobacter rodentium ICC168]
 gi|283832091|ref|ZP_06351832.1| iron-sulfur cluster assembly protein IscA [Citrobacter youngae ATCC
           29220]
 gi|282949597|emb|CBG89216.1| iron-binding protein (iron-sulfur cluster assembly protein)
           [Citrobacter rodentium ICC168]
 gi|291071717|gb|EFE09826.1| iron-sulfur cluster assembly protein IscA [Citrobacter youngae ATCC
           29220]
          Length = 107

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D P   D + E  GV
Sbjct: 3   ITLSDSAAARVNTFLAN-RGKGFGLRLGVRTSGCSGMAYVLEFV-DEPAAEDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL ++ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV 107


>gi|323308153|gb|EGA61404.1| Isa1p [Saccharomyces cerevisiae FostersO]
          Length = 250

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 71/105 (67%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++  A+  ++ ++  +Q + + IR+S +  GC+GL Y +  +T+ P   D+++E+DG
Sbjct: 146 LITLSPKAIKHLRALL--AQPEPKLIRVSARNRGCSGLTYDLQYITE-PGKFDEVVEQDG 202

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VK+ IDS +L  ++G+E+D+  +KL S FVF NPN    CGCG+S
Sbjct: 203 VKIVIDSKALFSIIGSEMDWVDDKLASKFVFKNPNSKGTCGCGES 247


>gi|223936198|ref|ZP_03628111.1| iron-sulfur cluster assembly accessory protein [bacterium Ellin514]
 gi|223895060|gb|EEF61508.1| iron-sulfur cluster assembly accessory protein [bacterium Ellin514]
          Length = 128

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 67/106 (63%), Gaps = 3/106 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGI-RISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++ +TE+A  ++  +    QG+AQG+ R+++  GGC+GL+Y +DL  D P + D L+E  
Sbjct: 22  LIKVTESAAKKVSSL-LTKQGRAQGVLRVAVVGGGCSGLQYKMDL-QDGPANRDILVESS 79

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           G+KV +D  S LY+ G+E+D+       GF   NPN  ++C CG+S
Sbjct: 80  GIKVVVDPKSALYVTGSELDYLDALQEGGFKVKNPNAATSCSCGES 125


>gi|323347592|gb|EGA81859.1| Isa1p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 250

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 71/105 (67%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++  A+  ++ ++  +Q + + IR+S +  GC+GL Y +  +T+ P   D+++E+DG
Sbjct: 146 LITLSPKAIKHLRALL--AQPEPKLIRVSARNRGCSGLTYDLQYITE-PGKFDEVVEQDG 202

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VK+ IDS +L  ++G+E+D+  +KL S FVF NPN    CGCG+S
Sbjct: 203 VKIVIDSKALFSIIGSEMDWVDDKLASKFVFKNPNSKGTCGCGES 247


>gi|323303936|gb|EGA57716.1| Isa1p [Saccharomyces cerevisiae FostersB]
          Length = 250

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 71/105 (67%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++  A+  ++ ++  +Q + + IR+S +  GC+GL Y +  +T+ P   D+++E+DG
Sbjct: 146 LITLSPKAIKHLRALL--AQPEPKLIRVSARNRGCSGLTYDLQYITE-PGKFDEVVEQDG 202

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VK+ IDS +L  ++G+E+D+  +KL S FVF NPN    CGCG+S
Sbjct: 203 VKIVIDSKALFSIIGSEMDWVDDKLASKFVFKNPNSKGTCGCGES 247


>gi|317405203|gb|EFV85542.1| hypothetical protein HMPREF0005_03986 [Achromobacter xylosoxidans
           C54]
          Length = 107

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+ A   I   +   +GK  G+R+ ++  GC+G+ Y ++ V D+    D + E  GV
Sbjct: 3   VTLTQQAATHIGRYL-QKRGKGIGLRLGVRTTGCSGMAYKLEYV-DDAAPEDQVFESFGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+D+  E L  GF F NPN+ + CGCG+S  +
Sbjct: 61  KVFVDPKSLAYLDGTELDYAREGLNEGFKFRNPNEKATCGCGESFTV 107


>gi|151941143|gb|EDN59521.1| iron sulfur assembly-related protein [Saccharomyces cerevisiae
           YJM789]
 gi|190406019|gb|EDV09286.1| iron sulfur assembly protein 1 [Saccharomyces cerevisiae RM11-1a]
 gi|259147962|emb|CAY81211.1| Isa1p [Saccharomyces cerevisiae EC1118]
 gi|323336537|gb|EGA77803.1| Isa1p [Saccharomyces cerevisiae Vin13]
 gi|323353875|gb|EGA85728.1| Isa1p [Saccharomyces cerevisiae VL3]
          Length = 250

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 71/105 (67%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++  A+  ++ ++  +Q + + IR+S +  GC+GL Y +  +T+ P   D+++E+DG
Sbjct: 146 LITLSPKAIKHLRALL--AQPEPKLIRVSARNRGCSGLTYDLQYITE-PGKFDEVVEQDG 202

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VK+ IDS +L  ++G+E+D+  +KL S FVF NPN    CGCG+S
Sbjct: 203 VKIVIDSKALFSIIGSEMDWVDDKLASKFVFKNPNSKGTCGCGES 247


>gi|323138473|ref|ZP_08073542.1| iron-sulfur cluster assembly accessory protein [Methylocystis sp.
           ATCC 49242]
 gi|322396269|gb|EFX98801.1| iron-sulfur cluster assembly accessory protein [Methylocystis sp.
           ATCC 49242]
          Length = 106

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T++AV  ++  +  +  + +G+RI ++ GGCAGL+YM+ LV + P   D + + DG
Sbjct: 1   MIQLTDSAVTAVRTAIAGAGQEVEGLRIMVEAGGCAGLKYMMGLVNE-PDPNDHVFDNDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VK++++  SL Y+ GT IDF      SGF F NP   S+C CG+S
Sbjct: 60  VKIFVEEGSLAYLDGTRIDFVIGLEGSGFTFDNPQAKSSCSCGKS 104


>gi|319404149|emb|CBI77742.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 107

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +++ A  +I +I+    GK   +RIS++ GGC+G  Y  DLV+++  D D +I+KDG 
Sbjct: 3   VNISDIAAKQIAQILAEQPGKT-ALRISVEGGGCSGFSYKYDLVSESKED-DFVIKKDGA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V+IDS S  +M G EIDF  + +   F  HNPN  S+CGCG S  I
Sbjct: 61  VVFIDSISFPFMEGAEIDFVDDLMGQSFQIHNPNATSSCGCGVSFSI 107


>gi|159125322|gb|EDP50439.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Aspergillus fumigatus A1163]
          Length = 228

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 70/104 (67%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T  AV ++++++  SQ   + IR+ +K  GC+GL Y ++ V + P   D+++E+DGV
Sbjct: 125 MKLTPLAVEQLRKLL--SQPDPKFIRVGVKNRGCSGLAYHLEYV-EKPGAFDEVVEQDGV 181

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV IDS +L  ++G+E+D++ +KL   FVF NPN    CGCG+S
Sbjct: 182 KVLIDSKALFSIIGSEMDWQEDKLSRKFVFRNPNIKEQCGCGES 225


>gi|77165127|ref|YP_343652.1| HesB/YadR/YfhF [Nitrosococcus oceani ATCC 19707]
 gi|254433828|ref|ZP_05047336.1| hypothetical protein NOC27_759 [Nitrosococcus oceani AFC27]
 gi|76883441|gb|ABA58122.1| HesB/YadR/YfhF [Nitrosococcus oceani ATCC 19707]
 gi|207090161|gb|EDZ67432.1| hypothetical protein NOC27_759 [Nitrosococcus oceani AFC27]
          Length = 107

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +A+ +IK+ V + Q   +G+RI +KK GC+G  Y++D       + D + + DGV
Sbjct: 3   ITVTASALKQIKK-VLSQQENVEGLRIGVKKSGCSGYAYVLDFAKQVKSE-DTIFDHDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL ++ GTE+D++ E L   F F NPN    CGCG+S  I
Sbjct: 61  KILVDKKSLNFIDGTELDYRREGLNESFKFQNPNVAGTCGCGESFSI 107


>gi|293606130|ref|ZP_06688495.1| iron-sulfur cluster assembly protein IscA [Achromobacter piechaudii
           ATCC 43553]
 gi|292815585|gb|EFF74701.1| iron-sulfur cluster assembly protein IscA [Achromobacter piechaudii
           ATCC 43553]
          Length = 107

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+ A   I   +   +GK  G+R+ ++  GC+G+ Y ++ V D+  + D + E  GV
Sbjct: 3   VTLTQQAATHIGRYL-QKRGKGIGLRLGVRTTGCSGMAYKLEYVDDSAPE-DVVFESFGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV+ID  SL Y+ GTE+D+  E L  GF F NPN+ + CGCG+S  +
Sbjct: 61  KVFIDPKSLAYLDGTELDYAREGLNEGFKFRNPNEKATCGCGESFTV 107


>gi|253688827|ref|YP_003018017.1| FeS assembly scaffold SufA [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251755405|gb|ACT13481.1| FeS assembly scaffold SufA [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 123

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE+AV +IK ++   +   QG+R+S+K+ GCAG  Y++DLV +   D D + E+DG 
Sbjct: 19  LTLTESAVKQIKNLMKQDEA-VQGLRLSVKQSGCAGFGYVLDLVQEFETD-DLVFERDGA 76

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F F+NP    ACGCG+S  I
Sbjct: 77  KLYVPLKAMPFIDGTELDFVREGLNQIFKFNNPRAQHACGCGESFGI 123


>gi|323332598|gb|EGA74005.1| Isa1p [Saccharomyces cerevisiae AWRI796]
          Length = 250

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 71/105 (67%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++  A+  ++ ++  +Q + + IR+S +  GC+GL Y +  +T+ P   D+++E+DG
Sbjct: 146 LITLSPKAIKHLRALL--AQPEPKLIRVSARNRGCSGLTYDLQYITE-PGKFDEVVEQDG 202

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VK+ IDS +L  ++G+E+D+  +KL S FVF NPN    CGCG+S
Sbjct: 203 VKIVIDSKALFSVIGSEMDWVDDKLASKFVFKNPNSKGTCGCGES 247


>gi|6323001|ref|NP_013073.1| Isa1p [Saccharomyces cerevisiae S288c]
 gi|2495214|sp|Q07821|ISA1_YEAST RecName: Full=Iron-sulfur assembly protein 1
 gi|1360208|emb|CAA97476.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|285813397|tpg|DAA09293.1| TPA: Isa1p [Saccharomyces cerevisiae S288c]
          Length = 250

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 71/105 (67%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++  A+  ++ ++  +Q + + IR+S +  GC+GL Y +  +T+ P   D+++E+DG
Sbjct: 146 LITLSPKAIKHLRALL--AQPEPKLIRVSARNRGCSGLTYDLQYITE-PGKFDEVVEQDG 202

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VK+ IDS +L  ++G+E+D+  +KL S FVF NPN    CGCG+S
Sbjct: 203 VKIVIDSKALFSIIGSEMDWIDDKLASKFVFKNPNSKGTCGCGES 247


>gi|70993822|ref|XP_751758.1| iron-sulfur cluster assembly accessory protein Isa1 [Aspergillus
           fumigatus Af293]
 gi|66849392|gb|EAL89720.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Aspergillus fumigatus Af293]
          Length = 228

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 70/104 (67%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T  AV ++++++  SQ   + IR+ +K  GC+GL Y ++ V + P   D+++E+DGV
Sbjct: 125 MKLTPLAVEQLRKLL--SQPDPKFIRVGVKNRGCSGLAYHLEYV-EKPGAFDEVVEQDGV 181

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV IDS +L  ++G+E+D++ +KL   FVF NPN    CGCG+S
Sbjct: 182 KVLIDSKALFSIIGSEMDWQEDKLSRKFVFRNPNIKEQCGCGES 225


>gi|239828209|ref|YP_002950833.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           WCH70]
 gi|239808502|gb|ACS25567.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           WCH70]
          Length = 120

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 66/108 (61%), Gaps = 1/108 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+DI+T+TEAA ++IK+++   + +   +RI +K GGC+GL Y +    +   D D   E
Sbjct: 1   MADIITLTEAAAFQIKDMMKEHEEEGAYLRIGVKGGGCSGLSYGMGFDHERHED-DHEFE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           + G+K+ +D  S   + GT ID+K   +  GF  +NPN ++ CGCG S
Sbjct: 60  QHGIKILVDKESAPILQGTVIDYKQSLMGGGFTINNPNAIATCGCGSS 107


>gi|290561206|gb|ADD38005.1| Iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Lepeophtheirus salmonis]
          Length = 135

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + MT +AV RIKE+V   + +  G+RI +K+ GC G+ Y++D         +++I+ DGV
Sbjct: 31  LVMTPSAVRRIKELV-EERHECIGLRIGVKQRGCNGMSYVLDYAIQKEKHDEEVIQ-DGV 88

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K++ID  + L +LGTE+D+    L + FVF+NPN    CGCG+S  I
Sbjct: 89  KIFIDKKAQLSILGTEMDYVDSNLSAEFVFNNPNIKGTCGCGESFSI 135


>gi|169771539|ref|XP_001820239.1| iron-sulfur assembly protein 1 [Aspergillus oryzae RIB40]
 gi|238485886|ref|XP_002374181.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Aspergillus flavus NRRL3357]
 gi|83768098|dbj|BAE58237.1| unnamed protein product [Aspergillus oryzae]
 gi|220699060|gb|EED55399.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Aspergillus flavus NRRL3357]
          Length = 237

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 70/102 (68%), Gaps = 3/102 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A+ ++++++  SQ   + IR+ +K  GC+GL Y ++ V + P   D+++E+DGVKV
Sbjct: 136 LTPEAIVQLRKLL--SQPDPKLIRVGVKNRGCSGLAYHLEYV-EKPGTFDEVVEQDGVKV 192

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            IDS +L  ++G+E+D++ +KL   F+F NPN   +CGCG+S
Sbjct: 193 LIDSKALFSIIGSEMDWQEDKLSRRFIFKNPNIKESCGCGES 234


>gi|319779389|ref|YP_004130302.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Taylorella equigenitalis MCE9]
 gi|317109413|gb|ADU92159.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Taylorella equigenitalis MCE9]
          Length = 107

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 68/108 (62%), Gaps = 4/108 (3%)

Query: 5   VTMTE-AAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           VT+TE AA + IK I    +GK  G+R+ +K  GC+G+ Y ++   +  +  D + E   
Sbjct: 3   VTLTERAAQHVIKSI--KKRGKGIGLRVGVKTSGCSGMAYKLEYADEQDI-ADSVFESHN 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V+V++D+ SL Y+ GTE+DF  E L  GF F NPN+ ++CGCG+S  +
Sbjct: 60  VRVFVDAKSLPYIDGTELDFVREGLNEGFKFKNPNEKASCGCGESFSV 107


>gi|300312442|ref|YP_003776534.1| hypothetical protein Hsero_3142 [Herbaspirillum seropedicae SmR1]
 gi|300075227|gb|ADJ64626.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 107

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   I   +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAKHISRYM-ERRGKGIGLRLGVRTTGCSGLAYKLEYV-DEQSSEDTVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V++D  SL Y+ GTE+DF  E L  GF F NPN    CGCG+S  I
Sbjct: 61  RVFVDPKSLPYIDGTELDFAREGLNEGFKFQNPNVKDECGCGESFRI 107


>gi|115377893|ref|ZP_01465079.1| iron-sulfur cluster assembly accessory protein [Stigmatella
           aurantiaca DW4/3-1]
 gi|310823046|ref|YP_003955404.1| iron-sulfur cluster assembly accessory protein [Stigmatella
           aurantiaca DW4/3-1]
 gi|115365108|gb|EAU64157.1| iron-sulfur cluster assembly accessory protein [Stigmatella
           aurantiaca DW4/3-1]
 gi|309396118|gb|ADO73577.1| Iron-sulfur cluster assembly accessory protein [Stigmatella
           aurantiaca DW4/3-1]
          Length = 133

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 72/107 (67%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + ++++AV R++ ++   Q    G+R+++K GGC+GL+Y ++   + P + D + E++GV
Sbjct: 28  ILLSDSAVLRLRRLLEERQTPEAGLRLAVKGGGCSGLQYAMEWA-EKPRERDKIFEREGV 86

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V++D  S LY++GTE+ ++   + SGF   NPN  +ACGCG+S  +
Sbjct: 87  RVFVDPKSYLYLMGTELVYEETMMASGFKLQNPNVKAACGCGESFTL 133


>gi|146420893|ref|XP_001486399.1| hypothetical protein PGUG_02070 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 264

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 72/105 (68%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++ +A+  +K ++   Q + + IRI +K  GC+GL Y ++ V++ P   D+++E+DG
Sbjct: 160 LITLSPSAIEHLKGLL--DQPEPKLIRIGVKNRGCSGLTYHLEYVSE-PGKFDEVVEQDG 216

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV IDS +L  ++G+E+++  +KL S F+F NPN    CGCG+S
Sbjct: 217 VKVVIDSKALFSIVGSEMEWLDDKLSSRFIFKNPNSKGTCGCGES 261


>gi|153878768|ref|ZP_02004679.1| Iron-sulphur cluster biosynthesis [Beggiatoa sp. PS]
 gi|152064768|gb|EDN65321.1| Iron-sulphur cluster biosynthesis [Beggiatoa sp. PS]
          Length = 107

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+ A   +++ +  S+GK  G+R+ +K  GC+G+ Y+++   D   + D + E  G+
Sbjct: 3   LTLTDTAAKHVQKSL-TSRGKGVGLRLGVKTSGCSGMAYVMEFA-DEISENDQVFESLGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SLLY+ GTE+DF  E L  GF F+NPN    CGCG+S  I
Sbjct: 61  KILVDPKSLLYIDGTELDFVREGLNEGFQFNNPNIKDECGCGESFNI 107


>gi|85375375|ref|YP_459437.1| hypothetical protein ELI_12740 [Erythrobacter litoralis HTCC2594]
 gi|84788458|gb|ABC64640.1| hypothetical protein ELI_12740 [Erythrobacter litoralis HTCC2594]
          Length = 119

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T AA  R+ +++  +   A G+++S  + GC+GL Y VD VT+     D+ IE  G 
Sbjct: 14  VILTPAAEQRVADLMAKAPEDAIGVKLSTPRRGCSGLAYSVDYVTEE-AKFDEKIETPGG 72

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
             +ID AS+LY++G+ +D+  +   +GFVF NPN   ACGCG+S
Sbjct: 73  VFYIDGASVLYLIGSTMDWVEDDFTAGFVFENPNAKGACGCGES 116


>gi|218296259|ref|ZP_03497015.1| iron-sulfur cluster assembly accessory protein [Thermus aquaticus
           Y51MC23]
 gi|218243331|gb|EED09861.1| iron-sulfur cluster assembly accessory protein [Thermus aquaticus
           Y51MC23]
          Length = 126

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 63/109 (57%), Gaps = 1/109 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T  A  + KEI+     +   IR+ +K GGC+G +Y +  V +  ++GD  +E  G
Sbjct: 8   VIRITPLAAEKAKEILARYGKEGAAIRVYIKSGGCSGFQYGM-AVDERELEGDTFVEMHG 66

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           V++ +D  SL Y++G+EID+    +  GF  HNPN  S CGCG S   K
Sbjct: 67  VRLVVDQRSLPYLVGSEIDWVESLMGGGFTVHNPNAASTCGCGHSFRTK 115


>gi|46199574|ref|YP_005241.1| hesB protein [Thermus thermophilus HB27]
 gi|46197200|gb|AAS81614.1| hesB protein [Thermus thermophilus HB27]
          Length = 126

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 63/109 (57%), Gaps = 1/109 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T  A  + KEI+     +   IR+ +K GGC+G +Y +  V +  + GD  +E  G
Sbjct: 8   VIRITPLAAEKAKEILARYGKEHAAIRVYIKSGGCSGFQYGM-AVDERELPGDTFVEMHG 66

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           V++ +D  SL Y++G+EID+    +  GF  HNPN VS CGCG S   K
Sbjct: 67  VRLVVDRMSLPYLVGSEIDWVESLMGGGFTVHNPNAVSTCGCGHSFRTK 115


>gi|190345989|gb|EDK37972.2| hypothetical protein PGUG_02070 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 264

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 72/105 (68%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++ +A+  +K ++   Q + + IRI +K  GC+GL Y ++ V++ P   D+++E+DG
Sbjct: 160 LITLSPSAIEHLKGLL--DQPEPKLIRIGVKNRGCSGLTYHLEYVSE-PGKFDEVVEQDG 216

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV IDS +L  ++G+E+++  +KL S F+F NPN    CGCG+S
Sbjct: 217 VKVVIDSKALFSIVGSEMEWLDDKLSSRFIFKNPNSKGTCGCGES 261


>gi|302899051|ref|XP_003047968.1| hypothetical protein NECHADRAFT_104323 [Nectria haematococca mpVI
           77-13-4]
 gi|256728900|gb|EEU42255.1| hypothetical protein NECHADRAFT_104323 [Nectria haematococca mpVI
           77-13-4]
          Length = 235

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 68/104 (65%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T AAV +++E++   Q   + I++ ++  GC+GL Y ++ V D P   D+ +E+DGV
Sbjct: 132 MKLTPAAVEQLRELL--DQPDPKLIKVGVRNRGCSGLAYHLEYV-DKPGAFDETVEQDGV 188

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV IDS +L  ++G+E+D+  +KL   FVF NPN    CGCG+S
Sbjct: 189 KVLIDSKALFSIIGSEMDWAEDKLNQRFVFRNPNIKEQCGCGES 232


>gi|221133860|ref|ZP_03560165.1| iron-sulfur cluster assembly protein IscA [Glaciecola sp. HTCC2999]
          Length = 107

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++++AA  R ++ + N +G   G+R+ +K  GC+GL Y+++ V D   + D + E +GV
Sbjct: 3   ISVSDAAAKRARDFLVN-RGSGIGLRLGVKTTGCSGLAYVLEFV-DELNEDDTVFEDNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KIIIDGKSLVYLDGTQLDFAKEGLNEGFQFVNPNANGECGCGESFNV 107


>gi|206560558|ref|YP_002231323.1| HesB family protein [Burkholderia cenocepacia J2315]
 gi|198036600|emb|CAR52497.1| HesB family protein [Burkholderia cenocepacia J2315]
          Length = 107

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYLVR-RGKGMGLRLGVRTTGCSGLAYKLEYV-DELAPEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|15803055|ref|NP_289085.1| iron-sulfur cluster assembly protein [Escherichia coli O157:H7
           EDL933]
 gi|15832648|ref|NP_311421.1| iron-sulfur cluster assembly protein [Escherichia coli O157:H7 str.
           Sakai]
 gi|16130453|ref|NP_417023.1| FeS cluster assembly protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|30063918|ref|NP_838089.1| iron-sulfur cluster assembly protein [Shigella flexneri 2a str.
           2457T]
 gi|56480126|ref|NP_708367.2| iron-sulfur cluster assembly protein [Shigella flexneri 2a str.
           301]
 gi|74313054|ref|YP_311473.1| iron-sulfur cluster assembly protein [Shigella sonnei Ss046]
 gi|82544977|ref|YP_408924.1| iron-sulfur cluster assembly protein [Shigella boydii Sb227]
 gi|82777911|ref|YP_404260.1| iron-sulfur cluster assembly protein [Shigella dysenteriae Sd197]
 gi|89109334|ref|AP_003114.1| FeS cluster assembly protein [Escherichia coli str. K-12 substr.
           W3110]
 gi|110642693|ref|YP_670423.1| iron-sulfur cluster assembly protein [Escherichia coli 536]
 gi|117624756|ref|YP_853669.1| iron-sulfur cluster assembly protein [Escherichia coli APEC O1]
 gi|161486151|ref|NP_754935.2| iron-sulfur cluster assembly protein [Escherichia coli CFT073]
 gi|168761144|ref|ZP_02786151.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4501]
 gi|170019189|ref|YP_001724143.1| iron-sulfur cluster assembly protein [Escherichia coli ATCC 8739]
 gi|170082138|ref|YP_001731458.1| FeS cluster assembly protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170681489|ref|YP_001744717.1| iron-sulfur cluster assembly protein [Escherichia coli SMS-3-5]
 gi|170767559|ref|ZP_02902012.1| iron-sulfur cluster assembly protein IscA [Escherichia albertii
           TW07627]
 gi|191167670|ref|ZP_03029479.1| iron-sulfur cluster assembly protein IscA [Escherichia coli B7A]
 gi|191172588|ref|ZP_03034127.1| iron-sulfur cluster assembly protein IscA [Escherichia coli F11]
 gi|193064017|ref|ZP_03045102.1| iron-sulfur cluster assembly protein IscA [Escherichia coli E22]
 gi|193068314|ref|ZP_03049277.1| iron-sulfur cluster assembly protein IscA [Escherichia coli
           E110019]
 gi|194427272|ref|ZP_03059822.1| iron-sulfur cluster assembly protein IscA [Escherichia coli B171]
 gi|194437577|ref|ZP_03069673.1| iron-sulfur cluster assembly protein IscA [Escherichia coli 101-1]
 gi|195936674|ref|ZP_03082056.1| iron-sulfur cluster assembly protein [Escherichia coli O157:H7 str.
           EC4024]
 gi|209920005|ref|YP_002294089.1| iron-sulfur cluster assembly protein [Escherichia coli SE11]
 gi|215487878|ref|YP_002330309.1| iron-sulfur cluster assembly protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217327820|ref|ZP_03443903.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. TW14588]
 gi|218548035|ref|YP_002381826.1| iron-sulfur cluster assembly protein [Escherichia fergusonii ATCC
           35469]
 gi|218555053|ref|YP_002387966.1| iron-sulfur cluster assembly protein [Escherichia coli IAI1]
 gi|218559454|ref|YP_002392367.1| iron-sulfur cluster assembly protein [Escherichia coli S88]
 gi|218690648|ref|YP_002398860.1| iron-sulfur cluster assembly protein [Escherichia coli ED1a]
 gi|218696155|ref|YP_002403822.1| iron-sulfur cluster assembly protein [Escherichia coli 55989]
 gi|218701038|ref|YP_002408667.1| iron-sulfur cluster assembly protein [Escherichia coli IAI39]
 gi|218706031|ref|YP_002413550.1| iron-sulfur cluster assembly protein [Escherichia coli UMN026]
 gi|227887564|ref|ZP_04005369.1| HesB family protein [Escherichia coli 83972]
 gi|237705039|ref|ZP_04535520.1| iron-sulfur cluster assembly protein IscA [Escherichia sp.
           3_2_53FAA]
 gi|238901693|ref|YP_002927489.1| FeS cluster assembly protein [Escherichia coli BW2952]
 gi|253772576|ref|YP_003035407.1| iron-sulfur cluster assembly protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162502|ref|YP_003045610.1| iron-sulfur cluster assembly protein [Escherichia coli B str.
           REL606]
 gi|254794478|ref|YP_003079315.1| iron-sulfur cluster assembly protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|256017323|ref|ZP_05431188.1| iron-sulfur cluster assembly protein [Shigella sp. D9]
 gi|256021787|ref|ZP_05435652.1| iron-sulfur cluster assembly protein [Escherichia sp. 4_1_40B]
 gi|260845158|ref|YP_003222936.1| FeS cluster assembly protein [Escherichia coli O103:H2 str. 12009]
 gi|260856622|ref|YP_003230513.1| FeS cluster assembly protein [Escherichia coli O26:H11 str. 11368]
 gi|260869217|ref|YP_003235619.1| FeS cluster assembly protein [Escherichia coli O111:H- str. 11128]
 gi|261223036|ref|ZP_05937317.1| iron-sulfur cluster assembly protein [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261259413|ref|ZP_05951946.1| iron-sulfur cluster assembly protein [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283753|ref|YP_003500571.1| Iron-binding protein iscA [Escherichia coli O55:H7 str. CB9615]
 gi|293405969|ref|ZP_06649961.1| iron-binding protein iscA [Escherichia coli FVEC1412]
 gi|293410943|ref|ZP_06654519.1| iron-sulfur cluster assembly protein IscA [Escherichia coli B354]
 gi|293415796|ref|ZP_06658439.1| iron-sulfur cluster assembly protein IscA [Escherichia coli B185]
 gi|293446881|ref|ZP_06663303.1| iron-sulfur cluster assembly protein IscA [Escherichia coli B088]
 gi|297520342|ref|ZP_06938728.1| iron-sulfur cluster assembly protein [Escherichia coli OP50]
 gi|298381770|ref|ZP_06991369.1| iron-binding protein iscA [Escherichia coli FVEC1302]
 gi|300817702|ref|ZP_07097917.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           107-1]
 gi|300820802|ref|ZP_07100952.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           119-7]
 gi|300898364|ref|ZP_07116710.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           198-1]
 gi|300904295|ref|ZP_07122153.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           84-1]
 gi|300920687|ref|ZP_07137095.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           115-1]
 gi|300927105|ref|ZP_07142855.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           182-1]
 gi|300930172|ref|ZP_07145590.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           187-1]
 gi|300940218|ref|ZP_07154818.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           21-1]
 gi|300951761|ref|ZP_07165580.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           116-1]
 gi|300958838|ref|ZP_07170949.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           175-1]
 gi|300982028|ref|ZP_07175850.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           45-1]
 gi|300998257|ref|ZP_07181945.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           200-1]
 gi|301022143|ref|ZP_07186066.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           196-1]
 gi|301024810|ref|ZP_07188447.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           69-1]
 gi|301047165|ref|ZP_07194258.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           185-1]
 gi|301302886|ref|ZP_07209014.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           124-1]
 gi|301330376|ref|ZP_07223021.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           78-1]
 gi|301648286|ref|ZP_07248027.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           146-1]
 gi|306814402|ref|ZP_07448564.1| iron-sulfur cluster assembly protein [Escherichia coli NC101]
 gi|307139163|ref|ZP_07498519.1| iron-sulfur cluster assembly protein [Escherichia coli H736]
 gi|307313901|ref|ZP_07593517.1| iron-sulfur cluster assembly protein IscA [Escherichia coli W]
 gi|309794425|ref|ZP_07688848.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           145-7]
 gi|312965446|ref|ZP_07779678.1| iron-sulfur cluster assembly protein IscA [Escherichia coli
           2362-75]
 gi|312973228|ref|ZP_07787400.1| iron-sulfur cluster assembly protein IscA [Escherichia coli
           1827-70]
 gi|331643149|ref|ZP_08344284.1| iron-sulfur cluster assembly protein IscA [Escherichia coli H736]
 gi|331648226|ref|ZP_08349316.1| iron-sulfur cluster assembly protein IscA [Escherichia coli M605]
 gi|331653962|ref|ZP_08354963.1| iron-sulfur cluster assembly protein IscA [Escherichia coli M718]
 gi|331658676|ref|ZP_08359620.1| iron-sulfur cluster assembly protein IscA [Escherichia coli TA206]
 gi|331664093|ref|ZP_08365003.1| iron-sulfur cluster assembly protein IscA [Escherichia coli TA143]
 gi|331669276|ref|ZP_08370124.1| iron-sulfur cluster assembly protein IscA [Escherichia coli TA271]
 gi|331673984|ref|ZP_08374747.1| iron-sulfur cluster assembly protein IscA [Escherichia coli TA280]
 gi|331678521|ref|ZP_08379196.1| iron-sulfur cluster assembly protein IscA [Escherichia coli H591]
 gi|331684178|ref|ZP_08384774.1| iron-sulfur cluster assembly protein IscA [Escherichia coli H299]
 gi|332278318|ref|ZP_08390731.1| FeS cluster assembly protein [Shigella sp. D9]
 gi|76365057|sp|P0AAC8|ISCA_ECOLI RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|81170858|sp|P0AAD0|ISCA_ECO57 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|81170859|sp|P0AAC9|ISCA_ECOL6 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|81170860|sp|P0AAD1|ISCA_SHIFL RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|122958129|sp|Q0TEV7|ISCA_ECOL5 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|123558995|sp|Q31XW2|ISCA_SHIBS RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|123561910|sp|Q32D36|ISCA_SHIDS RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|123616512|sp|Q3YZ24|ISCA_SHISS RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|166215526|sp|A1AE65|ISCA_ECOK1 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|189044739|sp|B1IWD3|ISCA_ECOLC RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711588|sp|B7MIL8|ISCA_ECO45 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711589|sp|B7NRH7|ISCA_ECO7I RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711590|sp|B7M7N1|ISCA_ECO8A RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711591|sp|B1XB03|ISCA_ECODH RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711592|sp|B7N6B5|ISCA_ECOLU RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711593|sp|B6I5A0|ISCA_ECOSE RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711594|sp|B1LNI4|ISCA_ECOSM RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|226711595|sp|B7LKB1|ISCA_ESCF3 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|254806049|sp|B7UGX4|ISCA_ECO27 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|254806050|sp|B7LDC0|ISCA_ECO55 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|254806051|sp|B7MYG2|ISCA_ECO81 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|259493870|sp|C4ZXA3|ISCA_ECOBW RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|12516932|gb|AAG57642.1|AE005483_1 putative regulator [Escherichia coli O157:H7 str. EDL933]
 gi|1788877|gb|AAC75581.1| FeS cluster assembly protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|1799936|dbj|BAA16422.1| FeS cluster assembly protein [Escherichia coli str. K12 substr.
           W3110]
 gi|13362865|dbj|BAB36817.1| putative iron-binding protein [Escherichia coli O157:H7 str. Sakai]
 gi|30042174|gb|AAP17899.1| putative regulator [Shigella flexneri 2a str. 2457T]
 gi|56383677|gb|AAN44074.2| putative regulator [Shigella flexneri 2a str. 301]
 gi|73856531|gb|AAZ89238.1| putative regulator [Shigella sonnei Ss046]
 gi|81242059|gb|ABB62769.1| putative regulator [Shigella dysenteriae Sd197]
 gi|81246388|gb|ABB67096.1| putative regulator [Shigella boydii Sb227]
 gi|110344285|gb|ABG70522.1| HesB family protein [Escherichia coli 536]
 gi|115513880|gb|ABJ01955.1| iron-sulfur cluster assembly protein [Escherichia coli APEC O1]
 gi|169754117|gb|ACA76816.1| iron-sulfur cluster assembly protein IscA [Escherichia coli ATCC
           8739]
 gi|169889973|gb|ACB03680.1| FeS cluster assembly protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170123893|gb|EDS92824.1| iron-sulfur cluster assembly protein IscA [Escherichia albertii
           TW07627]
 gi|170519207|gb|ACB17385.1| iron-sulfur cluster assembly protein IscA [Escherichia coli
           SMS-3-5]
 gi|189368427|gb|EDU86843.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4501]
 gi|190902269|gb|EDV62009.1| iron-sulfur cluster assembly protein IscA [Escherichia coli B7A]
 gi|190907061|gb|EDV66661.1| iron-sulfur cluster assembly protein IscA [Escherichia coli F11]
 gi|192929252|gb|EDV82861.1| iron-sulfur cluster assembly protein IscA [Escherichia coli E22]
 gi|192958266|gb|EDV88706.1| iron-sulfur cluster assembly protein IscA [Escherichia coli
           E110019]
 gi|194414593|gb|EDX30865.1| iron-sulfur cluster assembly protein IscA [Escherichia coli B171]
 gi|194423383|gb|EDX39374.1| iron-sulfur cluster assembly protein IscA [Escherichia coli 101-1]
 gi|209763258|gb|ACI79941.1| putative iron-binding protein [Escherichia coli]
 gi|209763260|gb|ACI79942.1| putative iron-binding protein [Escherichia coli]
 gi|209763262|gb|ACI79943.1| putative iron-binding protein [Escherichia coli]
 gi|209763264|gb|ACI79944.1| putative iron-binding protein [Escherichia coli]
 gi|209763266|gb|ACI79945.1| putative iron-binding protein [Escherichia coli]
 gi|209913264|dbj|BAG78338.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215265950|emb|CAS10359.1| Fe-S cluster assembly protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217320187|gb|EEC28612.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. TW14588]
 gi|218352887|emb|CAU98686.1| FeS cluster assembly protein [Escherichia coli 55989]
 gi|218355576|emb|CAQ88188.1| FeS cluster assembly protein [Escherichia fergusonii ATCC 35469]
 gi|218361821|emb|CAQ99419.1| FeS cluster assembly protein [Escherichia coli IAI1]
 gi|218366223|emb|CAR03970.1| FeS cluster assembly protein [Escherichia coli S88]
 gi|218371024|emb|CAR18851.1| FeS cluster assembly protein [Escherichia coli IAI39]
 gi|218428212|emb|CAR09128.2| FeS cluster assembly protein [Escherichia coli ED1a]
 gi|218433128|emb|CAR14024.1| FeS cluster assembly protein [Escherichia coli UMN026]
 gi|222034239|emb|CAP76980.1| Iron-binding protein iscA [Escherichia coli LF82]
 gi|226901405|gb|EEH87664.1| iron-sulfur cluster assembly protein IscA [Escherichia sp.
           3_2_53FAA]
 gi|227835914|gb|EEJ46380.1| HesB family protein [Escherichia coli 83972]
 gi|238861086|gb|ACR63084.1| FeS cluster assembly protein [Escherichia coli BW2952]
 gi|242378128|emb|CAQ32901.1| iron-sulfur cluster assembly protein [Escherichia coli BL21(DE3)]
 gi|253323620|gb|ACT28222.1| iron-sulfur cluster assembly protein IscA [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253974403|gb|ACT40074.1| iron-sulfur cluster assembly protein [Escherichia coli B str.
           REL606]
 gi|253978570|gb|ACT44240.1| iron-sulfur cluster assembly protein [Escherichia coli BL21(DE3)]
 gi|254593878|gb|ACT73239.1| FeS cluster assembly protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|257755271|dbj|BAI26773.1| FeS cluster assembly protein [Escherichia coli O26:H11 str. 11368]
 gi|257760305|dbj|BAI31802.1| FeS cluster assembly protein [Escherichia coli O103:H2 str. 12009]
 gi|257765573|dbj|BAI37068.1| FeS cluster assembly protein [Escherichia coli O111:H- str. 11128]
 gi|260448392|gb|ACX38814.1| iron-sulfur cluster assembly protein IscA [Escherichia coli DH1]
 gi|281179582|dbj|BAI55912.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|284922478|emb|CBG35565.1| iron-binding protein (iron-sulfur cluster assembly protein)
           [Escherichia coli 042]
 gi|290763626|gb|ADD57587.1| Iron-binding protein iscA [Escherichia coli O55:H7 str. CB9615]
 gi|291323711|gb|EFE63139.1| iron-sulfur cluster assembly protein IscA [Escherichia coli B088]
 gi|291428177|gb|EFF01204.1| iron-binding protein iscA [Escherichia coli FVEC1412]
 gi|291433444|gb|EFF06423.1| iron-sulfur cluster assembly protein IscA [Escherichia coli B185]
 gi|291471411|gb|EFF13895.1| iron-sulfur cluster assembly protein IscA [Escherichia coli B354]
 gi|294491932|gb|ADE90688.1| iron-sulfur cluster assembly protein IscA [Escherichia coli
           IHE3034]
 gi|298279212|gb|EFI20726.1| iron-binding protein iscA [Escherichia coli FVEC1302]
 gi|299881344|gb|EFI89555.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           196-1]
 gi|300300913|gb|EFJ57298.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           185-1]
 gi|300304029|gb|EFJ58549.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           200-1]
 gi|300314523|gb|EFJ64307.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           175-1]
 gi|300357949|gb|EFJ73819.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           198-1]
 gi|300396341|gb|EFJ79879.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           69-1]
 gi|300403753|gb|EFJ87291.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           84-1]
 gi|300408856|gb|EFJ92394.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           45-1]
 gi|300412335|gb|EFJ95645.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           115-1]
 gi|300416909|gb|EFK00220.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           182-1]
 gi|300449045|gb|EFK12665.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           116-1]
 gi|300454974|gb|EFK18467.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           21-1]
 gi|300461932|gb|EFK25425.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           187-1]
 gi|300526555|gb|EFK47624.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           119-7]
 gi|300529690|gb|EFK50752.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           107-1]
 gi|300841821|gb|EFK69581.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           124-1]
 gi|300843636|gb|EFK71396.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           78-1]
 gi|301073637|gb|EFK88443.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           146-1]
 gi|305851796|gb|EFM52248.1| iron-sulfur cluster assembly protein [Escherichia coli NC101]
 gi|306906402|gb|EFN36917.1| iron-sulfur cluster assembly protein IscA [Escherichia coli W]
 gi|307554551|gb|ADN47326.1| iron-sulfur cluster assembly protein [Escherichia coli ABU 83972]
 gi|307625917|gb|ADN70221.1| iron-sulfur cluster assembly protein [Escherichia coli UM146]
 gi|308121881|gb|EFO59143.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           145-7]
 gi|309702860|emb|CBJ02191.1| iron-binding protein (iron-sulfur cluster assembly protein)
           [Escherichia coli ETEC H10407]
 gi|310331823|gb|EFP99058.1| iron-sulfur cluster assembly protein IscA [Escherichia coli
           1827-70]
 gi|312289866|gb|EFR17754.1| iron-sulfur cluster assembly protein IscA [Escherichia coli
           2362-75]
 gi|312947105|gb|ADR27932.1| iron-sulfur cluster assembly protein [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|313651017|gb|EFS15417.1| iron-sulfur cluster assembly protein IscA [Shigella flexneri 2a
           str. 2457T]
 gi|315061847|gb|ADT76174.1| FeS cluster assembly protein [Escherichia coli W]
 gi|315256549|gb|EFU36517.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           85-1]
 gi|315288051|gb|EFU47453.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           110-3]
 gi|315292496|gb|EFU51848.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           153-1]
 gi|315300499|gb|EFU59728.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           16-3]
 gi|315615789|gb|EFU96421.1| iron-sulfur cluster assembly protein IscA [Escherichia coli 3431]
 gi|320175092|gb|EFW50205.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Shigella dysenteriae CDC 74-1112]
 gi|320180523|gb|EFW55454.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Shigella boydii ATCC 9905]
 gi|320186425|gb|EFW61155.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Shigella flexneri CDC 796-83]
 gi|320188867|gb|EFW63526.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Escherichia coli O157:H7 str. EC1212]
 gi|320196369|gb|EFW70993.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Escherichia coli WV_060327]
 gi|320200092|gb|EFW74681.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Escherichia coli EC4100B]
 gi|320640876|gb|EFX10364.1| iron-sulfur cluster assembly protein [Escherichia coli O157:H7 str.
           G5101]
 gi|320646319|gb|EFX15246.1| iron-sulfur cluster assembly protein [Escherichia coli O157:H- str.
           493-89]
 gi|320651499|gb|EFX19886.1| iron-sulfur cluster assembly protein [Escherichia coli O157:H- str.
           H 2687]
 gi|320657210|gb|EFX25019.1| iron-sulfur cluster assembly protein [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320662816|gb|EFX30148.1| iron-sulfur cluster assembly protein [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320667620|gb|EFX34535.1| iron-sulfur cluster assembly protein [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323156184|gb|EFZ42343.1| iron-sulfur cluster assembly protein IscA [Escherichia coli
           EPECa14]
 gi|323159298|gb|EFZ45284.1| iron-sulfur cluster assembly protein IscA [Escherichia coli
           E128010]
 gi|323169395|gb|EFZ55071.1| iron-sulfur cluster assembly protein IscA [Shigella sonnei 53G]
 gi|323177347|gb|EFZ62935.1| iron-sulfur cluster assembly protein IscA [Escherichia coli 1180]
 gi|323188352|gb|EFZ73644.1| iron-sulfur cluster assembly protein IscA [Escherichia coli
           RN587/1]
 gi|323377572|gb|ADX49840.1| iron-sulfur cluster assembly protein IscA [Escherichia coli KO11]
 gi|323936421|gb|EGB32711.1| iron-sulfur cluster assembly protein IscA [Escherichia coli E1520]
 gi|323941210|gb|EGB37395.1| iron-sulfur cluster assembly protein IscA [Escherichia coli E482]
 gi|323944750|gb|EGB40817.1| iron-sulfur cluster assembly protein IscA [Escherichia coli H120]
 gi|323949188|gb|EGB45079.1| iron-sulfur cluster assembly protein IscA [Escherichia coli H252]
 gi|323955769|gb|EGB51527.1| iron-sulfur cluster assembly protein IscA [Escherichia coli H263]
 gi|323961344|gb|EGB56956.1| iron-sulfur cluster assembly protein IscA [Escherichia coli H489]
 gi|323967976|gb|EGB63388.1| iron-sulfur cluster assembly protein IscA [Escherichia coli M863]
 gi|323971058|gb|EGB66306.1| iron-sulfur cluster assembly protein IscA [Escherichia coli TA007]
 gi|323977289|gb|EGB72375.1| iron-sulfur cluster assembly protein IscA [Escherichia coli
           TW10509]
 gi|324008491|gb|EGB77710.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           57-2]
 gi|324011240|gb|EGB80459.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           60-1]
 gi|324020050|gb|EGB89269.1| iron-sulfur cluster assembly protein IscA [Escherichia coli MS
           117-3]
 gi|324113022|gb|EGC06998.1| iron-sulfur cluster assembly protein IscA [Escherichia fergusonii
           B253]
 gi|324118262|gb|EGC12158.1| iron-sulfur cluster assembly protein IscA [Escherichia coli E1167]
 gi|325496439|gb|EGC94298.1| iron-sulfur cluster assembly protein [Escherichia fergusonii
           ECD227]
 gi|326340332|gb|EGD64136.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Escherichia coli O157:H7 str. 1125]
 gi|326345016|gb|EGD68760.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Escherichia coli O157:H7 str. 1044]
 gi|327252236|gb|EGE63908.1| iron-sulfur cluster assembly protein IscA [Escherichia coli
           STEC_7v]
 gi|330912304|gb|EGH40814.1| iron binding protein IscA for iron-sulfur cluster assembly
           [Escherichia coli AA86]
 gi|331039947|gb|EGI12167.1| iron-sulfur cluster assembly protein IscA [Escherichia coli H736]
 gi|331043086|gb|EGI15226.1| iron-sulfur cluster assembly protein IscA [Escherichia coli M605]
 gi|331048811|gb|EGI20887.1| iron-sulfur cluster assembly protein IscA [Escherichia coli M718]
 gi|331054341|gb|EGI26368.1| iron-sulfur cluster assembly protein IscA [Escherichia coli TA206]
 gi|331059892|gb|EGI31869.1| iron-sulfur cluster assembly protein IscA [Escherichia coli TA143]
 gi|331064470|gb|EGI36381.1| iron-sulfur cluster assembly protein IscA [Escherichia coli TA271]
 gi|331069257|gb|EGI40649.1| iron-sulfur cluster assembly protein IscA [Escherichia coli TA280]
 gi|331074981|gb|EGI46301.1| iron-sulfur cluster assembly protein IscA [Escherichia coli H591]
 gi|331079130|gb|EGI50332.1| iron-sulfur cluster assembly protein IscA [Escherichia coli H299]
 gi|332087979|gb|EGI93104.1| iron-sulfur cluster assembly protein IscA [Shigella boydii 5216-82]
 gi|332089707|gb|EGI94808.1| iron-sulfur cluster assembly protein IscA [Shigella dysenteriae
           155-74]
 gi|332092780|gb|EGI97849.1| iron-sulfur cluster assembly protein IscA [Shigella boydii 3594-74]
 gi|332100670|gb|EGJ04016.1| FeS cluster assembly protein [Shigella sp. D9]
 gi|332344403|gb|AEE57737.1| iron-sulfur cluster assembly protein IscA [Escherichia coli UMNK88]
 gi|332754060|gb|EGJ84431.1| iron-sulfur cluster assembly protein IscA [Shigella flexneri
           4343-70]
 gi|332754137|gb|EGJ84506.1| iron-sulfur cluster assembly protein IscA [Shigella flexneri K-671]
 gi|332756368|gb|EGJ86719.1| iron-sulfur cluster assembly protein IscA [Shigella flexneri
           2747-71]
 gi|333000892|gb|EGK20463.1| iron-sulfur cluster assembly protein IscA [Shigella flexneri K-218]
 gi|333016326|gb|EGK35657.1| iron-sulfur cluster assembly protein IscA [Shigella flexneri K-304]
          Length = 107

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D P   D + E  GV
Sbjct: 3   ITLSDSAAARVNTFLAN-RGKGFGLRLGVRTSGCSGMAYVLEFV-DEPTPEDIVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL ++ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV 107


>gi|195133108|ref|XP_002010981.1| GI16259 [Drosophila mojavensis]
 gi|193906956|gb|EDW05823.1| GI16259 [Drosophila mojavensis]
          Length = 130

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV RIK ++ N +    G+++ +++ GC GL Y +D  +      D+ + +DGV
Sbjct: 26  LTLTPAAVNRIKSLLQN-KPDVIGLKVGVRQRGCNGLSYTLDYASTKD-KLDEEVVQDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  +
Sbjct: 84  KVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFSM 130


>gi|145258180|ref|XP_001401965.1| iron-sulfur assembly protein 1 [Aspergillus niger CBS 513.88]
 gi|134074570|emb|CAK38863.1| unnamed protein product [Aspergillus niger]
          Length = 247

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 69/102 (67%), Gaps = 3/102 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A+ ++++++  +Q   + IR+ +K  GC+GL Y ++ V + P   D+++E+DGVKV
Sbjct: 146 LTPVAIEQLRKLL--TQPNPKLIRVGVKNRGCSGLAYHLEYV-EKPGTFDEVVEQDGVKV 202

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            IDS +L  ++G+E+D++ +KL   FVF NPN    CGCG+S
Sbjct: 203 LIDSKALFSIIGSEMDWQEDKLSRRFVFRNPNIKEQCGCGES 244


>gi|91211855|ref|YP_541841.1| iron-sulfur cluster assembly protein [Escherichia coli UTI89]
 gi|110806459|ref|YP_689979.1| iron-sulfur cluster assembly protein [Shigella flexneri 5 str.
           8401]
 gi|157156631|ref|YP_001463851.1| iron-sulfur cluster assembly protein [Escherichia coli E24377A]
 gi|157162003|ref|YP_001459321.1| iron-sulfur cluster assembly protein [Escherichia coli HS]
 gi|187732325|ref|YP_001881319.1| iron-sulfur cluster assembly protein [Shigella boydii CDC 3083-94]
 gi|187775823|ref|ZP_02992729.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4196]
 gi|188024715|ref|ZP_02997217.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4113]
 gi|188496440|ref|ZP_03003710.1| iron-sulfur cluster assembly protein IscA [Escherichia coli 53638]
 gi|189009927|ref|ZP_03006142.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4076]
 gi|189402266|ref|ZP_03006650.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4401]
 gi|189403157|ref|ZP_03006976.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4486]
 gi|189405041|ref|ZP_03007667.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC869]
 gi|189405739|ref|ZP_03007923.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC508]
 gi|194432191|ref|ZP_03064480.1| iron-sulfur cluster assembly protein IscA [Shigella dysenteriae
           1012]
 gi|208806675|ref|ZP_03249012.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4206]
 gi|208814233|ref|ZP_03255562.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4045]
 gi|208819140|ref|ZP_03259460.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4042]
 gi|209400619|ref|YP_002272003.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4115]
 gi|26109301|gb|AAN81503.1|AE016764_185 Protein yfhF [Escherichia coli CFT073]
 gi|91073429|gb|ABE08310.1| putative regulator [Escherichia coli UTI89]
 gi|110616007|gb|ABF04674.1| putative regulator [Shigella flexneri 5 str. 8401]
 gi|157067683|gb|ABV06938.1| iron-sulfur cluster assembly protein IscA [Escherichia coli HS]
 gi|157078661|gb|ABV18369.1| iron-sulfur cluster assembly protein IscA [Escherichia coli
           E24377A]
 gi|187429317|gb|ACD08591.1| iron-sulfur cluster assembly protein IscA [Shigella boydii CDC
           3083-94]
 gi|187770621|gb|EDU34465.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4196]
 gi|188017053|gb|EDU55175.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4113]
 gi|188491639|gb|EDU66742.1| iron-sulfur cluster assembly protein IscA [Escherichia coli 53638]
 gi|189003208|gb|EDU72194.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4076]
 gi|189356623|gb|EDU75042.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4401]
 gi|189362324|gb|EDU80743.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4486]
 gi|189372338|gb|EDU90754.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC869]
 gi|189378612|gb|EDU97028.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC508]
 gi|194419720|gb|EDX35800.1| iron-sulfur cluster assembly protein IscA [Shigella dysenteriae
           1012]
 gi|208726476|gb|EDZ76077.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4206]
 gi|208735510|gb|EDZ84197.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4045]
 gi|208739263|gb|EDZ86945.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4042]
 gi|209162019|gb|ACI39452.1| iron-sulfur cluster assembly protein IscA [Escherichia coli O157:H7
           str. EC4115]
 gi|281601931|gb|ADA74915.1| Iron-binding protein iscA [Shigella flexneri 2002017]
 gi|315137152|dbj|BAJ44311.1| iron-sulfur cluster assembly protein [Escherichia coli DH1]
          Length = 109

 Score = 85.9 bits (211), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D P   D + E  GV
Sbjct: 5   ITLSDSAAARVNTFLAN-RGKGFGLRLGVRTSGCSGMAYVLEFV-DEPTPEDIVFEDKGV 62

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL ++ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 63  KVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV 109


>gi|312796713|ref|YP_004029635.1| iron-sulphur cluster assembly protein IscA [Burkholderia
           rhizoxinica HKI 454]
 gi|312168488|emb|CBW75491.1| Iron-sulphur cluster assembly protein IscA [Burkholderia
           rhizoxinica HKI 454]
          Length = 107

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 68/108 (62%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDG 63
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V  + +DG D++ E  G
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGIGLRLGVRTTGCSGLAYKLEYV--DELDGGDMVFESHG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 60  IKVIVDPKSLAYIDGTELDFAREGLNEGFRFNNPNVKDECGCGESFRV 107


>gi|170741743|ref|YP_001770398.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           sp. 4-46]
 gi|168196017|gb|ACA17964.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           sp. 4-46]
          Length = 106

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++T+ AV  +K  +  + G   G+RI ++ GGCAG +YM+ L   +  DGD ++E+DG
Sbjct: 1   MISLTDNAVTAVKTALSQAPGTPTGLRIMVEAGGCAGYKYMMGL-ESSARDGDLVVEQDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           V++++D  S   + G  IDF T    SGFVF NPN  + C CG+S
Sbjct: 60  VRLFVDGRSQSLVSGLRIDFVTALETSGFVFENPNAGAKCACGKS 104


>gi|238784225|ref|ZP_04628238.1| Iron-binding protein iscA [Yersinia bercovieri ATCC 43970]
 gi|238796773|ref|ZP_04640279.1| Iron-binding protein iscA [Yersinia mollaretii ATCC 43969]
 gi|238714934|gb|EEQ06933.1| Iron-binding protein iscA [Yersinia bercovieri ATCC 43970]
 gi|238719504|gb|EEQ11314.1| Iron-binding protein iscA [Yersinia mollaretii ATCC 43969]
          Length = 107

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++++A  R+   + + +GK  G+R+ ++  GC+G+ Y+++ V D   D D + E  GV
Sbjct: 3   ISISDSAAQRVSAFL-SHRGKGLGLRLGVRTSGCSGMAYVLEFV-DEMNDDDIVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  S++Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  KVIIDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGESFNV 107


>gi|194289265|ref|YP_002005172.1| Fe-S cluster assembly and activation factor [Cupriavidus
           taiwanensis LMG 19424]
 gi|193223100|emb|CAQ69105.1| Fe-S cluster assembly and activation factor [Cupriavidus
           taiwanensis LMG 19424]
          Length = 106

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 66/108 (61%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMTE A   +   +   +GK  G+R+ +K  GC+GL Y ++ V D  +  D++ E  G
Sbjct: 1   MITMTEKAAKHVARYL-ERRGKGVGLRLGVKTTGCSGLAYKLEYV-DELLPEDNVFESHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +KV +D+ SL Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 59  IKVIVDAKSLPYIDGTELDYAREGLNEGFRFNNPNVKDECGCGESFTV 106


>gi|299770355|ref|YP_003732381.1| iron-sulfur cluster assembly protein IscA [Acinetobacter sp. DR1]
 gi|298700443|gb|ADI91008.1| iron-sulfur cluster assembly protein IscA [Acinetobacter sp. DR1]
          Length = 106

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 69/108 (63%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V D+  + D++ E+ G
Sbjct: 1   MIHLTENAATHISNYLKN-RGKGEGIRVGVKTSGCSGLAYVLEFV-DSVDEHDEVFEQFG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  S +Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSHVYLEGLEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|186476214|ref|YP_001857684.1| iron-sulfur cluster assembly protein IscA [Burkholderia phymatum
           STM815]
 gi|184192673|gb|ACC70638.1| iron-sulfur cluster assembly protein IscA [Burkholderia phymatum
           STM815]
          Length = 118

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D++ E +GV
Sbjct: 14  ITLTEKAAQHVQKYL-TRRGKGVGLRLGVRTTGCSGLAYKLEYV-DELAPEDEVFECNGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 72  KIVVDPKSLAYIDGTELDFAREGLNEGFRFNNPNVKDECGCGESFRV 118


>gi|68448477|ref|NP_001020349.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Danio rerio]
 gi|81170637|sp|Q4QRC6|ISCA1_DANRE RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|67678098|gb|AAH97234.1| Zgc:114185 [Danio rerio]
          Length = 129

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV ++K+++ N + +  G+++ ++  GC GL Y +D  T N    D+ + +DGV
Sbjct: 25  LTLTPSAVNKVKQLLDN-KPEYIGLKVGVRTRGCNGLTYTLDY-TKNKEQSDEEVLQDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  I
Sbjct: 83  RVFIEKKAQLTLLGTEMDFVETKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|312080094|ref|XP_003142454.1| hypothetical protein LOAG_06870 [Loa loa]
 gi|307762383|gb|EFO21617.1| hypothetical protein LOAG_06870 [Loa loa]
          Length = 131

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 66/105 (62%), Gaps = 2/105 (1%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  AV R+K  + + Q +   ++IS+++ GC GL Y +D    +    D+ + +DGV++
Sbjct: 29  LTPEAVKRVK-YLLSKQPETAALKISVRQRGCNGLTYTLDYA-QHKAKFDEEVVQDGVRL 86

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           WID  + L +LG+E+D+  ++L S FVF NPN  S CGCG+S  I
Sbjct: 87  WIDPKAQLTLLGSEMDYVEDRLSSEFVFRNPNIKSTCGCGESFSI 131


>gi|94309972|ref|YP_583182.1| iron-sulfur cluster assembly protein IscA [Cupriavidus
           metallidurans CH34]
 gi|93353824|gb|ABF07913.1| FeS cluster assembly protein [Cupriavidus metallidurans CH34]
          Length = 113

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 65/110 (59%), Gaps = 2/110 (1%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           + +++MTE A   +   +   +GK  G+R+ +K  GC+GL Y ++ V D  +  D + E 
Sbjct: 6   AKMISMTEKAAKHVARYL-ERRGKGVGLRVGVKTTGCSGLAYKLEYV-DEVLPEDQVFET 63

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            G+KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 64  HGIKVIVDPKSLPYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 113


>gi|167586744|ref|ZP_02379132.1| iron-sulfur cluster assembly protein IscA [Burkholderia ubonensis
           Bu]
          Length = 107

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D+    D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYLVR-RGKGLGLRLGVRTTGCSGLAYKLEYV-DDLAPEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|170694741|ref|ZP_02885892.1| iron-sulfur cluster assembly protein IscA [Burkholderia graminis
           C4D1M]
 gi|170140372|gb|EDT08549.1| iron-sulfur cluster assembly protein IscA [Burkholderia graminis
           C4D1M]
          Length = 107

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D++ E +GV
Sbjct: 3   ITLTEKAAQHVQKYLIR-RGKGVGLRLGVRTTGCSGLAYKLEYV-DELAPEDEVFECNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|148284615|ref|YP_001248705.1| iron-sulfur cluster assembly accessory protein [Orientia
           tsutsugamushi str. Boryong]
 gi|146740054|emb|CAM80170.1| iron-sulfur cluster assembly accessory protein [Orientia
           tsutsugamushi str. Boryong]
          Length = 124

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 66/106 (62%), Gaps = 1/106 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++  A  RIKE++   +  + GI++ +K GGC+G  Y ++   D   D D++I   G
Sbjct: 18  VITISSRAAKRIKELLAKREKPSLGIKVGIKTGGCSGYSYYIEY-ADVKGDFDEVIIDKG 76

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           V V +D  ++LY++GT +D+   K  SGF F NPN+ + CGCG+S 
Sbjct: 77  VTVLVDQKAILYLVGTTMDYIEGKFNSGFEFSNPNEKNRCGCGKSA 122


>gi|46138745|ref|XP_391063.1| hypothetical protein FG10887.1 [Gibberella zeae PH-1]
          Length = 239

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 68/102 (66%), Gaps = 3/102 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T +AV +++E++   Q + + I++ ++  GC+GL Y ++ V D P   D+ +E+DGVKV
Sbjct: 138 LTPSAVEQLRELL--DQPEPKLIKVGVRNRGCSGLAYHLEYV-DKPGAFDETVEQDGVKV 194

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            IDS +L  ++G+E+D+  +KL   FVF NPN    CGCG+S
Sbjct: 195 LIDSKALFSIIGSEMDYVEDKLNQRFVFKNPNIKEECGCGES 236


>gi|110634166|ref|YP_674374.1| iron-sulfur cluster assembly accessory protein [Mesorhizobium sp.
           BNC1]
 gi|110285150|gb|ABG63209.1| iron-sulfur cluster assembly accessory protein [Chelativorans sp.
           BNC1]
          Length = 116

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AA  RI +I+     K   +R+S++ GGC+G  Y  DLV D+  D D +IEKDG 
Sbjct: 12  IELTDAAARRIVKILAAEPDKT-ALRVSIEGGGCSGFSYKFDLV-DSRNDDDLVIEKDGA 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V ID  SL+YM G+ IDF  + +   F   NPN V++CGCG S  I
Sbjct: 70  TVLIDDLSLVYMGGSVIDFVDDLIGQSFQIRNPNAVASCGCGTSFSI 116


>gi|225076508|ref|ZP_03719707.1| hypothetical protein NEIFLAOT_01554 [Neisseria flavescens
           NRL30031/H210]
 gi|261380299|ref|ZP_05984872.1| iron-sulfur cluster assembly protein IscA [Neisseria subflava
           NJ9703]
 gi|224952187|gb|EEG33396.1| hypothetical protein NEIFLAOT_01554 [Neisseria flavescens
           NRL30031/H210]
 gi|284796812|gb|EFC52159.1| iron-sulfur cluster assembly protein IscA [Neisseria subflava
           NJ9703]
          Length = 106

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 68/109 (62%), Gaps = 4/109 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKD 62
           ++T+TE A   I   +   +GK  G+R+ +K  GC+G+ Y ++ V +   + DDLI E+ 
Sbjct: 1   MITITENAAKYINNYL-TKRGKGLGVRLGVKTSGCSGMAYNLEFVDE--ANEDDLIFEEH 57

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 58  GARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|221198429|ref|ZP_03571475.1| iron-sulfur cluster assembly protein IscA [Burkholderia multivorans
           CGD2M]
 gi|221208894|ref|ZP_03581891.1| iron-sulfur cluster assembly protein IscA [Burkholderia multivorans
           CGD2]
 gi|221214775|ref|ZP_03587744.1| iron-sulfur cluster assembly protein IscA [Burkholderia multivorans
           CGD1]
 gi|221165314|gb|EED97791.1| iron-sulfur cluster assembly protein IscA [Burkholderia multivorans
           CGD1]
 gi|221171177|gb|EEE03627.1| iron-sulfur cluster assembly protein IscA [Burkholderia multivorans
           CGD2]
 gi|221182361|gb|EEE14762.1| iron-sulfur cluster assembly protein IscA [Burkholderia multivorans
           CGD2M]
          Length = 117

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 13  ITLTEKAAQHVQKYLVR-RGKGLGLRLGVRTTGCSGLAYKLEYV-DELAPEDQVFESHGV 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 71  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 117


>gi|333003805|gb|EGK23341.1| feS assembly scaffold SufA [Shigella flexneri VA-6]
          Length = 122

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 18  LTLTPAAAIHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   S+ ++ GTEIDF  E L   F FHNP   + CGCG+S  +
Sbjct: 76  KLFVPLQSMPFIDGTEIDFVREGLNQIFKFHNPKAQNECGCGESFRV 122


>gi|107028696|ref|YP_625791.1| iron-sulfur cluster assembly protein IscA [Burkholderia cenocepacia
           AU 1054]
 gi|105897860|gb|ABF80818.1| iron-sulfur cluster assembly protein IscA [Burkholderia cenocepacia
           AU 1054]
          Length = 107

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D+    D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYLVR-RGKGVGLRLGVRTTGCSGLAYKLEYV-DDLAPEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|116690145|ref|YP_835768.1| iron-sulfur cluster assembly protein IscA [Burkholderia cenocepacia
           HI2424]
 gi|170733477|ref|YP_001765424.1| iron-sulfur cluster assembly protein IscA [Burkholderia cenocepacia
           MC0-3]
 gi|254247785|ref|ZP_04941106.1| HesB/YadR/YfhF [Burkholderia cenocepacia PC184]
 gi|116648234|gb|ABK08875.1| iron-sulfur cluster assembly protein IscA [Burkholderia cenocepacia
           HI2424]
 gi|124872561|gb|EAY64277.1| HesB/YadR/YfhF [Burkholderia cenocepacia PC184]
 gi|169816719|gb|ACA91302.1| iron-sulfur cluster assembly protein IscA [Burkholderia cenocepacia
           MC0-3]
          Length = 115

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D   + D + E  GV
Sbjct: 11  ITLTEKAAQHVQKYLVR-RGKGVGLRLGVRTTGCSGLAYKLEYVDDLAPE-DQVFESHGV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 69  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 115


>gi|195396973|ref|XP_002057103.1| GJ16900 [Drosophila virilis]
 gi|194146870|gb|EDW62589.1| GJ16900 [Drosophila virilis]
          Length = 130

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 66/104 (63%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV RIK +    + +  G+++ +++ GC GL Y +D  +      D+ + +DGV
Sbjct: 26  LTLTPAAVQRIKSL-LQDKPEVIGLKVGVRQRGCNGLSYTLDYASTKD-KLDEEVVQDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S
Sbjct: 84  KVFIDKKAQLSLLGTEMDFVESKLTSEFVFNNPNIKGTCGCGES 127


>gi|261377483|ref|ZP_05982056.1| iron-sulfur cluster assembly protein IscA [Neisseria cinerea ATCC
           14685]
 gi|269146212|gb|EEZ72630.1| iron-sulfur cluster assembly protein IscA [Neisseria cinerea ATCC
           14685]
          Length = 106

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 68/109 (62%), Gaps = 4/109 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKD 62
           ++T+TE A   I   +   +GK  G+R+ +K  GC+G+ Y ++ V +   + DDLI E+ 
Sbjct: 1   MITITENAAKYINNYL-TRRGKGLGVRLGVKTSGCSGMAYNLEFVDE--ANEDDLIFEEH 57

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 58  GARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|163843146|ref|YP_001627550.1| iron-sulfur cluster assembly accessory protein [Brucella suis ATCC
           23445]
 gi|163673869|gb|ABY37980.1| iron-sulfur cluster assembly accessory protein [Brucella suis ATCC
           23445]
          Length = 108

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  RI +I+ +  GK   +R+S++ GGC+G  Y  DLV D   + D +IEK G 
Sbjct: 4   ITVSDSAARRIAKILDSEPGKT-ALRVSVEGGGCSGFSYKYDLV-DAQTEDDIVIEKLGA 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V IDS S+ YM G+EIDF  + +   F   NPN  ++CGCG S  I
Sbjct: 62  RVLIDSISVPYMNGSEIDFVDDLMGQSFQIRNPNATASCGCGTSFAI 108


>gi|255066431|ref|ZP_05318286.1| iron-sulfur cluster assembly protein IscA [Neisseria sicca ATCC
           29256]
 gi|255049311|gb|EET44775.1| iron-sulfur cluster assembly protein IscA [Neisseria sicca ATCC
           29256]
          Length = 106

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 68/109 (62%), Gaps = 4/109 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKD 62
           ++T+TE A   I   +   +GK  G+R+ +K  GC+G+ Y ++ V  +  + DDL+ E+ 
Sbjct: 1   MITITENAAKYINSYL-TKRGKGLGVRLGVKTSGCSGMAYNLEFV--DEANEDDLVFEEH 57

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +V+ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 58  GARVYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|225559955|gb|EEH08237.1| iron-sulfur assembly protein 1 [Ajellomyces capsulatus G186AR]
          Length = 123

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 59/84 (70%), Gaps = 1/84 (1%)

Query: 25  KAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEIDFK 84
           +AQ +R+ +K  GC+GL Y ++ V D P   D+++E+DGVK+ IDS +L  ++GTE+D++
Sbjct: 38  EAQLVRVGVKNRGCSGLSYHLEYV-DKPAPFDEVVEQDGVKILIDSKALFSIIGTEMDWQ 96

Query: 85  TEKLYSGFVFHNPNQVSACGCGQS 108
            + L S FVF NPN    CGCG+S
Sbjct: 97  EDSLASRFVFKNPNIKDQCGCGES 120


>gi|189200376|ref|XP_001936525.1| iron sulfur assembly protein 1 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187983624|gb|EDU49112.1| iron sulfur assembly protein 1 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 196

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 68/107 (63%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + ++ +AV  ++E++   + K   IRI  K  GC+GL Y ++ V D P   D+ +E+DGV
Sbjct: 92  IKLSPSAVAHLRELLELPEPKL--IRIGTKAKGCSGLAYHLEYV-DKPSPLDEQVEQDGV 148

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID+ +LL ++G+E+D+  +KL   F+F NPN    CGCG+S  +
Sbjct: 149 KVLIDNKALLNIIGSEMDWLEDKLNERFIFKNPNITEQCGCGESFSV 195


>gi|156932921|ref|YP_001436837.1| iron-sulfur cluster assembly protein [Cronobacter sakazakii ATCC
           BAA-894]
 gi|166215527|sp|A7MGY0|ISCA_ENTS8 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|156531175|gb|ABU76001.1| hypothetical protein ESA_00724 [Cronobacter sakazakii ATCC BAA-894]
          Length = 107

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+++ A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D P   D + E  GV
Sbjct: 3   ITLSDTAAARVNAFLAN-RGKGFGLRLGVRTSGCSGMAYVLEFV-DAPQPEDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL ++ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVVVDGKSLQFLNGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFNV 107


>gi|121601807|ref|YP_989048.1| iron-sulfur cluster assembly accessory protein [Bartonella
           bacilliformis KC583]
 gi|120613984|gb|ABM44585.1| iron-sulfur cluster assembly accessory protein [Bartonella
           bacilliformis KC583]
          Length = 107

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++++ A  RI +I+ N   K   +RIS++ GGC+G  Y  DLV+    D D +I+K G 
Sbjct: 3   VSVSDFAAERIAKILSNEPNKI-ALRISVEGGGCSGFSYKYDLVSTRKED-DFVIQKGGA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            ++IDS SL +M G +IDF  + +   F  HNPN VS+CGCG S  I
Sbjct: 61  VIFIDSISLSFMKGAQIDFVDDLMEQSFQIHNPNAVSSCGCGVSFSI 107


>gi|319794402|ref|YP_004156042.1| iron-sulfur cluster assembly protein isca [Variovorax paradoxus
           EPS]
 gi|315596865|gb|ADU37931.1| iron-sulfur cluster assembly protein IscA [Variovorax paradoxus
           EPS]
          Length = 107

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TEAA   +   +   +GK  G+R+ +K  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   VTLTEAAARHVTRYL-GKRGKGVGVRLGVKTTGCSGLAYKLEYV-DEFTPEDVVFEDHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GT++DF  E L  GF F NPN+   CGCG+S  I
Sbjct: 61  KVLVDPKSLAYIDGTQLDFVREGLNEGFKFINPNERDRCGCGESFRI 107


>gi|332374118|gb|AEE62200.1| unknown [Dendroctonus ponderosae]
          Length = 129

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV R+KE++   +    G++I +++ GC GL Y ++   D     D+ + +DGV
Sbjct: 25  LTLTPAAVGRVKELL-KDKSDYVGLKIGVRQRGCNGLSYTLEYA-DKKEKLDEEVVQDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  +
Sbjct: 83  RVFIDKKAQLTLLGTEMDFVENKLSSEFVFNNPNIKGTCGCGESFSV 129


>gi|332526734|ref|ZP_08402836.1| iron-sulfur cluster assembly protein IscA [Rubrivivax
           benzoatilyticus JA2]
 gi|332111137|gb|EGJ11169.1| iron-sulfur cluster assembly protein IscA [Rubrivivax
           benzoatilyticus JA2]
          Length = 107

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 65/108 (60%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDG 63
           +T+TEAA   +   +   +GK  G+R+ +K  GC+GL Y ++    + V  +D++ E  G
Sbjct: 3   ITLTEAAARHVTRYL-GRRGKGVGVRLGVKTTGCSGLAYKLEYA--DEVGAEDIVFEDHG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV +D  SL Y+ GT++DF  E L  GF FHNP +   CGCG+S  +
Sbjct: 60  VKVLVDPKSLPYLDGTQLDFVREGLNEGFKFHNPRERDRCGCGESFRV 107


>gi|262376141|ref|ZP_06069371.1| iron-sulfur cluster assembly protein IscA [Acinetobacter lwoffii
           SH145]
 gi|262308742|gb|EEY89875.1| iron-sulfur cluster assembly protein IscA [Acinetobacter lwoffii
           SH145]
          Length = 106

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 66/108 (61%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V D     D   E+ G
Sbjct: 1   MIHLTENAATHISNYLKN-RGKGEGIRVGVKTSGCSGLAYVLEFV-DEVDTHDQAFEQFG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLEGMEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|118104133|ref|XP_001231752.1| PREDICTED: hypothetical protein [Gallus gallus]
 gi|81170638|sp|Q5ZJ74|ISCA1_CHICK RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|53133780|emb|CAG32219.1| hypothetical protein RCJMB04_20e4 [Gallus gallus]
          Length = 129

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK++    Q +  G+++ ++  GC GL Y ++  T +  D D+ + +DGV
Sbjct: 25  LTLTPSAVQKIKQL-LKDQPEHVGVKVGVRTRGCNGLSYTLEY-TKSKGDSDEEVVQDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|220918722|ref|YP_002494026.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219956576|gb|ACL66960.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 127

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 64/108 (59%), Gaps = 1/108 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           + + V++T  A+  +K+ +        GIR+ +  GGCAG +Y +D   D P DGD  +E
Sbjct: 18  IPNFVSLTSKAIEMVKDAIAREGLAGYGIRVGVMGGGCAGFQYSMDFEKD-PRDGDLSLE 76

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +DG+K+++D  S +Y+ G  ID+      +GF F+NPN  + CGCG S
Sbjct: 77  QDGIKLYVDPMSSMYLQGVTIDYVVGLQGAGFKFNNPNARTTCGCGSS 124


>gi|197123953|ref|YP_002135904.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           sp. K]
 gi|196173802|gb|ACG74775.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           sp. K]
          Length = 127

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 64/108 (59%), Gaps = 1/108 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           + + V++T  A+  +K+ +        GIR+ +  GGCAG +Y +D   D P DGD  +E
Sbjct: 18  IPNFVSLTSKAIEMVKDAIAREGLAGYGIRVGVMGGGCAGFQYSMDFEKD-PRDGDLSLE 76

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +DG+K+++D  S +Y+ G  ID+      +GF F+NPN  + CGCG S
Sbjct: 77  QDGIKLYVDPMSSMYLQGVTIDYVVGLQGAGFKFNNPNARTTCGCGSS 124


>gi|57864885|gb|AAW57059.1| HesB protein [cyanobacterium endosymbiont of Rhopalodia gibba]
          Length = 119

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 61/108 (56%), Gaps = 1/108 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++TE A +R++  +     K  GIR+ +K GGC G EY ++LV   P D D   E++ V
Sbjct: 3   VSLTEKAAFRLRTFLEEKGSKVTGIRVGIKDGGCGGHEYTLNLV-KQPDDQDMFFEQENV 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
            ++++S S   + G  IDF      SGF+F NPN    CGCG+S   +
Sbjct: 62  PIYVNSQSFPLLKGVVIDFVDSLTQSGFIFTNPNAGDTCGCGKSFSSR 109


>gi|162660694|gb|EDQ48493.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 98

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 57/92 (61%), Gaps = 1/92 (1%)

Query: 20  FNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGT 79
            + +GK  G+R+ +K  GC+GL Y ++ V D  +  D + E  G+KV +D  SL Y+ GT
Sbjct: 8   LSRRGKGIGVRLGVKTTGCSGLAYKLEYV-DEQLPEDVIFEDHGIKVLVDPKSLAYIDGT 66

Query: 80  EIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           E+DF  E L  GF FHNPN+   CGCG+S  I
Sbjct: 67  ELDFVREGLNEGFKFHNPNERDRCGCGESFRI 98


>gi|209519992|ref|ZP_03268771.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp. H160]
 gi|209499589|gb|EDZ99665.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp. H160]
          Length = 107

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGIGLRVGVRTTGCSGLAYKLEYV-DEVAAEDQVFETSGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|239815135|ref|YP_002944045.1| iron-sulfur cluster assembly protein IscA [Variovorax paradoxus
           S110]
 gi|239801712|gb|ACS18779.1| iron-sulfur cluster assembly protein IscA [Variovorax paradoxus
           S110]
          Length = 107

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TEAA   +   +   +GK  G+R+ +K  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   VTLTEAAARHVTRYL-GKRGKGVGVRLGVKTTGCSGLAYKLEYV-DEFAPEDVVFEDHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GT++DF  E L  GF F NPN+   CGCG+S  I
Sbjct: 61  KVLVDPKSLAYIDGTQLDFVREGLNEGFKFINPNERDRCGCGESFRI 107


>gi|124267447|ref|YP_001021451.1| hypothetical protein Mpe_A2260 [Methylibium petroleiphilum PM1]
 gi|124260222|gb|ABM95216.1| conserved hypothetical protein [Methylibium petroleiphilum PM1]
          Length = 107

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T AA   +   +   +GK  G+R+ +K  GC+GL Y ++   D     D + E  GV
Sbjct: 3   VTLTPAAARHVTRYL-GKRGKGVGVRLGVKTTGCSGLAYKLEYA-DEAAPEDVIFEDQGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GT++DF  E L  GF F+NPN+   CGCG+S  I
Sbjct: 61  KVLVDPKSLPYIEGTQLDFVREGLNEGFKFNNPNERDRCGCGESFRI 107


>gi|295401374|ref|ZP_06811345.1| iron-sulfur cluster assembly accessory protein [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312109666|ref|YP_003987982.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           Y4.1MC1]
 gi|294976589|gb|EFG52196.1| iron-sulfur cluster assembly accessory protein [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311214767|gb|ADP73371.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           Y4.1MC1]
          Length = 120

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 66/108 (61%), Gaps = 1/108 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+DIVT+TEAA ++IK+++   + +   +RI ++ GGC+GL Y +    +   D D   E
Sbjct: 1   MTDIVTLTEAAAFQIKDMMKEHEEEGAYLRIGVRGGGCSGLSYGMGFDHERHED-DHEFE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           + G+K+ +D  S   + GT ID+K   +  GF  +NPN ++ CGCG S
Sbjct: 60  QHGIKILVDKDSAPILQGTVIDYKQSLMGGGFTINNPNAIATCGCGSS 107


>gi|298705983|emb|CBJ29104.1| iron-sulfur assembly protein [Ectocarpus siliculosus]
          Length = 175

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 67/111 (60%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGI--RISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           M  IV +   A+  ++E+   SQG    I  R+ ++ GGC+GL Y++DLV    +  DD+
Sbjct: 63  MEKIVNIRPKAMDHLQELR-RSQGTEGDIFLRMGVRSGGCSGLSYIMDLVKKEEITEDDM 121

Query: 59  IEK-DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +E+ DG K  ID  S+LY+ G E+DF    +  GF F NPN  S+CGCG+S
Sbjct: 122 VEEYDGFKCVIDPKSVLYLYGLELDFSDALIGGGFQFQNPNAESSCGCGKS 172


>gi|225711762|gb|ACO11727.1| Iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Caligus rogercresseyi]
          Length = 135

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 65/105 (61%), Gaps = 2/105 (1%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           MT  AV+R+KE+V + + +   +RI +++ GC G+ Y +D         D+ + +DGVK+
Sbjct: 33  MTPTAVHRVKELV-DERSECIALRIGVRQRGCNGMSYTLDYAVAEE-KHDEEVNQDGVKI 90

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +ID  + L +LGTE+D+    L S FVF+NPN    CGCG+S  I
Sbjct: 91  FIDKKAQLSILGTEMDYVDSNLSSEFVFNNPNIKGTCGCGESFSI 135


>gi|225710790|gb|ACO11241.1| Iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Caligus rogercresseyi]
          Length = 135

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 65/105 (61%), Gaps = 2/105 (1%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           MT  AV+R+KE+V + + +   +RI +++ GC G+ Y +D         D+ + +DGVK+
Sbjct: 33  MTPTAVHRVKELV-DERSECIALRIGVRQRGCNGMSYTLDYAVAKE-KHDEEVNQDGVKI 90

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +ID  + L +LGTE+D+    L S FVF+NPN    CGCG+S  I
Sbjct: 91  FIDKKAQLSILGTEMDYVDSNLSSEFVFNNPNIKGTCGCGESFSI 135


>gi|225025119|ref|ZP_03714311.1| hypothetical protein EIKCOROL_02011 [Eikenella corrodens ATCC
           23834]
 gi|224942080|gb|EEG23289.1| hypothetical protein EIKCOROL_02011 [Eikenella corrodens ATCC
           23834]
          Length = 106

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T  A   I+  +   +GK +GIRI +K  GC+G+ Y ++   D  +  D + E  G
Sbjct: 1   MITLTPNAADHIRSFL-TKRGKGEGIRIGVKTSGCSGMAYTLEFA-DEILPDDLVFEGHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV +D  S +Y+ GTE+DF  E L  GF F NPN  + CGCG+S  +
Sbjct: 59  VKVLVDPKSHVYLDGTELDFTKEGLQEGFKFANPNVKNECGCGESFNV 106


>gi|332528390|ref|ZP_08404384.1| iron-sulfur cluster assembly protein IscA [Hylemonella gracilis
           ATCC 19624]
 gi|332042153|gb|EGI78485.1| iron-sulfur cluster assembly protein IscA [Hylemonella gracilis
           ATCC 19624]
          Length = 107

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE+A   +   + + +GK  G+R+ +K  GC+GL Y ++ V D+    D + E  GV
Sbjct: 3   VTLTESAARHVSRYL-SKRGKGVGVRLGVKTTGCSGLAYKLEYV-DDVAPEDIVFEGHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GT++D+  E L  GF F+NPN+   CGCG+S  +
Sbjct: 61  KVLIDPKSLSYIDGTQLDYVREGLNEGFKFNNPNERDRCGCGESFRV 107


>gi|17987374|ref|NP_540008.1| HESB protein [Brucella melitensis bv. 1 str. 16M]
 gi|23501761|ref|NP_697888.1| HesB/YadR/YfhF family protein [Brucella suis 1330]
 gi|62289820|ref|YP_221613.1| HesB/YadR/YfhF family protein [Brucella abortus bv. 1 str. 9-941]
 gi|82699745|ref|YP_414319.1| hypothetical protein BAB1_0894 [Brucella melitensis biovar Abortus
           2308]
 gi|148559334|ref|YP_001258849.1| HesB/YadR/YfhF family protein [Brucella ovis ATCC 25840]
 gi|161618835|ref|YP_001592722.1| iron-sulfur cluster assembly accessory protein [Brucella canis ATCC
           23365]
 gi|189024061|ref|YP_001934829.1| hypothetical protein BAbS19_I08340 [Brucella abortus S19]
 gi|225627363|ref|ZP_03785400.1| iron-sulfur cluster assembly accessory protein [Brucella ceti str.
           Cudo]
 gi|225852387|ref|YP_002732620.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           ATCC 23457]
 gi|237815305|ref|ZP_04594303.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           str. 2308 A]
 gi|254689125|ref|ZP_05152379.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 6 str. 870]
 gi|254693608|ref|ZP_05155436.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 3 str. Tulya]
 gi|254697258|ref|ZP_05159086.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254701639|ref|ZP_05163467.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 5
           str. 513]
 gi|254704182|ref|ZP_05166010.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 3
           str. 686]
 gi|254706915|ref|ZP_05168743.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis M163/99/10]
 gi|254709977|ref|ZP_05171788.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis B2/94]
 gi|254713977|ref|ZP_05175788.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M644/93/1]
 gi|254716964|ref|ZP_05178775.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M13/05/1]
 gi|254718979|ref|ZP_05180790.1| iron-sulfur cluster assembly accessory protein [Brucella sp. 83/13]
 gi|254730157|ref|ZP_05188735.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 4 str. 292]
 gi|256031470|ref|ZP_05445084.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis M292/94/1]
 gi|256044548|ref|ZP_05447452.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256060980|ref|ZP_05451138.1| iron-sulfur cluster assembly accessory protein [Brucella neotomae
           5K33]
 gi|256113413|ref|ZP_05454262.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|256159596|ref|ZP_05457358.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M490/95/1]
 gi|256254876|ref|ZP_05460412.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           B1/94]
 gi|256257374|ref|ZP_05462910.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 9 str. C68]
 gi|256264115|ref|ZP_05466647.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 2 str. 63/9]
 gi|256369303|ref|YP_003106811.1| HesB/YadR/YfhF family protein [Brucella microti CCM 4915]
 gi|260168604|ref|ZP_05755415.1| HesB/YadR/YfhF family protein [Brucella sp. F5/99]
 gi|260545433|ref|ZP_05821174.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           NCTC 8038]
 gi|260563901|ref|ZP_05834387.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 1 str. 16M]
 gi|260566568|ref|ZP_05837038.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 4
           str. 40]
 gi|260754624|ref|ZP_05866972.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 6 str. 870]
 gi|260757847|ref|ZP_05870195.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 4 str. 292]
 gi|260761670|ref|ZP_05874013.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260883651|ref|ZP_05895265.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 9 str. C68]
 gi|261213874|ref|ZP_05928155.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 3 str. Tulya]
 gi|261218769|ref|ZP_05933050.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M13/05/1]
 gi|261222060|ref|ZP_05936341.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           B1/94]
 gi|261314379|ref|ZP_05953576.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis M163/99/10]
 gi|261317525|ref|ZP_05956722.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis B2/94]
 gi|261321732|ref|ZP_05960929.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M644/93/1]
 gi|261324982|ref|ZP_05964179.1| iron-sulfur cluster assembly accessory protein [Brucella neotomae
           5K33]
 gi|261752192|ref|ZP_05995901.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 5
           str. 513]
 gi|261754851|ref|ZP_05998560.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 3
           str. 686]
 gi|261758078|ref|ZP_06001787.1| iron-sulfur cluster assembly accessory protein [Brucella sp. F5/99]
 gi|265983969|ref|ZP_06096704.1| iron-sulfur cluster assembly accessory protein [Brucella sp. 83/13]
 gi|265988560|ref|ZP_06101117.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis M292/94/1]
 gi|265990974|ref|ZP_06103531.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|265994811|ref|ZP_06107368.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|265998025|ref|ZP_06110582.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M490/95/1]
 gi|294852227|ref|ZP_06792900.1| HesB/YadR/YfhF family protein [Brucella sp. NVSL 07-0026]
 gi|297248224|ref|ZP_06931942.1| HesB/YadR/YfhF family protein [Brucella abortus bv. 5 str. B3196]
 gi|306837327|ref|ZP_07470208.1| iron-sulfur cluster assembly accessory protein [Brucella sp. NF
           2653]
 gi|306840367|ref|ZP_07473134.1| iron-sulfur cluster assembly accessory protein [Brucella sp. BO2]
 gi|306843772|ref|ZP_07476370.1| iron-sulfur cluster assembly accessory protein [Brucella sp. BO1]
 gi|17983061|gb|AAL52272.1| hesb protein [Brucella melitensis bv. 1 str. 16M]
 gi|23347689|gb|AAN29803.1| HesB/YadR/YfhF family protein [Brucella suis 1330]
 gi|62195952|gb|AAX74252.1| HesB/YadR/YfhF family protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615846|emb|CAJ10850.1| Protein of unknown function, HesB/YadR/YfhF [Brucella melitensis
           biovar Abortus 2308]
 gi|148370591|gb|ABQ60570.1| HesB/YadR/YfhF family protein [Brucella ovis ATCC 25840]
 gi|161335646|gb|ABX61951.1| iron-sulfur cluster assembly accessory protein [Brucella canis ATCC
           23365]
 gi|189019633|gb|ACD72355.1| Protein of unknown function, HesB/YadR/YfhF [Brucella abortus S19]
 gi|225617368|gb|EEH14413.1| iron-sulfur cluster assembly accessory protein [Brucella ceti str.
           Cudo]
 gi|225640752|gb|ACO00666.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           ATCC 23457]
 gi|237790142|gb|EEP64352.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           str. 2308 A]
 gi|255999463|gb|ACU47862.1| HesB/YadR/YfhF family protein [Brucella microti CCM 4915]
 gi|260096840|gb|EEW80715.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           NCTC 8038]
 gi|260153917|gb|EEW89009.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 1 str. 16M]
 gi|260156086|gb|EEW91166.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 4
           str. 40]
 gi|260668165|gb|EEX55105.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 4 str. 292]
 gi|260672102|gb|EEX58923.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260674732|gb|EEX61553.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 6 str. 870]
 gi|260873179|gb|EEX80248.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 9 str. C68]
 gi|260915481|gb|EEX82342.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 3 str. Tulya]
 gi|260920644|gb|EEX87297.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           B1/94]
 gi|260923858|gb|EEX90426.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M13/05/1]
 gi|261294422|gb|EEX97918.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M644/93/1]
 gi|261296748|gb|EEY00245.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis B2/94]
 gi|261300962|gb|EEY04459.1| iron-sulfur cluster assembly accessory protein [Brucella neotomae
           5K33]
 gi|261303405|gb|EEY06902.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis M163/99/10]
 gi|261738062|gb|EEY26058.1| iron-sulfur cluster assembly accessory protein [Brucella sp. F5/99]
 gi|261741945|gb|EEY29871.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 5
           str. 513]
 gi|261744604|gb|EEY32530.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 3
           str. 686]
 gi|262552493|gb|EEZ08483.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M490/95/1]
 gi|262765924|gb|EEZ11713.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|263001758|gb|EEZ14333.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|263094333|gb|EEZ18178.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 2 str. 63/9]
 gi|264660757|gb|EEZ31018.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis M292/94/1]
 gi|264662561|gb|EEZ32822.1| iron-sulfur cluster assembly accessory protein [Brucella sp. 83/13]
 gi|294820816|gb|EFG37815.1| HesB/YadR/YfhF family protein [Brucella sp. NVSL 07-0026]
 gi|297175393|gb|EFH34740.1| HesB/YadR/YfhF family protein [Brucella abortus bv. 5 str. B3196]
 gi|306275850|gb|EFM57566.1| iron-sulfur cluster assembly accessory protein [Brucella sp. BO1]
 gi|306289652|gb|EFM60852.1| iron-sulfur cluster assembly accessory protein [Brucella sp. BO2]
 gi|306407579|gb|EFM63777.1| iron-sulfur cluster assembly accessory protein [Brucella sp. NF
           2653]
 gi|326408893|gb|ADZ65958.1| HESB protein [Brucella melitensis M28]
 gi|326538611|gb|ADZ86826.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           M5-90]
          Length = 108

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  RI +I+ +  GK   +R+S++ GGC+G  Y  DLV D   + D +IEK G 
Sbjct: 4   ITVSDSAARRIAKILDSEPGKT-ALRVSVEGGGCSGFSYKYDLV-DAQTEDDIVIEKLGA 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V IDS S+ YM G+EIDF  + +   F   NPN  ++CGCG S  I
Sbjct: 62  RVLIDSISVPYMDGSEIDFVDDLMGQSFQIRNPNATASCGCGTSFAI 108


>gi|119898305|ref|YP_933518.1| putative regulatory protein [Azoarcus sp. BH72]
 gi|119670718|emb|CAL94631.1| putative regulatory Protein [Azoarcus sp. BH72]
          Length = 107

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++++A   +   +   +GK  GIR+ ++  GC+G+ Y ++ V D   D D + E  GV
Sbjct: 3   VTLSQSAAKHVANFI-AKRGKGLGIRLGVRTSGCSGMAYKLEFV-DEKQDEDLVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V +D  SL Y+ GTE+DF  E L  GF F+NPN   ACGCG+S  +
Sbjct: 61  QVIVDPKSLPYIDGTELDFVREGLNEGFKFNNPNVKDACGCGESFNV 107


>gi|296422409|ref|XP_002840753.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636976|emb|CAZ84944.1| unnamed protein product [Tuber melanosporum]
          Length = 181

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 68/107 (63%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +A   ++ ++  +Q   Q IRI +K  GC+GL Y ++ V D P   D+ + +DGV
Sbjct: 77  ITLTPSATQHLRSLL--AQPTPQLIRIGVKNRGCSGLAYHLEYV-DRPDKFDEEVVQDGV 133

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS +L  ++G+E+D+  +++ + FVF NPN    CGCG+S  +
Sbjct: 134 KVLIDSKALFSIIGSEMDWVEDRISARFVFRNPNIKEQCGCGESFSV 180


>gi|254565285|ref|XP_002489753.1| Mitochondrial matrix protein involved in biogenesis of iron-sulfur
           (Fe/S) cluster of Fe/S proteins [Pichia pastoris GS115]
 gi|238029549|emb|CAY67472.1| Mitochondrial matrix protein involved in biogenesis of iron-sulfur
           (Fe/S) cluster of Fe/S proteins [Pichia pastoris GS115]
          Length = 238

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 69/105 (65%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++ +AV  ++ +    + K    RI ++  GC+GL Y ++ V++ P   D+L+E+DG
Sbjct: 134 LITLSPSAVSHLRALSDLPEPKL--TRIGVRNRGCSGLTYHLEYVSE-PGKFDELVEQDG 190

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV IDS +L  ++G+E+D+  +KL S FVF NPN    CGCG+S
Sbjct: 191 VKVLIDSKALFSIVGSEMDWVDDKLSSKFVFKNPNSKGTCGCGES 235


>gi|262370467|ref|ZP_06063793.1| iron-binding protein [Acinetobacter johnsonii SH046]
 gi|262314809|gb|EEY95850.1| iron-binding protein [Acinetobacter johnsonii SH046]
          Length = 106

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 68/109 (62%), Gaps = 4/109 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEKD 62
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V  + +D  D   E+ 
Sbjct: 1   MINLTENAATHISNYLKN-RGKGEGIRVGVKTSGCSGLAYVLEFV--DSIDAHDTTFEQF 57

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVKV++D  SL+Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 58  GVKVFVDPKSLVYLDGMEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|161524321|ref|YP_001579333.1| iron-sulfur cluster assembly protein IscA [Burkholderia multivorans
           ATCC 17616]
 gi|189350923|ref|YP_001946551.1| HesB-like protein [Burkholderia multivorans ATCC 17616]
 gi|160341750|gb|ABX14836.1| iron-sulfur cluster assembly protein IscA [Burkholderia multivorans
           ATCC 17616]
 gi|189334945|dbj|BAG44015.1| HesB-like protein [Burkholderia multivorans ATCC 17616]
          Length = 107

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYLVR-RGKGLGLRLGVRTTGCSGLAYKLEYV-DELAPEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|189183478|ref|YP_001937263.1| HesB protein [Orientia tsutsugamushi str. Ikeda]
 gi|189180249|dbj|BAG40029.1| HesB protein [Orientia tsutsugamushi str. Ikeda]
          Length = 124

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 1/106 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++  A  RIKE++   +  + GI++ +K GGC+G  Y ++   D   D D++I   G
Sbjct: 18  VITISSRAAKRIKELLAKREKPSLGIKVGIKTGGCSGYSYYIEY-ADVKGDFDEVIIDKG 76

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           V V +D  ++LY++GT +D+   K  SGF F NPN+   CGCG+S 
Sbjct: 77  VTVLVDQKAILYLVGTTMDYIEGKFNSGFEFSNPNEKHRCGCGKSA 122


>gi|268567329|ref|XP_002647772.1| Hypothetical protein CBG20529 [Caenorhabditis briggsae]
          Length = 128

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 66/107 (61%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV RI+ ++   Q  A  ++I +++ GC GL Y ++   +     D+ +E+DG+
Sbjct: 25  LTLTNEAVSRIR-VLLAQQNNANALKIGVRQKGCNGLTYTLEYAREKQ-KFDEEVEQDGI 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KVW   A L  +LG+E+D+ T+KL S FVF NPN    CGCG+S  I
Sbjct: 83  KVWEPKAQL-SLLGSEMDYVTDKLSSEFVFRNPNIKGTCGCGESFSI 128


>gi|68248979|ref|YP_248091.1| hypothetical protein NTHI0496 [Haemophilus influenzae 86-028NP]
 gi|145628732|ref|ZP_01784532.1| co-chaperone HscB [Haemophilus influenzae 22.1-21]
 gi|145631829|ref|ZP_01787588.1| co-chaperone HscB [Haemophilus influenzae R3021]
 gi|145634628|ref|ZP_01790337.1| scaffold protein [Haemophilus influenzae PittAA]
 gi|145636356|ref|ZP_01792025.1| scaffold protein [Haemophilus influenzae PittHH]
 gi|145638715|ref|ZP_01794324.1| scaffold protein [Haemophilus influenzae PittII]
 gi|148825341|ref|YP_001290094.1| hypothetical protein CGSHiEE_01125 [Haemophilus influenzae PittEE]
 gi|148827515|ref|YP_001292268.1| hypothetical protein CGSHiGG_04690 [Haemophilus influenzae PittGG]
 gi|229846463|ref|ZP_04466571.1| hypothetical protein CGSHi7P49H1_07320 [Haemophilus influenzae
           7P49H1]
 gi|260582532|ref|ZP_05850322.1| iron-sulfur cluster assembly protein IscA [Haemophilus influenzae
           NT127]
 gi|68057178|gb|AAX87431.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP]
 gi|144979202|gb|EDJ88888.1| co-chaperone HscB [Haemophilus influenzae 22.1-21]
 gi|144982548|gb|EDJ90102.1| co-chaperone HscB [Haemophilus influenzae R3021]
 gi|145268173|gb|EDK08168.1| scaffold protein [Haemophilus influenzae PittAA]
 gi|145270521|gb|EDK10455.1| scaffold protein [Haemophilus influenzae PittHH]
 gi|145272310|gb|EDK12218.1| scaffold protein [Haemophilus influenzae PittII]
 gi|148715501|gb|ABQ97711.1| scaffold protein [Haemophilus influenzae PittEE]
 gi|148718757|gb|ABQ99884.1| hypothetical protein CGSHiGG_04690 [Haemophilus influenzae PittGG]
 gi|229810556|gb|EEP46274.1| hypothetical protein CGSHi7P49H1_07320 [Haemophilus influenzae
           7P49H1]
 gi|260094343|gb|EEW78241.1| iron-sulfur cluster assembly protein IscA [Haemophilus influenzae
           NT127]
 gi|301169078|emb|CBW28675.1| FeS cluster assembly protein [Haemophilus influenzae 10810]
 gi|309750205|gb|ADO80189.1| iron-sulfur cluster assembly protein IscA [Haemophilus influenzae
           R2866]
 gi|309972465|gb|ADO95666.1| iron-sulfur cluster assembly protein IscA [Haemophilus influenzae
           R2846]
          Length = 107

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+K  + N +GK  G+R+ +K  GC+GL Y+++ V D     D + E+ GV
Sbjct: 3   ITLTEKAAQRVKAFLDN-RGKGIGLRLGVKTSGCSGLAYVLEFV-DVLNSEDQVFEQHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL+Y+ G E+D+  E L  GF ++NPN   +CGCG+S  +
Sbjct: 61  NIIVDPKSLVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV 107


>gi|254251968|ref|ZP_04945286.1| HesB/YadR/YfhF [Burkholderia dolosa AUO158]
 gi|124894577|gb|EAY68457.1| HesB/YadR/YfhF [Burkholderia dolosa AUO158]
          Length = 115

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 11  ITLTEKAAQHVQKYLVR-RGKGVGLRLGVRTTGCSGLAYKLEYV-DELAPEDQVFESHGV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 69  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 115


>gi|49258913|pdb|1S98|A Chain A, E.Coli Isca Crystal Structure To 2.3 A
 gi|49258914|pdb|1S98|B Chain B, E.Coli Isca Crystal Structure To 2.3 A
          Length = 107

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D P   D + E  GV
Sbjct: 3   ITLSDSAAARVNTFLAN-RGKGFGLRLGVRTSGCSGMAYVLEFV-DEPTPEDIVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  S+ ++ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVVVDGKSMQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV 107


>gi|115524635|ref|YP_781546.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisA53]
 gi|115518582|gb|ABJ06566.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris BisA53]
          Length = 109

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 69/112 (61%), Gaps = 4/112 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-I 59
           M+D VT++E A  RI EI+   +G    +RIS++ GGC+G +Y  D+  D   + DDL I
Sbjct: 1   MTDNVTLSERAARRIGEIL-KGEGNGAMLRISVEGGGCSGFQYKFDV--DRHQNNDDLVI 57

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D   V +DSAS+ ++ G E+DF  + + + F  +NPN  ++CGCG S  I
Sbjct: 58  ARDAAVVLVDSASVPFLSGAEVDFVDDLIGASFRVNNPNATASCGCGTSFSI 109


>gi|325523673|gb|EGD01944.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp. TJI49]
          Length = 107

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYLVR-RGKGVGLRLGVRTTGCSGLAYKLEYV-DELAPEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTELDFAREGLNEGFRFNNPNVKDECGCGESFRV 107


>gi|292491987|ref|YP_003527426.1| iron-sulfur cluster assembly accessory protein [Nitrosococcus
           halophilus Nc4]
 gi|291580582|gb|ADE15039.1| iron-sulfur cluster assembly accessory protein [Nitrosococcus
           halophilus Nc4]
          Length = 107

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T++A+ +IK+ V + Q   +G+R+ +KK GC+G  Y++        + D + + DG+
Sbjct: 3   ITVTDSALKQIKK-VLSQQANVEGLRVGVKKSGCSGYAYVLGFAEQVEPE-DTVFDHDGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL ++ GTE+D++ E L   F F NPN V++CGCG+S  +
Sbjct: 61  KIVIDKQSLGFIDGTELDYRREGLNESFKFQNPNVVASCGCGESFSV 107


>gi|134291401|ref|YP_001115170.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           vietnamiensis G4]
 gi|134134590|gb|ABO58915.1| FeS assembly scaffold SufA [Burkholderia vietnamiensis G4]
          Length = 107

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T AA   I E     +G   G+R+++K  GC+G  Y ++ V D P D D      GV
Sbjct: 3   ISVTPAAARHI-EKALQKRGAGLGLRVAVKTSGCSGFAYALEFV-DAPNDDDLCFATHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  SL  + GTE+DF  E L  GF FHNPN  + CGCG+S  +
Sbjct: 61  TVVVDPRSLPMLDGTELDFVREGLNEGFKFHNPNATANCGCGESFAV 107


>gi|149185211|ref|ZP_01863528.1| hypothetical protein ED21_19197 [Erythrobacter sp. SD-21]
 gi|148831322|gb|EDL49756.1| hypothetical protein ED21_19197 [Erythrobacter sp. SD-21]
          Length = 119

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 64/104 (61%), Gaps = 1/104 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T  A  RI E++  +   A G+++S  + GC+GL Y VD VT+     D+ IE  G 
Sbjct: 14  VILTPRAEERIAELMSKAPEDAIGVKLSTPRRGCSGLAYSVDYVTEE-TKFDEKIETPGG 72

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
             +ID AS+LY++G+ +D+  +   +GFVF NPN   ACGCG+S
Sbjct: 73  IFYIDGASVLYLVGSTMDWVEDDFSAGFVFENPNAKGACGCGES 116


>gi|73540762|ref|YP_295282.1| HesB/YadR/YfhF:Iron-sulphur cluster assembly protein IscA
           [Ralstonia eutropha JMP134]
 gi|72118175|gb|AAZ60438.1| HesB/YadR/YfhF:Iron-sulphur cluster assembly protein IscA
           [Ralstonia eutropha JMP134]
          Length = 106

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMTE A   +   +   +GK  G+R+ +K  GC+GL Y ++ V D     D++ E  G
Sbjct: 1   MITMTEKAARHVARYL-ERRGKGVGLRLGVKTTGCSGLAYKLEYV-DELHPEDEVFESHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +KV +D+ SL Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 59  IKVIVDAKSLPYIDGTELDYAREGLNEGFRFNNPNVKDECGCGESFTV 106


>gi|33592863|ref|NP_880507.1| [Fe-S] cluster formation/repair protein [Bordetella pertussis
           Tohama I]
 gi|33596645|ref|NP_884288.1| [Fe-S] cluster formation/repair protein [Bordetella parapertussis
           12822]
 gi|33601261|ref|NP_888821.1| [Fe-S] cluster formation/repair protein [Bordetella bronchiseptica
           RB50]
 gi|33572511|emb|CAE42087.1| [Fe-S] cluster formation/repair protein [Bordetella pertussis
           Tohama I]
 gi|33573346|emb|CAE37330.1| [Fe-S] cluster formation/repair protein [Bordetella parapertussis]
 gi|33575696|emb|CAE32774.1| [Fe-S] cluster formation/repair protein [Bordetella bronchiseptica
           RB50]
 gi|332382276|gb|AEE67123.1| [Fe-S] cluster formation/repair protein [Bordetella pertussis CS]
          Length = 107

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T++A   +   +   +GK  G+R+ ++  GC+G+ Y ++ V +   D D + +  GV
Sbjct: 3   VTLTQSAANHVGRYL-QKRGKGIGLRLGVRTTGCSGMAYKLEYVDEQAAD-DVVFDSFGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV+ID  SL Y+ GTE+D+  E L  GF F NPN+ + CGCG+S  +
Sbjct: 61  KVFIDPKSLAYLDGTELDYAREGLNEGFRFSNPNEKATCGCGESFTV 107


>gi|86159896|ref|YP_466681.1| HesB/YadR/YfhF [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85776407|gb|ABC83244.1| HesB/YadR/YfhF [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 127

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 64/108 (59%), Gaps = 1/108 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           + + V++T  A+  +K+ +        GIR+ +  GGCAG +Y +D   D P DGD  +E
Sbjct: 18  IPNFVSLTSKAIEMVKDAIAREGLAGYGIRVGVMGGGCAGFQYSMDFEKD-PRDGDISLE 76

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +DG+K+++D  S +Y+ G  +D+      +GF F+NPN  + CGCG S
Sbjct: 77  QDGIKLYVDPMSSMYLQGVTVDYVVGLQGAGFKFNNPNARTTCGCGSS 124


>gi|24113073|ref|NP_707583.1| iron-sulfur cluster assembly scaffold protein [Shigella flexneri 2a
           str. 301]
 gi|30063198|ref|NP_837369.1| iron-sulfur cluster assembly scaffold protein [Shigella flexneri 2a
           str. 2457T]
 gi|110805661|ref|YP_689181.1| iron-sulfur cluster assembly scaffold protein [Shigella flexneri 5
           str. 8401]
 gi|24052046|gb|AAN43290.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30041450|gb|AAP17178.1| hypothetical protein S1846 [Shigella flexneri 2a str. 2457T]
 gi|110615209|gb|ABF03876.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|281601121|gb|ADA74105.1| SufA scaffold protein for iron-sulfur cluster assembly [Shigella
           flexneri 2002017]
 gi|313648966|gb|EFS13403.1| feS assembly scaffold SufA [Shigella flexneri 2a str. 2457T]
 gi|332757004|gb|EGJ87347.1| feS assembly scaffold SufA [Shigella flexneri 4343-70]
          Length = 122

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 18  LTLTPAAAIHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   S+ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 76  KLFVPLQSMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFRV 122


>gi|332757755|gb|EGJ88084.1| feS assembly scaffold SufA [Shigella flexneri 2747-71]
 gi|332758525|gb|EGJ88846.1| feS assembly scaffold SufA [Shigella flexneri K-671]
 gi|332766890|gb|EGJ97090.1| feS assembly scaffold SufA [Shigella flexneri 2930-71]
 gi|333003869|gb|EGK23404.1| feS assembly scaffold SufA [Shigella flexneri K-218]
 gi|333018036|gb|EGK37341.1| feS assembly scaffold SufA [Shigella flexneri K-304]
          Length = 120

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 16  LTLTPAAAIHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 73

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   S+ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 74  KLFVPLQSMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFRV 120


>gi|16519984|ref|NP_444104.1| hypothetical protein NGR_a01210 [Sinorhizobium fredii NGR234]
 gi|2496755|sp|Q53211|Y4VC_RHISN RecName: Full=Uncharacterized protein y4vC
 gi|1486440|emb|CAA92418.1| unknown [Rhizobium sp.]
 gi|2182670|gb|AAB91891.1| conserved hypothetical 11.0 kDa protein; possibly involved in
           assembly of iron-sulfur cluster [Sinorhizobium fredii
           NGR234]
          Length = 106

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T++A+  IK  +  +   A G+RI ++ GGC+G +Y + L +++  DGD +IE  G
Sbjct: 1   MITLTDSAIAAIKFALSQTCEPADGLRIKVEAGGCSGFKYHLGLDSESR-DGDAVIEAGG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV++DSAS  ++ G  +DF T    +GF+F NPN    C CG+S
Sbjct: 60  VKVYVDSASQPHVSGMTVDFTTGVDSAGFIFDNPNARENCACGKS 104


>gi|91778665|ref|YP_553873.1| HesB/YadR/YfhF, Iron-sulphur cluster assembly protein IscA
           [Burkholderia xenovorans LB400]
 gi|91691325|gb|ABE34523.1| HesB/YadR/YfhF, Iron-sulfur cluster assembly protein IscA
           [Burkholderia xenovorans LB400]
          Length = 107

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T AA   + E     +G   G+R++++  GC+G  Y ++ V D   D D   E  GV
Sbjct: 3   ISLTPAAARHV-EKSLRKRGSGMGLRVAVRTSGCSGFAYALEFV-DTANDEDQRFEAHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  SL  + GTE+DF  E L  GF FHNPN  + CGCG+S  +
Sbjct: 61  TVVVDPRSLTMLDGTELDFVREGLNEGFRFHNPNARANCGCGESFAV 107


>gi|134296305|ref|YP_001120040.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           vietnamiensis G4]
 gi|134139462|gb|ABO55205.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           vietnamiensis G4]
          Length = 107

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYLVR-RGKGVGLRLGVRTTGCSGLAYKLEYV-DELAPEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|50311733|ref|XP_455894.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49645030|emb|CAG98602.1| KLLA0F18150p [Kluyveromyces lactis]
          Length = 231

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 70/105 (66%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++T  A+  +K ++   Q + + IRI +K  GC+GL Y +  +T +P   D+++E+DG
Sbjct: 127 LISLTPNALSHLKGLL--DQPEPKLIRIGVKNRGCSGLTYDLQYIT-SPGKFDEVVEQDG 183

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV IDS +L  ++G+E+D+  +KL S FVF NPN    CGCG+S
Sbjct: 184 VKVIIDSKALFSIVGSEMDWVDDKLSSRFVFKNPNSKGTCGCGES 228


>gi|24642263|ref|NP_573062.1| lethal (1) G0136 [Drosophila melanogaster]
 gi|194894350|ref|XP_001978048.1| GG17904 [Drosophila erecta]
 gi|195355387|ref|XP_002044173.1| GM22570 [Drosophila sechellia]
 gi|195478946|ref|XP_002100707.1| GE17212 [Drosophila yakuba]
 gi|19528139|gb|AAL90184.1| AT26381p [Drosophila melanogaster]
 gi|22832286|gb|AAF48498.2| lethal (1) G0136 [Drosophila melanogaster]
 gi|190649697|gb|EDV46975.1| GG17904 [Drosophila erecta]
 gi|194129462|gb|EDW51505.1| GM22570 [Drosophila sechellia]
 gi|194188231|gb|EDX01815.1| GE17212 [Drosophila yakuba]
 gi|220958998|gb|ACL92042.1| l(1)G0136-PA [synthetic construct]
 gi|220960216|gb|ACL92644.1| l(1)G0136-PA [synthetic construct]
          Length = 130

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV RIK +    +    G+++ +++ GC GL Y +D  +      D+ + +DGV
Sbjct: 26  LTLTPAAVLRIKTL-LQDKPDMVGLKVGVRQRGCNGLSYTLDYASQKD-KLDEEVVQDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  +
Sbjct: 84  KVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFSM 130


>gi|319775757|ref|YP_004138245.1| hypothetical protein HICON_11010 [Haemophilus influenzae F3047]
 gi|317450348|emb|CBY86564.1| conserved hypothetical protein [Haemophilus influenzae F3047]
          Length = 107

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+K  + N +GK  G+R+ +K  GC+GL Y+++ V D     D + E+ GV
Sbjct: 3   ITLTEKAAQRVKAFLDN-RGKGIGLRLGVKTSGCSGLAYVLEFV-DVLNAEDQVFEQHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL+Y+ G E+D+  E L  GF ++NPN   +CGCG+S  +
Sbjct: 61  NIIVDPKSLVYLNGIELDYVKEGLNEGFRYNNPNVKESCGCGESFHV 107


>gi|285018512|ref|YP_003376223.1| iron-sulfur cluster assembly protein (hesb/yadr/yfhf family)
           [Xanthomonas albilineans GPE PC73]
 gi|283473730|emb|CBA16233.1| putative iron-sulfur cluster assembly protein (hesb/yadr/yfhf
           family) [Xanthomonas albilineans]
          Length = 125

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 65/104 (62%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T AA  R++  +  + G A G+R  + + GC+G  ++ DL  +   D D + E+DGV
Sbjct: 14  IRLTPAAFARVQRFLDQTPG-ALGLRFGVVRTGCSGWGHVTDLAHEAHAD-DAVFEQDGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++D+ASL  + GTEIDF  + L   FVF NPN  + CGCG+S
Sbjct: 72  RIYVDAASLQLVDGTEIDFAKQGLGETFVFRNPNATAECGCGES 115


>gi|118589110|ref|ZP_01546517.1| hypothetical protein SIAM614_13698 [Stappia aggregata IAM 12614]
 gi|118438439|gb|EAV45073.1| hypothetical protein SIAM614_13698 [Stappia aggregata IAM 12614]
          Length = 113

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+++ A  RI  I  + +     +R+S++ GGC+GL+Y  D+V D+  D D +IEK+G 
Sbjct: 9   VTVSDRAAKRIAAI-LSKEPDCSMLRVSVEGGGCSGLQYKYDVV-DSREDDDLVIEKNGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V IDS SL YM G+EIDF  + +   F  +NPN V+ CGCG S  I
Sbjct: 67  TVLIDSISLQYMGGSEIDFVDDLIGQSFQINNPNAVAGCGCGTSFTI 113


>gi|255575681|ref|XP_002528740.1| iron-sulfur cluster assembly protein, putative [Ricinus communis]
 gi|223531834|gb|EEF33652.1| iron-sulfur cluster assembly protein, putative [Ricinus communis]
          Length = 138

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 67/104 (64%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA  RI+ ++   Q +   +++ +K  GC GL Y ++   D     D+L+E+ GV
Sbjct: 22  LTLTDAAASRIRHLL--QQRQRPFLKLGVKARGCNGLSYTLNYA-DEKAKFDELVEEKGV 78

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+ ID  +L++++GT++DF  +KL S FVF NPN    CGCG+S
Sbjct: 79  KILIDPKALMHVIGTKMDFVDDKLRSEFVFINPNSKGQCGCGES 122


>gi|126668348|ref|ZP_01739306.1| hypothetical protein MELB17_12982 [Marinobacter sp. ELB17]
 gi|126627164|gb|EAZ97803.1| hypothetical protein MELB17_12982 [Marinobacter sp. ELB17]
          Length = 117

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMT +AV  +++ V + Q +A+GIR++++K GC+G +Y      D   D D +   DGV
Sbjct: 12  VTMTPSAVTHVRKQV-DKQPEAKGIRLAIRKSGCSGFKYETQWAEDVAAD-DKVFHIDGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V++    L  + G EIDF TE + S F+F NPN  + CGCG+S  +
Sbjct: 70  DVYVKEEHLALVNGIEIDFVTEGVNSVFLFRNPNATAECGCGESFTV 116


>gi|238753889|ref|ZP_04615249.1| Iron-binding protein iscA [Yersinia ruckeri ATCC 29473]
 gi|238707877|gb|EEQ00235.1| Iron-binding protein iscA [Yersinia ruckeri ATCC 29473]
          Length = 107

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++++A  R+   +   +GK  G+R+ ++  GC+G+ Y+++ V D   D D + E  GV
Sbjct: 3   ISISDSAAQRVSAFL-EHRGKGLGLRLGVRTSGCSGMAYVLEFV-DEMNDDDIVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  S++Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDGKSIVYLDGTELDFVKEGLNEGFKFNNPNVSGECGCGESFNV 107


>gi|156840885|ref|XP_001643820.1| hypothetical protein Kpol_1044p22 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156114446|gb|EDO15962.1| hypothetical protein Kpol_1044p22 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 253

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 68/105 (64%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++  AV  ++ ++   Q + + IRI  +  GC+GL Y +  + + P   D+++E+DG
Sbjct: 149 LITLSPKAVTHLRALL--DQPEPKLIRIGTRNRGCSGLTYDLQYIAE-PEKYDEIVEQDG 205

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV IDS +L  ++G+E+D+  +KL S FVF NPN    CGCG+S
Sbjct: 206 VKVVIDSKALFSVVGSEMDWVDDKLTSKFVFKNPNSKGTCGCGES 250


>gi|262278960|ref|ZP_06056745.1| iron-sulfur cluster assembly protein IscA [Acinetobacter
           calcoaceticus RUH2202]
 gi|262259311|gb|EEY78044.1| iron-sulfur cluster assembly protein IscA [Acinetobacter
           calcoaceticus RUH2202]
          Length = 106

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V D+  + D + E+ G
Sbjct: 1   MIHLTENAATHISNYLKN-RGKGEGIRVGVKTSGCSGLAYVLEFV-DSIDEHDQVFEQFG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  S +Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSSVYLEGLEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|195566952|ref|XP_002107039.1| GD17232 [Drosophila simulans]
 gi|194204436|gb|EDX18012.1| GD17232 [Drosophila simulans]
          Length = 125

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV RIK ++   +    G+++ +++ GC GL Y +D  +      D+ + +DGV
Sbjct: 21  LTLTPAAVLRIKTLL-QDKPDMVGLKVGVRQRGCNGLSYTLDYASQKD-KLDEEVVQDGV 78

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  +
Sbjct: 79  KVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFSM 125


>gi|307729213|ref|YP_003906437.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp.
           CCGE1003]
 gi|307583748|gb|ADN57146.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp.
           CCGE1003]
          Length = 107

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E +GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGVGLRLGVRTTGCSGLAYKLEYV-DELAPEDQVFECNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|224110166|ref|XP_002315435.1| predicted protein [Populus trichocarpa]
 gi|222864475|gb|EEF01606.1| predicted protein [Populus trichocarpa]
          Length = 141

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 68/105 (64%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++T+AA  RI++++   Q K   +R+ +K  GC GL Y ++   D     D+L+E  G
Sbjct: 25  VLSLTDAAATRIRDLL--QQRKRPFLRLGVKARGCNGLSYTLNYA-DEKGKFDELVEDKG 81

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VK+ ID  +L++++GT++DF  +KL S F+F NPN    CGCG+S
Sbjct: 82  VKILIDPKALMHVIGTKMDFVDDKLRSEFIFINPNSKGQCGCGES 126


>gi|113867180|ref|YP_725669.1| iron sulfur cluster assembly protein (IscA) [Ralstonia eutropha
           H16]
 gi|113525956|emb|CAJ92301.1| iron sulfur cluster assembly protein (IscA) [Ralstonia eutropha
           H16]
          Length = 106

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMTE A   +   +   +GK  G+R+ +K  GC+GL Y ++ V D  +  D + E  G
Sbjct: 1   MITMTEKAAKHVARYL-ERRGKGVGLRLGVKTTGCSGLAYKLEYV-DELLPEDAVFESHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +KV +D+ SL Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 59  IKVIVDAKSLPYIDGTELDYAREGLNEGFRFNNPNVKDECGCGESFTV 106


>gi|103486160|ref|YP_615721.1| HesB/YadR/YfhF [Sphingopyxis alaskensis RB2256]
 gi|98976237|gb|ABF52388.1| HesB/YadR/YfhF [Sphingopyxis alaskensis RB2256]
          Length = 118

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T  A  RI  ++  +   A G+++S  + GC+GL Y VD VT+     D+ IE  G 
Sbjct: 13  VTLTPNAEARIARLMAAAPDGAIGVKLSTPRRGCSGLAYSVDYVTEEE-KFDEKIETPGG 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             +ID AS+LY++G+ +D+  +   +GFVF NPN   ACGCG+S  +
Sbjct: 72  VFYIDGASVLYLIGSTMDWVEDDFAAGFVFDNPNAKGACGCGESFTV 118


>gi|255947932|ref|XP_002564733.1| Pc22g07080 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211591750|emb|CAP97996.1| Pc22g07080 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 230

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 70/104 (67%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + ++  AV ++++++  +Q + + IR+ +K  GC+GL Y ++ V + P   D+ +E+DGV
Sbjct: 127 MKLSPVAVEQLRKLM--AQPEPKFIRVGVKNRGCSGLAYHLEYV-EKPGKFDETVEQDGV 183

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV IDS +L  ++G+E+D++ +KL   FVF NPN    CGCG+S
Sbjct: 184 KVLIDSKALFSIIGSEMDWQEDKLSRRFVFRNPNIKEECGCGES 227


>gi|55981604|ref|YP_144901.1| iron-sulfur cluster biosynthesis protein IscA [Thermus thermophilus
           HB8]
 gi|55773017|dbj|BAD71458.1| iron-sulfur cluster biosynthesis protein IscA [Thermus thermophilus
           HB8]
          Length = 126

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 62/109 (56%), Gaps = 1/109 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T  A  + KEI+     +   IR+ +K GGC+G +Y +  V +  + GD  +E  G
Sbjct: 8   VIRITPLAAEKAKEILARYGKEHAAIRVYIKSGGCSGFQYGM-AVDERELPGDTFVEMHG 66

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           V++ +D  SL Y++G+EID+    +  GF  HNPN  S CGCG S   K
Sbjct: 67  VRLVVDRMSLPYLVGSEIDWVESLMGGGFTVHNPNAASTCGCGHSFRTK 115


>gi|194768925|ref|XP_001966561.1| GF21925 [Drosophila ananassae]
 gi|190617325|gb|EDV32849.1| GF21925 [Drosophila ananassae]
          Length = 130

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV RIK +    +    G+++ +++ GC GL Y +D  +      D+ + +DGV
Sbjct: 26  LTLTPAAVQRIKTL-LQDKPDMVGLKVGVRQRGCNGLSYTLDYASQKD-KLDEEVVQDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  +
Sbjct: 84  KVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFSM 130


>gi|224088740|ref|XP_002194930.1| PREDICTED: zinc finger, CCHC domain containing 6 [Taeniopygia
           guttata]
          Length = 129

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IKE++ +      G+++ ++  GC GL Y ++  T +  D D+ + +DGV
Sbjct: 25  LTLTPSAVQKIKELLKDKPDHV-GVKVGVRTRGCNGLSYTLEY-TKSKGDSDEEVVQDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|296156153|ref|ZP_06838992.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp. Ch1-1]
 gi|295893659|gb|EFG73438.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp. Ch1-1]
          Length = 107

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T AA   + E     +G   G+R+++K  GC+G  Y ++ V D   D D   E  GV
Sbjct: 3   ISLTPAAARHV-EKSLRKRGSGIGLRVAVKTSGCSGFAYALEFV-DTANDEDQRFEAHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  SL  + GTE+DF  E L  GF FHNPN  + CGCG+S  +
Sbjct: 61  TVVVDPRSLTMLDGTELDFVREGLNEGFRFHNPNARANCGCGESFAV 107


>gi|288942368|ref|YP_003444608.1| iron-sulfur cluster assembly accessory protein [Allochromatium
           vinosum DSM 180]
 gi|288897740|gb|ADC63576.1| iron-sulfur cluster assembly accessory protein [Allochromatium
           vinosum DSM 180]
          Length = 108

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 61/108 (56%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TEAA   +   +   +G   G+R++ KK GC+G  Y VD   +   D D + E  GV
Sbjct: 3   VTLTEAAARHVASQL-ERRGHGLGLRVATKKSGCSGFTYAVDYADELGAD-DRVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDF-KTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  +L  + G EIDF KT  L  GF FHNPN    CGCG+S  +
Sbjct: 61  KVVVDETNLSRLDGLEIDFVKTNLLNQGFEFHNPNAKDHCGCGESFRV 108


>gi|323526614|ref|YP_004228767.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp.
           CCGE1001]
 gi|323383616|gb|ADX55707.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp.
           CCGE1001]
          Length = 107

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E +GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGVGLRLGVRTTGCSGLAYKLEYV-DELAPEDQVFECNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|196233473|ref|ZP_03132316.1| iron-sulfur cluster assembly accessory protein [Chthoniobacter
           flavus Ellin428]
 gi|196222469|gb|EDY16996.1| iron-sulfur cluster assembly accessory protein [Chthoniobacter
           flavus Ellin428]
          Length = 115

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 41/112 (36%), Positives = 68/112 (60%), Gaps = 2/112 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A+ +++ ++     + QG+RI ++ GGCAGL+Y +      P  GD+++E+DG
Sbjct: 1   MIQVTEPAIRQLQVMMREQDDQTQGLRIFVEHGGCAGLQYGMGFGQAEP--GDEVVERDG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           VKV I   S  ++ G+ ID+  +   +GF   NPN V +CGCG S E   A+
Sbjct: 59  VKVIIAEKSRHFLDGSTIDYSDDLAGAGFRIQNPNAVRSCGCGTSFEPADAE 110


>gi|319407167|emb|CBI80806.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 107

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +++ A  +I +I+   Q +   +RIS++ GGC+G  Y  DLV+++  D D +I+K G 
Sbjct: 3   VNISDIAAKQIAQIL-AEQPRKTALRISVEGGGCSGFSYKYDLVSESKED-DFIIKKGGA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V+IDS SL +M G EIDF  + +   F  HNPN  S+CGCG S  I
Sbjct: 61  VVFIDSISLAFMEGAEIDFVDDLMGQSFQIHNPNATSSCGCGVSFSI 107


>gi|311107143|ref|YP_003979996.1| iron-sulfur cluster assembly protein IscA [Achromobacter
           xylosoxidans A8]
 gi|310761832|gb|ADP17281.1| iron-sulfur cluster assembly protein IscA [Achromobacter
           xylosoxidans A8]
          Length = 107

 Score = 84.3 bits (207), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+ A   I   +   +GK  G+R+ ++  GC+G+ Y ++ V D+    D + E  GV
Sbjct: 3   VTLTQQAATHIGRYL-QKRGKGIGLRLGVRTTGCSGMAYKLEYV-DDVAPEDVVFESFGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV+ID  SL Y+ GTE+D+  E L  GF F NPN+ + CGCG+S  +
Sbjct: 61  KVFIDPKSLSYLDGTELDYAREGLNEGFKFRNPNEKATCGCGESFTV 107


>gi|323169997|gb|EFZ55653.1| feS assembly scaffold SufA [Escherichia coli LT-68]
          Length = 120

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV  I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 16  LTLTPAAVIHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 73

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 74  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 120


>gi|240849547|ref|NP_001155651.1| iron-sulfur cluster assembly 1 homolog, mitochondrial-like
           [Acyrthosiphon pisum]
 gi|239789478|dbj|BAH71363.1| ACYPI006095 [Acyrthosiphon pisum]
          Length = 128

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV ++K+I+ + +    G++I +K+ GC GL Y +D  ++     D+ + +DG+
Sbjct: 24  LTLTPSAVDQLKKIL-SGKSNCIGLKIGVKQRGCNGLSYTLDYASEKH-KLDEEVVQDGI 81

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  I
Sbjct: 82  RVFIDRKAQLTLLGTEMDFVQSKLSSEFVFYNPNIKGTCGCGESFNI 128


>gi|218548730|ref|YP_002382521.1| iron-sulfur cluster assembly scaffold protein [Escherichia
           fergusonii ATCC 35469]
 gi|218356271|emb|CAQ88889.1| Fe-S cluster assembly protein [Escherichia fergusonii ATCC 35469]
          Length = 122

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 65/104 (62%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV  I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 18  LTLTPAAVVHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S
Sbjct: 76  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGES 119


>gi|307946865|ref|ZP_07662200.1| iron-sulfur cluster insertion protein ErpA [Roseibium sp.
           TrichSKD4]
 gi|307770529|gb|EFO29755.1| iron-sulfur cluster insertion protein ErpA [Roseibium sp.
           TrichSKD4]
          Length = 113

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+++ A  RI +I  +S+ +   +R+S++ GGC+GL+Y  DLV     D D  I K GV
Sbjct: 9   VTVSDRAAKRIAKI-LSSEPQGSMLRVSVEGGGCSGLQYKYDLVQQRE-DDDLAIGKGGV 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V IDS SL YM G+EIDF  + +   F  +NPN V+ CGCG S  I
Sbjct: 67  TVLIDSISLQYMDGSEIDFVDDLIGQSFQINNPNAVAGCGCGTSFTI 113


>gi|256822721|ref|YP_003146684.1| iron-sulfur cluster assembly protein IscA [Kangiella koreensis DSM
           16069]
 gi|256796260|gb|ACV26916.1| iron-sulfur cluster assembly protein IscA [Kangiella koreensis DSM
           16069]
          Length = 107

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+++AA  R+K  + N +GK  G+R+ +K  GC+GL Y+++ V D   + D + E  GV
Sbjct: 3   ITLSDAAAERVKSFLAN-RGKGLGVRLGVKTTGCSGLAYVLEFV-DELNEDDVVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  S LY+ GT ++F  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVIVDPKSSLYLDGTRLEFIKEGLNEGFEFVNPNVKGECGCGESFTV 107


>gi|298368421|ref|ZP_06979739.1| iron-sulfur cluster assembly protein IscA [Neisseria sp. oral taxon
           014 str. F0314]
 gi|298282424|gb|EFI23911.1| iron-sulfur cluster assembly protein IscA [Neisseria sp. oral taxon
           014 str. F0314]
          Length = 106

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 66/108 (61%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A   I   +   +GK  G+R+ +K  GC+G+ Y ++ V +   + D + E+ G
Sbjct: 1   MITITENAAKYINNYL-TKRGKGLGVRLGVKTSGCSGMAYNLEFVDEASAE-DLVFEEHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 59  ARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|49475741|ref|YP_033782.1| hypothetical protein BH09960 [Bartonella henselae str. Houston-1]
 gi|49238548|emb|CAF27788.1| hypothetical protein BH09960 [Bartonella henselae str. Houston-1]
          Length = 107

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +++AA  RI +I+ +S+    G+R+S++ GGC+G  Y  +LV++   D D +++K G 
Sbjct: 3   VNISDAAAKRIVQIL-SSEPDKIGLRVSVEGGGCSGFSYKYNLVSETNED-DFVLKKGGA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V IDS SL +M G EIDF  + +   F  HNPN VS+CGCG S  I
Sbjct: 61  IVLIDSLSLPFMEGAEIDFVDDLIGQSFQIHNPNAVSSCGCGVSFSI 107


>gi|296282935|ref|ZP_06860933.1| hypothetical protein CbatJ_04913 [Citromicrobium bathyomarinum
           JL354]
          Length = 120

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T AA  R+  ++  +   A G+++S  + GC+GL Y VD V++     D+ IE  G 
Sbjct: 15  VTLTPAAEQRVANLMAKAPDDAIGVKLSTPRRGCSGLAYSVDYVSEE-QGFDEKIETPGG 73

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
             +ID AS+LY++G+ +D+  +   +GFVF NPN   ACGCG+S
Sbjct: 74  VFYIDGASVLYLVGSVMDWVEDDFSAGFVFENPNAKGACGCGES 117


>gi|16272324|ref|NP_438537.1| hypothetical protein HI0376 [Haemophilus influenzae Rd KW20]
 gi|260580561|ref|ZP_05848389.1| iron-sulfur cluster assembly protein IscA [Haemophilus influenzae
           RdAW]
 gi|1175982|sp|P44672|ISCA_HAEIN RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|1573345|gb|AAC22033.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|260092903|gb|EEW76838.1| iron-sulfur cluster assembly protein IscA [Haemophilus influenzae
           RdAW]
          Length = 107

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+K  + N +GK  G+R+ +K  GC+GL Y+++ V D     D + E+ GV
Sbjct: 3   ITLTEKAAQRVKAFLDN-RGKGIGLRLGVKTSGCSGLAYVLEFV-DVLNSEDQVFEQYGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL+Y+ G E+D+  E L  GF ++NPN   +CGCG+S  +
Sbjct: 61  NIIVDPKSLVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV 107


>gi|330913198|ref|XP_003296224.1| hypothetical protein PTT_05470 [Pyrenophora teres f. teres 0-1]
 gi|311331812|gb|EFQ95675.1| hypothetical protein PTT_05470 [Pyrenophora teres f. teres 0-1]
          Length = 247

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 68/108 (62%), Gaps = 3/108 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
            + ++ +AV  +++++   + K   IRI  K  GC+GL Y ++ V D P   D+ +E+DG
Sbjct: 142 TIKLSPSAVSHLRKLLELPEPKL--IRIGTKAKGCSGLAYHLEYV-DKPSPLDEQVEQDG 198

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV ID+ +LL ++G+E+D+  +KL   F+F NPN    CGCG+S  +
Sbjct: 199 VKVLIDNKALLNIIGSEMDWLEDKLNERFIFKNPNITEQCGCGESFSV 246


>gi|11612207|gb|AAG37300.1| HesB [Sinorhizobium fredii]
          Length = 106

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T++A+  IK  +  +   A G+RI ++ GGC+G +Y + L  ++  DGD +IE  G
Sbjct: 1   MITLTDSAIAAIKFALSQTCEPADGLRIKVEAGGCSGFKYHLGLDRES-RDGDAVIEAGG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV++DSAS  ++ G  +DF T     GF+F NPN    C CG+S
Sbjct: 60  VKVYVDSASQPHVSGMTVDFTTGVDSPGFIFENPNARENCACGKS 104


>gi|115352212|ref|YP_774051.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria
           AMMD]
 gi|115282200|gb|ABI87717.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria
           AMMD]
          Length = 122

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 18  ITLTEKAAQHVQKYLVR-RGKGVGLRLGVRTTGCSGLAYKLEYV-DELAPEDQVFESHGV 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GT++DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 76  KVIVDPKSLAYIDGTQLDFAREGLNEGFKFNNPNVKDECGCGESFRV 122


>gi|17228926|ref|NP_485474.1| HesB protein [Nostoc sp. PCC 7120]
 gi|20141343|sp|P18501|HESB_ANASP RecName: Full=Protein hesB
 gi|17130778|dbj|BAB73388.1| HesB protein [Nostoc sp. PCC 7120]
          Length = 123

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 69/112 (61%), Gaps = 7/112 (6%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKA----QGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           VT+TE A +R++  +  S   A    +GIR+S+K GGC+G EY++D VT  P   DDL+ 
Sbjct: 3   VTLTEKAEFRLRAFLRGSAKDANETTKGIRVSVKDGGCSGYEYLMD-VTSQP-QPDDLVT 60

Query: 61  KDG-VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + G V V++D+ S   + G  IDF    + SGF F NPN  S CGCG+S ++
Sbjct: 61  QQGSVLVYVDAKSAPLLEGIVIDFVEGLVESGFKFTNPNATSTCGCGKSFKV 112


>gi|316933985|ref|YP_004108967.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris DX-1]
 gi|315601699|gb|ADU44234.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris DX-1]
          Length = 110

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 69/109 (63%), Gaps = 6/109 (5%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQG--IRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           VT++E A  RI EI+   +G+ QG  +RIS++ GGC+G +Y  D V     D D +I +D
Sbjct: 6   VTISERAARRIGEIL---KGEGQGAMLRISVEGGGCSGFQYKFD-VDRTKTDDDLVIARD 61

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G  V +DSAS+ ++ G+E+DF  + + + F  +NPN  ++CGCG S  I
Sbjct: 62  GAVVLVDSASVPFLAGSEVDFIDDLIGASFRVNNPNASASCGCGTSFSI 110


>gi|300114133|ref|YP_003760708.1| iron-sulfur cluster assembly accessory protein [Nitrosococcus
           watsonii C-113]
 gi|299540070|gb|ADJ28387.1| iron-sulfur cluster assembly accessory protein [Nitrosococcus
           watsonii C-113]
          Length = 107

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +A+ +IK+ V + Q   +G+R+ +KK GC+G  Y++D       + D +   DGV
Sbjct: 3   ITVTASALKQIKK-VLSQQENVEGLRVGVKKSGCSGYAYVLDFAKQVKSE-DTVFNHDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL ++ GTE+D++ E L   F F NPN    CGCG+S  +
Sbjct: 61  KILVDKQSLNFIDGTELDYRREGLNESFKFQNPNVTGTCGCGESFSM 107


>gi|195164087|ref|XP_002022880.1| GL16489 [Drosophila persimilis]
 gi|198471618|ref|XP_001355683.2| GA20890 [Drosophila pseudoobscura pseudoobscura]
 gi|194104942|gb|EDW26985.1| GL16489 [Drosophila persimilis]
 gi|198145998|gb|EAL32742.2| GA20890 [Drosophila pseudoobscura pseudoobscura]
          Length = 130

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 68/109 (62%), Gaps = 6/109 (5%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQ--GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +T+T AAV RIK ++   Q K    G+++ +++ GC GL Y +D  +      D+ + +D
Sbjct: 26  LTLTPAAVNRIKTLL---QDKPDFIGLKVGVRQRGCNGLSYTLDYASSKD-KLDEEVVQD 81

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVKV+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  +
Sbjct: 82  GVKVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFSM 130


>gi|301093476|ref|XP_002997584.1| iron-sulfur cluster assembly protein, putative [Phytophthora
           infestans T30-4]
 gi|262110547|gb|EEY68599.1| iron-sulfur cluster assembly protein, putative [Phytophthora
           infestans T30-4]
          Length = 146

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 68/111 (61%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           +   + +T+AA  RIKE++ N +  A GIR+ +K  GC GL Y ++   D     ++ + 
Sbjct: 38  LPPPLNLTDAAAERIKELLAN-KPDAIGIRLGVKTRGCNGLSYTMNYA-DKKEKMEEEVS 95

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+G +V+++  +L +++GT +DF+   + S FVF NPN   +CGCG+S  +
Sbjct: 96  KNGARVFVEPKALFHVVGTTMDFQVTPVSSEFVFENPNAKGSCGCGESFNV 146


>gi|260788975|ref|XP_002589524.1| hypothetical protein BRAFLDRAFT_125211 [Branchiostoma floridae]
 gi|229274702|gb|EEN45535.1| hypothetical protein BRAFLDRAFT_125211 [Branchiostoma floridae]
          Length = 128

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AAV +++ I  +S+    G+++ ++  GC GL Y ++   +     D+++ +DGV
Sbjct: 24  LVLTQAAVKKVRTI-MDSRPDMIGLKVGVRTRGCNGLSYTIEYAKEKN-KQDEVVVQDGV 81

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V ID  + L +LGTE+D++  KL S FVFHNPN    CGCG+S  +
Sbjct: 82  TVLIDKKAQLTLLGTEMDYQESKLASEFVFHNPNIKGTCGCGESFSL 128


>gi|50120789|ref|YP_049956.1| iron-sulfur cluster assembly scaffold protein [Pectobacterium
           atrosepticum SCRI1043]
 gi|49611315|emb|CAG74762.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 123

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 71/108 (65%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDG 63
           +T+T++AV +IK ++   +   QG+R+ +K+ GCAG  Y++DLV +   + DDLI E+DG
Sbjct: 19  LTLTDSAVKQIKNLMTQDEA-VQGLRLGVKQSGCAGFGYVLDLVQE--FETDDLIFERDG 75

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            K+++   ++ ++ GTE+DF  E L   F F+NP    ACGCG+S  I
Sbjct: 76  AKLYVPLKAMPFIDGTELDFVREGLNQIFKFNNPRAQHACGCGESFGI 123


>gi|333005926|gb|EGK25442.1| feS assembly scaffold SufA [Shigella flexneri K-272]
 gi|333018829|gb|EGK38122.1| feS assembly scaffold SufA [Shigella flexneri K-227]
          Length = 120

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 16  LTLTPAAAIHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 73

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   S+ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 74  KLFVPLQSMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 120


>gi|320181290|gb|EFW56209.1| Iron binding protein SufA for iron-sulfur cluster assembly
           [Shigella boydii ATCC 9905]
 gi|332090824|gb|EGI95916.1| feS assembly scaffold SufA [Shigella boydii 5216-82]
          Length = 122

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 18  LTLTPAAAIHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   S+ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 76  KLFVPLQSMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 122


>gi|229844536|ref|ZP_04464676.1| hypothetical protein CGSHi6P18H1_09480 [Haemophilus influenzae
           6P18H1]
 gi|319896705|ref|YP_004134898.1| hypothetical protein HIBPF03230 [Haemophilus influenzae F3031]
 gi|229812785|gb|EEP48474.1| hypothetical protein CGSHi6P18H1_09480 [Haemophilus influenzae
           6P18H1]
 gi|317432207|emb|CBY80559.1| conserved hypothetical protein [Haemophilus influenzae F3031]
          Length = 107

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+K  + N +GK  G+R+ +K  GC+GL Y+++ V D     D + E+ GV
Sbjct: 3   ITLTEKAAQRVKAFLDN-RGKGIGLRLGVKTSGCSGLAYVLEFV-DVLNSEDQVFEQHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S +Y+ G E+D+  E L  GF ++NPN   +CGCG+S  +
Sbjct: 61  NIIVDPKSFVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV 107


>gi|170702001|ref|ZP_02892921.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria
           IOP40-10]
 gi|171320034|ref|ZP_02909105.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria
           MEX-5]
 gi|172061079|ref|YP_001808731.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria
           MC40-6]
 gi|170133091|gb|EDT01499.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria
           IOP40-10]
 gi|171094727|gb|EDT39770.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria
           MEX-5]
 gi|171993596|gb|ACB64515.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria
           MC40-6]
          Length = 107

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYLVR-RGKGVGLRLGVRTTGCSGLAYKLEYV-DELAPEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GT++DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDPKSLAYIDGTQLDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|254439049|ref|ZP_05052543.1| hypothetical protein OA307_3919 [Octadecabacter antarcticus 307]
 gi|198254495|gb|EDY78809.1| hypothetical protein OA307_3919 [Octadecabacter antarcticus 307]
          Length = 108

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 63/105 (60%), Gaps = 4/105 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T+ A  R+ EI  N+ GKA  +RI +K GGC+G EY +DL  D   D D ++E  G KV
Sbjct: 8   VTQRAFERLSEIGANADGKA--LRIGVKGGGCSGFEYEIDL--DEAKDNDLILEGSGQKV 63

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IDS SL ++    IDF  E + + FV  NPN  S+CGCG S  +
Sbjct: 64  VIDSISLPFLSDATIDFTEELIGARFVIENPNASSSCGCGVSFSM 108


>gi|317122268|ref|YP_004102271.1| iron-sulfur cluster assembly accessory protein [Thermaerobacter
           marianensis DSM 12885]
 gi|315592248|gb|ADU51544.1| iron-sulfur cluster assembly accessory protein [Thermaerobacter
           marianensis DSM 12885]
          Length = 124

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 64/109 (58%), Gaps = 1/109 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T  A  +++E++   +     +R+ ++ GGC+G  Y +   + N  D D +IE+DG
Sbjct: 1   MITLTPEAARKVRELLAERRRDDLALRVFVQPGGCSGFSYGLAFDS-NRSDDDQVIEQDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           ++V +D+ S  ++ G +ID+      SGF  HNPN +  CGCGQS   +
Sbjct: 60  IRVVVDAMSARFLKGAQIDYVESLAGSGFAIHNPNAIHTCGCGQSFRTR 108


>gi|296135541|ref|YP_003642783.1| iron-sulfur cluster assembly protein IscA [Thiomonas intermedia
           K12]
 gi|294339670|emb|CAZ88030.1| Iron-binding protein iscA (Iron-sulfur cluster assembly protein)
           [Thiomonas sp. 3As]
 gi|295795663|gb|ADG30453.1| iron-sulfur cluster assembly protein IscA [Thiomonas intermedia
           K12]
          Length = 107

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE A  +++  +   +G   G+R+ +K  GC+G+ Y ++ V D   + D + +  GV
Sbjct: 3   VTLTERAAEQVQRHL-AKRGAGLGVRLGIKTTGCSGMAYKLEFV-DQASEEDQVFDSHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y+ GTE+DF  + L  GF F+NPN+   CGCG+S  +
Sbjct: 61  KILVDPKSLAYVDGTELDFVRQGLNEGFQFNNPNEKDRCGCGESFRV 107


>gi|78066899|ref|YP_369668.1| Iron-sulphur cluster assembly protein IscA [Burkholderia sp. 383]
 gi|77967644|gb|ABB09024.1| Iron-sulfur cluster assembly protein IscA [Burkholderia sp. 383]
          Length = 107

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ISLTEKAAQHVQKYLVR-RGKGVGLRLGVRTTGCSGLAYKLEYV-DELAPEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|17545740|ref|NP_519142.1| hypothetical protein RSc1021 [Ralstonia solanacearum GMI1000]
 gi|17428034|emb|CAD14723.1| conserved hypothetical protein [Ralstonia solanacearum GMI1000]
          Length = 106

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A   +   +   +GK  G+R+ +K  GC+GL Y ++   D     D++ E +G
Sbjct: 1   MITLTEKAAQHVTRYL-ARRGKGVGLRVGVKTTGCSGLAYKLEYA-DEIAAEDNVFESNG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV +D  SL Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 59  VKVIVDPKSLPYIDGTELDYAREGLNEGFRFNNPNVKDECGCGESFRV 106


>gi|220910157|ref|YP_002485468.1| iron-sulfur cluster assembly accessory protein [Cyanothece sp. PCC
           7425]
 gi|219866768|gb|ACL47107.1| iron-sulfur cluster assembly accessory protein [Cyanothece sp. PCC
           7425]
          Length = 121

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 69/109 (63%), Gaps = 5/109 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKA--QGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           V +TE A +R++  + +S   +  +GIRI +K GGC+G +Y +DL T  P + +DLIE+ 
Sbjct: 3   VILTEKAEFRLRAFLQSSANPSPDKGIRIGVKDGGCSGYQYTLDL-TSAPGN-EDLIEQQ 60

Query: 63  G-VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           G V+++ID+ S   + G  IDF    L SGF F NPN   +CGCGQS +
Sbjct: 61  GRVRLYIDANSAPLLNGVVIDFVDSLLESGFKFSNPNATDSCGCGQSFQ 109


>gi|114707220|ref|ZP_01440118.1| hypothetical protein FP2506_04916 [Fulvimarina pelagi HTCC2506]
 gi|114537416|gb|EAU40542.1| hypothetical protein FP2506_04916 [Fulvimarina pelagi HTCC2506]
          Length = 113

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+++ A  RI  I+  S G +  +R+S++ GGC+G  Y  DL ++   D D ++E+DG 
Sbjct: 9   VTLSDNAAKRIANILAKSPG-SNSLRVSVEGGGCSGFSYKYDLTSETEAD-DLVLERDGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V ID  S++Y+ G+ IDF  + +   F   NPN V++CGCG S  I
Sbjct: 67  RVVIDQISVVYLDGSVIDFVDDLMGQSFQIRNPNAVASCGCGTSFSI 113


>gi|94496625|ref|ZP_01303201.1| hypothetical protein SKA58_18012 [Sphingomonas sp. SKA58]
 gi|94423985|gb|EAT09010.1| hypothetical protein SKA58_18012 [Sphingomonas sp. SKA58]
          Length = 119

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T  A  RI +++  +     G+++S  + GC+GL Y VD VT+     D+ IE  G 
Sbjct: 14  VILTPNAEARIADLMAQAPAGTIGVKLSTPRRGCSGLAYSVDYVTEE-AKFDEKIETPGG 72

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             +ID AS+LY++G+ +D+  +   +GFVF+NPN   +CGCG+S  +
Sbjct: 73  TFYIDGASVLYLVGSTMDWVEDDFTAGFVFNNPNAKGSCGCGESFTV 119


>gi|71907581|ref|YP_285168.1| HesB/YadR/YfhF:Iron-sulphur cluster assembly protein IscA
           [Dechloromonas aromatica RCB]
 gi|71847202|gb|AAZ46698.1| HesB/YadR/YfhF:Iron-sulfur cluster assembly protein IscA
           [Dechloromonas aromatica RCB]
          Length = 107

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 68/108 (62%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDG 63
           VT+++ A   +   +   +GK  G+R+ ++  GC+G+ Y ++ V +  V+ DDL+ E++G
Sbjct: 3   VTLSDKAAQHVANFL-TKRGKGIGLRLGVRTSGCSGMAYKLEFVDE--VNPDDLVFEQNG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VK+ +D+ SL Y+ G E+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 60  VKIIVDAKSLPYLDGMELDFAREGLNEGFKFNNPNVKDQCGCGESFNV 107


>gi|39935921|ref|NP_948197.1| HesB/YadR/YfhF [Rhodopseudomonas palustris CGA009]
 gi|39649775|emb|CAE28297.1| Protein of unknown function, HesB/YadR/YfhF [Rhodopseudomonas
           palustris CGA009]
          Length = 110

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 69/109 (63%), Gaps = 6/109 (5%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQG--IRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           VT++E A  RI EI+   +G+ QG  +RIS++ GGC+G +Y  D V     D D +I K+
Sbjct: 6   VTISERAARRIGEIL---KGEGQGAMLRISVEGGGCSGFQYKFD-VDRTKTDDDLVIAKE 61

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G  V +DSAS+ ++ G+E+DF  + + + F  +NPN  ++CGCG S  I
Sbjct: 62  GAVVLVDSASVPFLAGSEVDFVDDLIGASFRVNNPNATASCGCGTSFSI 110


>gi|75910143|ref|YP_324439.1| HesB/YadR/YfhF protein [Anabaena variabilis ATCC 29413]
 gi|1170197|sp|P46051|HESB1_ANAVT RecName: Full=Protein hesB, heterocyst
 gi|599645|emb|CAA86985.1| unknown [Anabaena variabilis ATCC 29413]
 gi|75703868|gb|ABA23544.1| HesB/YadR/YfhF [Anabaena variabilis ATCC 29413]
          Length = 123

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 49/109 (44%), Positives = 67/109 (61%), Gaps = 7/109 (6%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKA----QGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           VT+TE A +R++  +  S   A    +GIRIS+K GGC+G EY++D VT  P   DDL+ 
Sbjct: 3   VTLTEKAEFRLRAFLRGSAKDANETTKGIRISVKDGGCSGYEYLMD-VTSQP-QPDDLVS 60

Query: 61  KDG-VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           + G V V++D+ S   + G  IDF    + SGF F NPN  S CGCG+S
Sbjct: 61  QQGSVLVYVDAKSAPLLEGIVIDFVEGLVESGFKFTNPNATSTCGCGKS 109


>gi|224823934|ref|ZP_03697043.1| iron-sulfur cluster assembly protein IscA [Lutiella nitroferrum
           2002]
 gi|224604389|gb|EEG10563.1| iron-sulfur cluster assembly protein IscA [Lutiella nitroferrum
           2002]
          Length = 107

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++E A   ++  +   +GK  GIR+ +K  GC+G+ Y ++ V D   D D   +  GV
Sbjct: 3   ITLSERAADHVRNFI-AKRGKGLGIRLGVKTSGCSGMAYKLEFV-DVASDEDVTFQSHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V+ D+ SL Y+ GTE+D+  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  TVFTDAKSLAYLDGTELDYAKEGLNEGFQFNNPNVKNECGCGESFNV 107


>gi|319408657|emb|CBI82312.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 107

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +++ A  RI +I+ +S+     +RIS++ GGC+G  Y  DLV+++  D D +I+KDG 
Sbjct: 3   IKISDFAAKRIAQIL-SSKPDKIALRISVEGGGCSGFSYKYDLVSESRED-DLVIKKDGA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + IDS SL +M G E+DF    +   F  HNPN  S+CGCG S  I
Sbjct: 61  VILIDSLSLPFMKGAEVDFVDNLMEQSFQIHNPNAASSCGCGVSFSI 107


>gi|307294778|ref|ZP_07574620.1| iron-sulfur cluster assembly accessory protein [Sphingobium
           chlorophenolicum L-1]
 gi|306879252|gb|EFN10470.1| iron-sulfur cluster assembly accessory protein [Sphingobium
           chlorophenolicum L-1]
          Length = 119

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T AA  RI +++  +     G+++S  + GC+GL Y VD V++     D+ IE  G 
Sbjct: 14  VILTPAAEQRIADLMAQAPDGTIGVKLSTPRRGCSGLAYSVDYVSEE-AKFDEKIETPGG 72

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             +ID AS+LY++G+ +D+  +   +GFVF+NPN   +CGCG+S  +
Sbjct: 73  TFYIDGASVLYLVGSTMDWVEDDFTAGFVFNNPNAKGSCGCGESFTV 119


>gi|254780287|ref|YP_003064700.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039964|gb|ACT56760.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 109

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 63/111 (56%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M  I+ +T+AA  +IK I+  S    + +RI+++ GGC+G  Y  DL +    D D + E
Sbjct: 1   MVPIIKITDAAATQIKTIL-ESNSDKKALRITIEGGGCSGFSYKFDLESKQSED-DIVFE 58

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+G +++ID  SL Y+  +EIDF    L   F   NPN  S CGCG S  I
Sbjct: 59  KNGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI 109


>gi|296189815|ref|XP_002742931.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Callithrix jacchus]
          Length = 176

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV +IK++    + +  G+++ ++  GC GL Y ++  T    D D+ + +DGV
Sbjct: 72  LTLTPAAVNKIKQL-LKDKPEHVGVKVGVRTRGCNGLSYTLEY-TKTKGDSDEEVIQDGV 129

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 130 RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 176


>gi|295676939|ref|YP_003605463.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp.
           CCGE1002]
 gi|295436782|gb|ADG15952.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp.
           CCGE1002]
          Length = 107

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGIGLRVGVRTTGCSGLAYKLEYV-DELAPEDQVFETGGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GT++DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTQLDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|206578670|ref|YP_002238016.1| FeS assembly scaffold SufA [Klebsiella pneumoniae 342]
 gi|288935004|ref|YP_003439063.1| FeS assembly scaffold SufA [Klebsiella variicola At-22]
 gi|290509065|ref|ZP_06548436.1| FeS assembly scaffold SufA [Klebsiella sp. 1_1_55]
 gi|206567728|gb|ACI09504.1| FeS assembly scaffold SufA [Klebsiella pneumoniae 342]
 gi|288889713|gb|ADC58031.1| FeS assembly scaffold SufA [Klebsiella variicola At-22]
 gi|289778459|gb|EFD86456.1| FeS assembly scaffold SufA [Klebsiella sp. 1_1_55]
          Length = 125

 Score = 83.6 bits (205), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT AA   I++++   Q   +G+R+ +K  GCAG  Y+++++ + P   D L E DG 
Sbjct: 18  LTMTPAAAAHIRDLM-RKQPDKKGLRLGIKTSGCAGFGYVLEMIAE-PAADDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           K+W    ++ ++ GTE+D+  E L   F FHNP     CGCG+S  ++
Sbjct: 76  KLWAPLQAMPFIDGTELDYVREGLNEIFKFHNPKAQHECGCGESFGVQ 123


>gi|163868518|ref|YP_001609727.1| hypothetical protein Btr_1370 [Bartonella tribocorum CIP 105476]
 gi|161018174|emb|CAK01732.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 107

 Score = 83.6 bits (205), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +++AA  +I +I+     K   +RIS++ GGC+G  Y  +LV++   D D +++KDG 
Sbjct: 3   VKISDAAANQIIQILLREPDKI-ALRISVEGGGCSGFSYKYELVSEMCED-DLVLKKDGA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V IDS SL +M G EIDF  + +   F  HNPN VS+CGCG S  I
Sbjct: 61  TVLIDSLSLPFMEGAEIDFVDDLMEQSFQIHNPNAVSSCGCGVSFSI 107


>gi|254293756|ref|YP_003059779.1| iron-sulfur cluster assembly accessory protein [Hirschia baltica
           ATCC 49814]
 gi|254042287|gb|ACT59082.1| iron-sulfur cluster assembly accessory protein [Hirschia baltica
           ATCC 49814]
          Length = 109

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 63/112 (56%), Gaps = 4/112 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI- 59
           M D VT+T +A  RIK  +    G A  +RI +  GGC+G  Y  D    N  + DD++ 
Sbjct: 1   MQDKVTITASAADRIK-FILKDNGNASMLRIGVLGGGCSGFSYTFDFA--NETNEDDIVF 57

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           E+D  KV ID  S+ ++ G EIDF  E + S F  +NPN  ++CGCG S  +
Sbjct: 58  ERDDAKVVIDETSIPFLEGCEIDFVNELIGSSFKINNPNATASCGCGTSFSV 109


>gi|225440900|ref|XP_002282752.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297740107|emb|CBI30289.3| unnamed protein product [Vitis vinifera]
          Length = 133

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 67/104 (64%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA  RI+ ++   Q +   +R+ +K  GC GL Y ++   D+    D+L+E  GV
Sbjct: 22  LTLTDAAASRIRHLL--QQRQRTFLRLGVKARGCNGLSYTLNYA-DDKGKFDELVEDKGV 78

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+ ID  +L++++GT++DF  +KL S F+F NPN    CGCG+S
Sbjct: 79  KILIDPKALMHVIGTKMDFVDDKLRSEFIFINPNSKGQCGCGES 122


>gi|315122847|ref|YP_004063336.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496249|gb|ADR52848.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 109

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 67/111 (60%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+ I+ +T+AA  +IK I+  S+   + +RIS++ GGC+G  Y  +L +    D D + E
Sbjct: 1   MASIINITDAAAKQIKTIL-ESEHDKKALRISIEGGGCSGFSYKFELESKKCED-DVVFE 58

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+G +V+ID  SL Y+  +EIDF    L   F   NPN +S+CGCG S  +
Sbjct: 59  KNGSQVFIDKISLSYIANSEIDFVDTLLSKSFQIRNPNAISSCGCGTSFSM 109


>gi|260575669|ref|ZP_05843666.1| iron-sulfur cluster assembly accessory protein [Rhodobacter sp.
           SW2]
 gi|259022067|gb|EEW25366.1| iron-sulfur cluster assembly accessory protein [Rhodobacter sp.
           SW2]
          Length = 106

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T AA   I+  +  +     G+R+ ++ GGCAGL+Y + L  D    GD +IE DG
Sbjct: 1   MIEITPAARDAIRTAIAGAAQPVAGLRVMVQTGGCAGLKYGMALELDA-APGDAVIESDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           V V +D+ S  ++ G  IDF +    +GFVF NPN  S+CGCG+S
Sbjct: 60  VTVLVDAESQAHLQGATIDFVSNLEGAGFVFDNPNATSSCGCGKS 104


>gi|324505849|gb|ADY42507.1| Iron-sulfur cluster assembly 1 [Ascaris suum]
          Length = 705

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV R+K ++   + + + ++I +++ GC GL Y ++   +     D+ + +DGV
Sbjct: 601 LTLTPEAVQRVK-LLMQKEPEMKALKIGVRQRGCNGLTYTLNYAKEKG-KFDEEVVQDGV 658

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+WID+ + L +LGTE+D+    L S FVF NPN    CGCG+S  I
Sbjct: 659 KIWIDTKAQLTLLGTEMDYIKSPLSSEFVFRNPNIKGTCGCGESFSI 705


>gi|195045788|ref|XP_001992036.1| GH24545 [Drosophila grimshawi]
 gi|193892877|gb|EDV91743.1| GH24545 [Drosophila grimshawi]
          Length = 130

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 70/108 (64%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLV-TDNPVDGDDLIEKDG 63
           +T+T AAV RIK ++ + +    G+++ +++ GC GL Y ++   T + +D + L  +DG
Sbjct: 26  LTLTPAAVQRIKSLLHD-KPDVIGLKVGVRQRGCNGLSYTLNYASTKDKLDEEVL--QDG 82

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  +
Sbjct: 83  VKVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFSM 130


>gi|255531464|ref|YP_003091836.1| iron-sulfur cluster assembly accessory protein [Pedobacter
           heparinus DSM 2366]
 gi|255344448|gb|ACU03774.1| iron-sulfur cluster assembly accessory protein [Pedobacter
           heparinus DSM 2366]
          Length = 108

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 64/109 (58%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++T+TE A  +I +++  SQ      +R+S+K GGC+GL Y +D   D    GD   E  
Sbjct: 1   MITITEKAKSKIDQLMEESQMDTTYFLRVSVKGGGCSGLSYNLDF-DDEEKAGDQFFEDK 59

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G+++ +D  S LY+ GTE+DF       GF F+NPN   +CGCG+S  +
Sbjct: 60  GIRIALDMKSFLYLAGTELDFSDGLNGKGFNFNNPNASRSCGCGESFSV 108


>gi|170594738|ref|XP_001902112.1| Iron-sulfur cluster assembly accessory protein [Brugia malayi]
 gi|158590409|gb|EDP29041.1| Iron-sulfur cluster assembly accessory protein [Brugia malayi]
          Length = 712

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 64/105 (60%), Gaps = 2/105 (1%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  AV R+K  + + Q +   ++IS+++ GC GL Y +D         D+ + +DGV++
Sbjct: 610 LTPEAVKRVK-YLLSKQPETTALKISVRQRGCNGLTYTLDYAQQK-AKFDEEVVQDGVRL 667

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           WID  + L +LG+E+D+  ++L S FVF NPN    CGCG+S  I
Sbjct: 668 WIDPKAQLSLLGSEMDYVEDRLSSEFVFRNPNIKGTCGCGESFSI 712


>gi|308174910|ref|YP_003921615.1| chaperone involved in Fe-S cluster assembly [Bacillus
           amyloliquefaciens DSM 7]
 gi|307607774|emb|CBI44145.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           amyloliquefaciens DSM 7]
 gi|328554917|gb|AEB25409.1| chaperone involved in Fe-S cluster assembly [Bacillus
           amyloliquefaciens TA208]
 gi|328913228|gb|AEB64824.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           amyloliquefaciens LL3]
          Length = 120

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 65/113 (57%), Gaps = 1/113 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  VT+TEAA   IK+++   + +   +R+ +K GGC+GL Y +    +   + D L E
Sbjct: 1   MSVPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKG-EKDSLFE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
           + G+ V +DS SL  M GT IDFK   +  GF   NPN +++CGCG S    +
Sbjct: 60  QHGINVLVDSESLDIMNGTIIDFKQSMMGGGFTIDNPNAIASCGCGSSFRTAK 112


>gi|149202738|ref|ZP_01879710.1| Iron-sulfur cluster assembly family protein [Roseovarius sp.
           TM1035]
 gi|149144020|gb|EDM32054.1| Iron-sulfur cluster assembly family protein [Roseovarius sp.
           TM1035]
          Length = 107

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 4/105 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A  R+ EI    QG+A  +R++++ GGC+G +Y + L  D P   D ++E DG KV
Sbjct: 7   VTPRAFARLAEIGAGDQGQA--LRVAVEGGGCSGFQYEIKL--DEPAQDDLILEGDGQKV 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +DS SL ++ G  IDF  E + + F+  NPN  S+CGCG S  +
Sbjct: 63  VVDSTSLPFLAGATIDFSEELIGARFIIDNPNASSSCGCGTSFSM 107


>gi|322795676|gb|EFZ18355.1| hypothetical protein SINV_04847 [Solenopsis invicta]
          Length = 130

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV +IKEI+   + +  G+++ +++ GC GL Y +D   +     +++I+ DGV
Sbjct: 26  LTLTPIAVKKIKEIL-KDKSEYIGLKVGVRQRGCNGLSYTLDYAKEKSKLDEEVIQ-DGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +++ID  + L +LGTE+D+   KL S F+F+NPN    CGCG+S  +
Sbjct: 84  RIFIDRKAQLSLLGTEMDYTENKLSSEFIFNNPNIKGTCGCGESFSV 130


>gi|253575297|ref|ZP_04852635.1| iron-sulfur cluster assembly accessory protein [Paenibacillus sp.
           oral taxon 786 str. D14]
 gi|251845294|gb|EES73304.1| iron-sulfur cluster assembly accessory protein [Paenibacillus sp.
           oral taxon 786 str. D14]
          Length = 118

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 64/109 (58%), Gaps = 1/109 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ ++++A+ RIK+++   +     +R+ +  GGC+G  Y + L  D   + D  ++  G
Sbjct: 1   MINISDSALARIKDMIAQEETPNMFLRVGVNPGGCSGFSYGMGL-DDQESEQDVYMDIKG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           +KV +D  S+ Y+ G EIDFK   L  GF  HNPN ++ CGCGQS   K
Sbjct: 60  LKVVVDKDSIRYLNGLEIDFKESGLSGGFTIHNPNAIATCGCGQSFRFK 108


>gi|294013378|ref|YP_003546838.1| hypothetical protein SJA_C1-33920 [Sphingobium japonicum UT26S]
 gi|292676708|dbj|BAI98226.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 119

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T AA  RI +++  +     G+++S  + GC+GL Y VD V++     D+ IE  G 
Sbjct: 14  VILTPAAEQRIADLMAQAPEGTIGVKLSTPRRGCSGLAYSVDYVSEE-AKFDEKIETPGG 72

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             +ID AS+LY++G+ +D+  +   +GFVF+NPN   +CGCG+S  +
Sbjct: 73  TFYIDGASVLYLVGSTMDWVEDDFAAGFVFNNPNAKGSCGCGESFTV 119


>gi|149908841|ref|ZP_01897501.1| hypothetical protein PE36_21609 [Moritella sp. PE36]
 gi|149808115|gb|EDM68056.1| hypothetical protein PE36_21609 [Moritella sp. PE36]
          Length = 107

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++++A  R+   + + +GK  G+R+ +K  GC+GL Y+++ V D+  + D++  + GV
Sbjct: 3   VTLSDSAAARVASYL-DKRGKGAGLRLGVKTSGCSGLAYVLEFV-DSIDENDEVFVEKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  SL+Y+ G E+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  TVIVDKKSLVYLDGIELDFVKEGLNEGFEFNNPNLKGECGCGESFNV 107


>gi|329123598|ref|ZP_08252158.1| iron-sulfur cluster assembly protein IscA [Haemophilus aegyptius
           ATCC 11116]
 gi|327469797|gb|EGF15262.1| iron-sulfur cluster assembly protein IscA [Haemophilus aegyptius
           ATCC 11116]
          Length = 107

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +TE A  R+K  + N +GK  G+R+ +K  GC+GL Y+++ V D     D + E+ GV
Sbjct: 3   IALTEKAAQRVKAFLDN-RGKGIGLRLGVKTSGCSGLAYVLEFV-DVLNSEDQVFEQHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL+Y+ G E+D+  E L  GF ++NPN   +CGCG+S  +
Sbjct: 61  NIIVDPKSLVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV 107


>gi|190575043|ref|YP_001972888.1| putative iron-sulfur cluster assembly protein [Stenotrophomonas
           maltophilia K279a]
 gi|190012965|emb|CAQ46597.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]
          Length = 112

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 62/104 (59%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T  A  R++  V  + G A G+R  + K GC+G  ++ DL  D   +GD + E+DGV
Sbjct: 3   VSLTPIAFERVQRFVAQTPG-ALGLRFGVTKTGCSGWGHITDLARDER-EGDTVFEQDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+++D+ SL  + GT IDF    L   F F NPN  + CGCG+S
Sbjct: 61  KIYVDAKSLALVDGTVIDFGKHGLSETFTFSNPNATAECGCGES 104


>gi|126333881|ref|XP_001362457.1| PREDICTED: similar to HESB like domain containing 2, [Monodelphis
           domestica]
          Length = 129

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK +    + +  G+R+ ++  GC GL Y ++  T    D D+ + +DG+
Sbjct: 25  LTLTPSAVNKIKHL-LKDKPENVGLRVGVRTRGCNGLSYTLEY-TKTKGDSDEEVVQDGI 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|154687328|ref|YP_001422489.1| YutM [Bacillus amyloliquefaciens FZB42]
 gi|154353179|gb|ABS75258.1| YutM [Bacillus amyloliquefaciens FZB42]
          Length = 120

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 65/113 (57%), Gaps = 1/113 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  VT+TEAA   IK+++   + +   +R+ +K GGC+GL Y +    +   + D + E
Sbjct: 1   MSVPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKG-EKDSMFE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
           + G+ V +DS SL  M GT IDFK   +  GF   NPN +++CGCG S    +
Sbjct: 60  QHGITVLVDSESLDIMTGTIIDFKQSMMGGGFTIDNPNAIASCGCGSSFRTAK 112


>gi|45201063|ref|NP_986633.1| AGL033Cp [Ashbya gossypii ATCC 10895]
 gi|44985846|gb|AAS54457.1| AGL033Cp [Ashbya gossypii ATCC 10895]
          Length = 265

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 69/105 (65%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ ++  A+  +K ++   Q + Q IRI ++  GC+GL Y +  + + P + D++IE+DG
Sbjct: 161 LIKLSPDALVHLKALL--DQPEPQLIRIGVRNRGCSGLTYDLQYIKE-PGEFDEVIEQDG 217

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV IDS +L  ++G+E+D+  +KL S FVF NPN    CGCG+S
Sbjct: 218 VKVVIDSKALFSIVGSEMDWIDDKLSSRFVFKNPNSKGTCGCGES 262


>gi|294886607|ref|XP_002771782.1| iron-sulfur cluster assembly protein, putative [Perkinsus marinus
           ATCC 50983]
 gi|239875544|gb|EER03598.1| iron-sulfur cluster assembly protein, putative [Perkinsus marinus
           ATCC 50983]
          Length = 133

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 70/109 (64%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQ-GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++T+T AA  RIK+++   +  +  G+R+ + K GC  + Y ++   D     D+++E +
Sbjct: 26  VMTVTPAAASRIKDLMNKKRDDSIIGLRVGVGKKGCENMSYTMNYARDIG-KLDEVVETE 84

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVKV +D  +L+Y++GT++D+    L S FVF NPNQ S+CGCG+S  +
Sbjct: 85  GVKVVVDPNALMYLIGTQMDYVDNDLASEFVFTNPNQKSSCGCGKSFSV 133


>gi|227111733|ref|ZP_03825389.1| iron-sulfur cluster assembly scaffold protein [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
 gi|227327025|ref|ZP_03831049.1| iron-sulfur cluster assembly scaffold protein [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
 gi|261822007|ref|YP_003260113.1| iron-sulfur cluster assembly scaffold protein [Pectobacterium
           wasabiae WPP163]
 gi|261606020|gb|ACX88506.1| FeS assembly scaffold SufA [Pectobacterium wasabiae WPP163]
          Length = 123

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T++AV +IK ++   +   QG+R+ +K+ GCAG  Y++DLV +   D D + E+DG 
Sbjct: 19  LTLTDSAVKQIKNLMKQDEA-VQGLRLGVKQSGCAGFGYVLDLVQEFETD-DLVFERDGA 76

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F F+NP    ACGCG+S  I
Sbjct: 77  KLYVPLKAMPFIDGTELDFVREGLNQIFKFNNPRAQHACGCGESFGI 123


>gi|39033|emb|CAA33559.1| unnamed protein product [Nostoc sp. PCC 7120]
          Length = 113

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 68/111 (61%), Gaps = 7/111 (6%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKA----QGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           VT+TE A +R++  +  S   A    +GIR+S+K GGC+G EY++D VT  P   DDL+ 
Sbjct: 3   VTLTEKAEFRLRAFLRGSAKDANETTKGIRVSVKDGGCSGYEYLMD-VTSQP-QPDDLVT 60

Query: 61  KDG-VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           + G V V++D+ S   + G  IDF    + SGF F NPN  S CGCG+S +
Sbjct: 61  QQGSVLVYVDAKSAPLLEGIVIDFVEGLVESGFKFTNPNATSTCGCGKSFK 111


>gi|194434800|ref|ZP_03067050.1| FeS assembly scaffold SufA [Shigella dysenteriae 1012]
 gi|194416969|gb|EDX33088.1| FeS assembly scaffold SufA [Shigella dysenteriae 1012]
 gi|332093958|gb|EGI99011.1| feS assembly scaffold SufA [Shigella dysenteriae 155-74]
          Length = 122

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 18  LTLTPAAAIHIRELVAKQLGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   S+ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 76  KLFVPLQSMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 122


>gi|91977267|ref|YP_569926.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisB5]
 gi|91683723|gb|ABE40025.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisB5]
          Length = 110

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E A  RI EI+   +G    +RIS++ GGC+G +Y  D V     D D +I +DG 
Sbjct: 6   VTISERAARRIGEIL-KGEGNGAMLRISVEGGGCSGFQYKFD-VDRAQTDDDLVIARDGA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +DSAS+ ++ G+E+DF  + + + F  +NPN  S CGCG S  +
Sbjct: 64  VVLVDSASVPFLAGSEVDFVDDLIGASFRVNNPNATSGCGCGTSFSM 110


>gi|291233939|ref|XP_002736905.1| PREDICTED: HESB like domain containing 2-like [Saccoglossus
           kowalevskii]
          Length = 130

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +TE+A  +IK ++ + + +  G+RI +K  GC GL Y +D   +     +++I+ +G 
Sbjct: 26  LNLTESAATKIKTLMAD-KPQVLGVRIGVKTRGCNGLSYTLDYAYEKQKFDEEVIQ-NGA 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV+IDS + L +LGTE+DF   KL S FVF NPN    CGCG+S  +
Sbjct: 84  KVYIDSKAQLTLLGTEMDFVENKLSSEFVFTNPNIKGTCGCGESFNV 130


>gi|328951140|ref|YP_004368475.1| iron-sulfur cluster assembly accessory protein [Marinithermus
           hydrothermalis DSM 14884]
 gi|328451464|gb|AEB12365.1| iron-sulfur cluster assembly accessory protein [Marinithermus
           hydrothermalis DSM 14884]
          Length = 128

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 61/105 (58%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++TE A  R +EI+         IR+ +K GGC+G +Y +  + +  ++GD  +E  G
Sbjct: 7   VISITETAAARAREILERHNKPNAAIRVFIKSGGCSGYQYGM-AIDERELEGDTFVEMHG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VK+ +D  SL  ++G+ ID+    +  GF  HNPN  S CGCG S
Sbjct: 66  VKLVVDRMSLPLLVGSTIDWVESMMGGGFTVHNPNATSTCGCGHS 110


>gi|323187108|gb|EFZ72424.1| feS assembly scaffold SufA [Escherichia coli RN587/1]
          Length = 120

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 16  LTLTPAAAVHIRELVAKQPGMI-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 73

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 74  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFAV 120


>gi|52426768|ref|NP_112202.2| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Homo sapiens]
 gi|77735891|ref|NP_001029642.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Bos taurus]
 gi|114701127|ref|XP_001136504.1| PREDICTED: similar to GK004 isoform 2 [Pan troglodytes]
 gi|74761270|sp|Q9BUE6|ISCA1_HUMAN RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Short=hIscA; Flags: Precursor
 gi|75076012|sp|Q4R5F0|ISCA1_MACFA RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|122140219|sp|Q3SZG8|ISCA1_BOVIN RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|12803679|gb|AAH02675.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Homo
           sapiens]
 gi|18025262|gb|AAG40950.1| HesB-like protein [Homo sapiens]
 gi|47940458|gb|AAH71621.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Homo
           sapiens]
 gi|55957468|emb|CAI14925.1| iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Homo
           sapiens]
 gi|67970665|dbj|BAE01675.1| unnamed protein product [Macaca fascicularis]
 gi|74354113|gb|AAI02864.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Bos taurus]
 gi|117646260|emb|CAL38597.1| hypothetical protein [synthetic construct]
 gi|193786263|dbj|BAG51546.1| unnamed protein product [Homo sapiens]
 gi|261860792|dbj|BAI46918.1| iron-sulfur cluster assembly 1 homolog [synthetic construct]
 gi|296484504|gb|DAA26619.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Bos taurus]
          Length = 129

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK++    + +  G+++ ++  GC GL Y ++  T    D D+ + +DGV
Sbjct: 25  LTLTPSAVNKIKQL-LKDKPEHVGVKVGVRTRGCNGLSYTLEY-TKTKGDSDEEVIQDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|300121078|emb|CBK21460.2| Scaffold protein Isa2 [Blastocystis hominis]
          Length = 148

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 71/111 (63%), Gaps = 6/111 (5%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLV---TDNPVDGDDLIEK 61
           VT+T AA  R++E++ + +    G+ +S    GC G +Y++       + P D  +++E+
Sbjct: 41  VTLTTAAENRVRELL-SKKPAGTGLLLSTTTKGCNGNKYVMKYCEPGKEGPFD--EIVEQ 97

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           +G+KV +D+ SL+Y+LGT+IDFK + + + FVF NP   S CGCG+S  +K
Sbjct: 98  NGIKVVVDADSLMYLLGTKIDFKEDDISAEFVFDNPLATSTCGCGESFSVK 148


>gi|189010449|ref|ZP_02807103.2| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4076]
 gi|189000335|gb|EDU69321.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4076]
          Length = 120

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 16  LTLTPAAAVHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 73

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 74  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 120


>gi|12584843|gb|AAG59854.1|AF284752_1 GK004 [Homo sapiens]
          Length = 130

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK++    + +  G+++ ++  GC GL Y ++  T    D D+ + +DGV
Sbjct: 26  LTLTPSAVNKIKQL-LKDKPEHVGVKVGVRTRGCNGLSYTLEY-TKTKGDSDEEVIQDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 84  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 130


>gi|296123221|ref|YP_003630999.1| iron-sulfur cluster assembly accessory protein [Planctomyces
           limnophilus DSM 3776]
 gi|296015561|gb|ADG68800.1| iron-sulfur cluster assembly accessory protein [Planctomyces
           limnophilus DSM 3776]
          Length = 110

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 63/106 (59%), Gaps = 3/106 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLV-TDNPVDGDDLIEKD 62
           VT+TE+A   I+ I+   Q  ++  +R+ +  GGC+G +Y        +PV+ D LIE  
Sbjct: 3   VTLTESAAKEIQRIISEQQMSESTLVRVGIAGGGCSGFKYNFGFEEAADPVN-DHLIEYH 61

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           GVKV ID  S LY+ GT IDF +     GFVF NPN V +CGCG S
Sbjct: 62  GVKVAIDKKSALYLDGTTIDFYSGLDRRGFVFENPNAVKSCGCGSS 107


>gi|324113449|gb|EGC07424.1| FeS assembly scaffold SufA [Escherichia fergusonii B253]
 gi|325497139|gb|EGC94998.1| iron-sulfur cluster assembly scaffold protein [Escherichia
           fergusonii ECD227]
          Length = 122

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 18  LTLTPAAAVHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 76  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 122


>gi|15802096|ref|NP_288118.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           O157:H7 EDL933]
 gi|15831645|ref|NP_310418.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           O157:H7 str. Sakai]
 gi|168751905|ref|ZP_02776927.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4113]
 gi|168756682|ref|ZP_02781689.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4401]
 gi|168762255|ref|ZP_02787262.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4501]
 gi|168770443|ref|ZP_02795450.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4486]
 gi|168775019|ref|ZP_02800026.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4196]
 gi|168789818|ref|ZP_02814825.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC869]
 gi|168800138|ref|ZP_02825145.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC508]
 gi|170682960|ref|YP_001743570.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           SMS-3-5]
 gi|188495005|ref|ZP_03002275.1| FeS assembly scaffold SufA [Escherichia coli 53638]
 gi|195937368|ref|ZP_03082750.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           O157:H7 str. EC4024]
 gi|208810537|ref|ZP_03252413.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4206]
 gi|208816544|ref|ZP_03257664.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4045]
 gi|208819538|ref|ZP_03259858.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4042]
 gi|209399898|ref|YP_002270753.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4115]
 gi|217329042|ref|ZP_03445123.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. TW14588]
 gi|218705182|ref|YP_002412701.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           UMN026]
 gi|254793301|ref|YP_003078138.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           O157:H7 str. TW14359]
 gi|261227871|ref|ZP_05942152.1| Fe-S cluster assembly protein [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261258395|ref|ZP_05950928.1| Fe-S cluster assembly protein [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291282814|ref|YP_003499632.1| FeS assembly scaffold SufA [Escherichia coli O55:H7 str. CB9615]
 gi|293405182|ref|ZP_06649174.1| sufA [Escherichia coli FVEC1412]
 gi|298380825|ref|ZP_06990424.1| sufA [Escherichia coli FVEC1302]
 gi|300898535|ref|ZP_07116868.1| FeS assembly scaffold SufA [Escherichia coli MS 198-1]
 gi|300938992|ref|ZP_07153690.1| FeS assembly scaffold SufA [Escherichia coli MS 21-1]
 gi|301026914|ref|ZP_07190310.1| FeS assembly scaffold SufA [Escherichia coli MS 69-1]
 gi|331653084|ref|ZP_08354089.1| FeS assembly scaffold SufA [Escherichia coli M718]
 gi|331663162|ref|ZP_08364072.1| FeS assembly scaffold SufA [Escherichia coli TA143]
 gi|331683191|ref|ZP_08383792.1| FeS assembly scaffold SufA [Escherichia coli H299]
 gi|12515686|gb|AAG56671.1|AE005391_8 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|13361858|dbj|BAB35814.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|170520678|gb|ACB18856.1| FeS assembly scaffold SufA [Escherichia coli SMS-3-5]
 gi|187769432|gb|EDU33276.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4196]
 gi|188014120|gb|EDU52242.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4113]
 gi|188490204|gb|EDU65307.1| FeS assembly scaffold SufA [Escherichia coli 53638]
 gi|189356188|gb|EDU74607.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4401]
 gi|189360657|gb|EDU79076.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4486]
 gi|189367488|gb|EDU85904.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4501]
 gi|189370632|gb|EDU89048.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC869]
 gi|189377596|gb|EDU96012.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC508]
 gi|208725053|gb|EDZ74760.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4206]
 gi|208730887|gb|EDZ79576.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4045]
 gi|208739661|gb|EDZ87343.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4042]
 gi|209161298|gb|ACI38731.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. EC4115]
 gi|209769148|gb|ACI82886.1| hypothetical protein ECs2391 [Escherichia coli]
 gi|209769150|gb|ACI82887.1| hypothetical protein ECs2391 [Escherichia coli]
 gi|209769152|gb|ACI82888.1| hypothetical protein ECs2391 [Escherichia coli]
 gi|209769154|gb|ACI82889.1| hypothetical protein ECs2391 [Escherichia coli]
 gi|209769156|gb|ACI82890.1| hypothetical protein ECs2391 [Escherichia coli]
 gi|217318389|gb|EEC26816.1| FeS assembly scaffold SufA [Escherichia coli O157:H7 str. TW14588]
 gi|218432279|emb|CAR13169.1| Fe-S cluster assembly protein [Escherichia coli UMN026]
 gi|254592701|gb|ACT72062.1| Fe-S cluster assembly protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|284921605|emb|CBG34677.1| Fe-S cluster assembly protein [Escherichia coli 042]
 gi|290762687|gb|ADD56648.1| FeS assembly scaffold SufA [Escherichia coli O55:H7 str. CB9615]
 gi|291427390|gb|EFF00417.1| sufA [Escherichia coli FVEC1412]
 gi|298278267|gb|EFI19781.1| sufA [Escherichia coli FVEC1302]
 gi|300357799|gb|EFJ73669.1| FeS assembly scaffold SufA [Escherichia coli MS 198-1]
 gi|300395261|gb|EFJ78799.1| FeS assembly scaffold SufA [Escherichia coli MS 69-1]
 gi|300456095|gb|EFK19588.1| FeS assembly scaffold SufA [Escherichia coli MS 21-1]
 gi|320188372|gb|EFW63034.1| Iron binding protein SufA for iron-sulfur cluster assembly
           [Escherichia coli O157:H7 str. EC1212]
 gi|320641899|gb|EFX11267.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           O157:H7 str. G5101]
 gi|320647355|gb|EFX16163.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           O157:H- str. 493-89]
 gi|320652649|gb|EFX20918.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           O157:H- str. H 2687]
 gi|320653034|gb|EFX21230.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320658718|gb|EFX26395.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|320668708|gb|EFX35513.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323968451|gb|EGB63857.1| FeS assembly scaffold SufA [Escherichia coli M863]
 gi|323978179|gb|EGB73265.1| FeS assembly scaffold SufA [Escherichia coli TW10509]
 gi|326342051|gb|EGD65832.1| Iron binding protein SufA for iron-sulfur cluster assembly
           [Escherichia coli O157:H7 str. 1044]
 gi|326343603|gb|EGD67365.1| Iron binding protein SufA for iron-sulfur cluster assembly
           [Escherichia coli O157:H7 str. 1125]
 gi|327252801|gb|EGE64455.1| feS assembly scaffold SufA [Escherichia coli STEC_7v]
 gi|331049182|gb|EGI21254.1| FeS assembly scaffold SufA [Escherichia coli M718]
 gi|331058961|gb|EGI30938.1| FeS assembly scaffold SufA [Escherichia coli TA143]
 gi|331079406|gb|EGI50603.1| FeS assembly scaffold SufA [Escherichia coli H299]
          Length = 122

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 18  LTLTPAAAVHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 76  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 122


>gi|312969709|ref|ZP_07783892.1| feS assembly scaffold SufA [Escherichia coli 1827-70]
 gi|310337994|gb|EFQ03083.1| feS assembly scaffold SufA [Escherichia coli 1827-70]
 gi|315618879|gb|EFU99462.1| feS assembly scaffold SufA [Escherichia coli 3431]
 gi|323169253|gb|EFZ54929.1| feS assembly scaffold SufA [Shigella sonnei 53G]
          Length = 120

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 16  LTLTPAAAIHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 73

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 74  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 120


>gi|58585014|ref|YP_198587.1| HesB/YadR/YfhF family protein [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58419330|gb|AAW71345.1| HesB/YadR/YfhF family protein [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 134

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 76/120 (63%), Gaps = 15/120 (12%)

Query: 5   VTMTEAAVYRIKEIVFNSQ-------GKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGD 56
           +T+T  AV RI+ ++   Q        +A GIR+ +K+ GC+GL+Y ++   D +P++  
Sbjct: 17  ITITANAVERIRYLLDQKQYTNLERSEEAIGIRVLIKQKGCSGLKYDIEYAYDIHPLES- 75

Query: 57  DLIEK---DG--VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +IE+   DG  VKV ID  S++++LG+E+D+  EK  SGFVF NPN+   CGCG+S  +
Sbjct: 76  -VIEESCSDGQKVKVLIDPKSVMFILGSEMDYVEEKFSSGFVFKNPNEKGKCGCGESFHV 134


>gi|218699751|ref|YP_002407380.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           IAI39]
 gi|218369737|emb|CAR17508.1| Fe-S cluster assembly protein [Escherichia coli IAI39]
          Length = 122

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 18  LTLTPAAAVHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 76  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 122


>gi|16129640|ref|NP_416199.1| Fe-S cluster assembly protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|74311991|ref|YP_310410.1| iron-sulfur cluster assembly scaffold protein [Shigella sonnei
           Ss046]
 gi|82543946|ref|YP_407893.1| iron-sulfur cluster assembly scaffold protein [Shigella boydii
           Sb227]
 gi|89108524|ref|AP_002304.1| Fe-S cluster assembly protein [Escherichia coli str. K-12 substr.
           W3110]
 gi|157156081|ref|YP_001462978.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           E24377A]
 gi|157161149|ref|YP_001458467.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli HS]
 gi|170081344|ref|YP_001730664.1| Fe-S cluster assembly protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|191167856|ref|ZP_03029661.1| FeS assembly scaffold SufA [Escherichia coli B7A]
 gi|193065301|ref|ZP_03046373.1| FeS assembly scaffold SufA [Escherichia coli E22]
 gi|193068930|ref|ZP_03049889.1| FeS assembly scaffold SufA [Escherichia coli E110019]
 gi|194429491|ref|ZP_03062013.1| FeS assembly scaffold SufA [Escherichia coli B171]
 gi|194438541|ref|ZP_03070630.1| FeS assembly scaffold SufA [Escherichia coli 101-1]
 gi|209918998|ref|YP_002293082.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           SE11]
 gi|218554250|ref|YP_002387163.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           IAI1]
 gi|218695245|ref|YP_002402912.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           55989]
 gi|238900899|ref|YP_002926695.1| Fe-S cluster assembly protein [Escherichia coli BW2952]
 gi|254161745|ref|YP_003044853.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli B
           str. REL606]
 gi|256018122|ref|ZP_05431987.1| iron-sulfur cluster assembly scaffold protein [Shigella sp. D9]
 gi|256022653|ref|ZP_05436518.1| iron-sulfur cluster assembly scaffold protein [Escherichia sp.
           4_1_40B]
 gi|260843990|ref|YP_003221768.1| Fe-S cluster assembly protein SufA [Escherichia coli O103:H2 str.
           12009]
 gi|260855508|ref|YP_003229399.1| Fe-S cluster assembly protein SufA [Escherichia coli O26:H11 str.
           11368]
 gi|260868175|ref|YP_003234577.1| Fe-S cluster assembly protein SufA [Escherichia coli O111:H- str.
           11128]
 gi|293415000|ref|ZP_06657643.1| FeS assembly scaffold SufA [Escherichia coli B185]
 gi|293446058|ref|ZP_06662480.1| FeS assembly scaffold SufA [Escherichia coli B088]
 gi|297518167|ref|ZP_06936553.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           OP50]
 gi|300820182|ref|ZP_07100344.1| FeS assembly scaffold SufA [Escherichia coli MS 107-1]
 gi|300821443|ref|ZP_07101590.1| FeS assembly scaffold SufA [Escherichia coli MS 119-7]
 gi|300904535|ref|ZP_07122374.1| FeS assembly scaffold SufA [Escherichia coli MS 84-1]
 gi|300924719|ref|ZP_07140665.1| FeS assembly scaffold SufA [Escherichia coli MS 182-1]
 gi|300930846|ref|ZP_07146216.1| FeS assembly scaffold SufA [Escherichia coli MS 187-1]
 gi|300951276|ref|ZP_07165125.1| FeS assembly scaffold SufA [Escherichia coli MS 116-1]
 gi|300958565|ref|ZP_07170695.1| FeS assembly scaffold SufA [Escherichia coli MS 175-1]
 gi|301027871|ref|ZP_07191172.1| FeS assembly scaffold SufA [Escherichia coli MS 196-1]
 gi|301303199|ref|ZP_07209325.1| FeS assembly scaffold SufA [Escherichia coli MS 124-1]
 gi|301326552|ref|ZP_07219893.1| FeS assembly scaffold SufA [Escherichia coli MS 78-1]
 gi|301647867|ref|ZP_07247649.1| FeS assembly scaffold SufA [Escherichia coli MS 146-1]
 gi|307138343|ref|ZP_07497699.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           H736]
 gi|307310745|ref|ZP_07590391.1| FeS assembly scaffold SufA [Escherichia coli W]
 gi|309793451|ref|ZP_07687878.1| FeS assembly scaffold SufA [Escherichia coli MS 145-7]
 gi|331642282|ref|ZP_08343417.1| FeS assembly scaffold SufA [Escherichia coli H736]
 gi|331668369|ref|ZP_08369217.1| FeS assembly scaffold SufA [Escherichia coli TA271]
 gi|331677555|ref|ZP_08378230.1| FeS assembly scaffold SufA [Escherichia coli H591]
 gi|332279167|ref|ZP_08391580.1| sufA [Shigella sp. D9]
 gi|2495208|sp|P77667|SUFA_ECOLI RecName: Full=Protein sufA
 gi|1742762|dbj|BAA15453.1| Fe-S cluster assembly protein [Escherichia coli str. K12 substr.
           W3110]
 gi|1787974|gb|AAC74754.1| Fe-S cluster assembly protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|73855468|gb|AAZ88175.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81245357|gb|ABB66065.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|157066829|gb|ABV06084.1| FeS assembly scaffold SufA [Escherichia coli HS]
 gi|157078111|gb|ABV17819.1| FeS assembly scaffold SufA [Escherichia coli E24377A]
 gi|169889179|gb|ACB02886.1| Fe-S cluster assembly protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|190902115|gb|EDV61859.1| FeS assembly scaffold SufA [Escherichia coli B7A]
 gi|192927095|gb|EDV81717.1| FeS assembly scaffold SufA [Escherichia coli E22]
 gi|192957725|gb|EDV88169.1| FeS assembly scaffold SufA [Escherichia coli E110019]
 gi|194412455|gb|EDX28755.1| FeS assembly scaffold SufA [Escherichia coli B171]
 gi|194422551|gb|EDX38549.1| FeS assembly scaffold SufA [Escherichia coli 101-1]
 gi|209912257|dbj|BAG77331.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|218351977|emb|CAU97709.1| Fe-S cluster assembly protein [Escherichia coli 55989]
 gi|218361018|emb|CAQ98593.1| Fe-S cluster assembly protein [Escherichia coli IAI1]
 gi|238861087|gb|ACR63085.1| Fe-S cluster assembly protein [Escherichia coli BW2952]
 gi|253973646|gb|ACT39317.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli B
           str. REL606]
 gi|257754157|dbj|BAI25659.1| Fe-S cluster assembly protein SufA [Escherichia coli O26:H11 str.
           11368]
 gi|257759137|dbj|BAI30634.1| Fe-S cluster assembly protein SufA [Escherichia coli O103:H2 str.
           12009]
 gi|257764531|dbj|BAI36026.1| Fe-S cluster assembly protein SufA [Escherichia coli O111:H- str.
           11128]
 gi|260449193|gb|ACX39615.1| FeS assembly scaffold SufA [Escherichia coli DH1]
 gi|291322888|gb|EFE62316.1| FeS assembly scaffold SufA [Escherichia coli B088]
 gi|291432648|gb|EFF05627.1| FeS assembly scaffold SufA [Escherichia coli B185]
 gi|299879027|gb|EFI87238.1| FeS assembly scaffold SufA [Escherichia coli MS 196-1]
 gi|300314774|gb|EFJ64558.1| FeS assembly scaffold SufA [Escherichia coli MS 175-1]
 gi|300403529|gb|EFJ87067.1| FeS assembly scaffold SufA [Escherichia coli MS 84-1]
 gi|300419097|gb|EFK02408.1| FeS assembly scaffold SufA [Escherichia coli MS 182-1]
 gi|300449457|gb|EFK13077.1| FeS assembly scaffold SufA [Escherichia coli MS 116-1]
 gi|300461321|gb|EFK24814.1| FeS assembly scaffold SufA [Escherichia coli MS 187-1]
 gi|300525946|gb|EFK47015.1| FeS assembly scaffold SufA [Escherichia coli MS 119-7]
 gi|300527270|gb|EFK48332.1| FeS assembly scaffold SufA [Escherichia coli MS 107-1]
 gi|300841608|gb|EFK69368.1| FeS assembly scaffold SufA [Escherichia coli MS 124-1]
 gi|300846772|gb|EFK74532.1| FeS assembly scaffold SufA [Escherichia coli MS 78-1]
 gi|301074008|gb|EFK88814.1| FeS assembly scaffold SufA [Escherichia coli MS 146-1]
 gi|306908923|gb|EFN39419.1| FeS assembly scaffold SufA [Escherichia coli W]
 gi|308123038|gb|EFO60300.1| FeS assembly scaffold SufA [Escherichia coli MS 145-7]
 gi|315060989|gb|ADT75316.1| Fe-S cluster assembly protein [Escherichia coli W]
 gi|315136325|dbj|BAJ43484.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           DH1]
 gi|315257513|gb|EFU37481.1| FeS assembly scaffold SufA [Escherichia coli MS 85-1]
 gi|320175145|gb|EFW50256.1| Iron binding protein SufA for iron-sulfur cluster assembly
           [Shigella dysenteriae CDC 74-1112]
 gi|320184435|gb|EFW59243.1| Iron binding protein SufA for iron-sulfur cluster assembly
           [Shigella flexneri CDC 796-83]
 gi|320197868|gb|EFW72476.1| Iron binding protein SufA for iron-sulfur cluster assembly
           [Escherichia coli EC4100B]
 gi|323152809|gb|EFZ39079.1| feS assembly scaffold SufA [Escherichia coli EPECa14]
 gi|323163466|gb|EFZ49292.1| feS assembly scaffold SufA [Escherichia coli E128010]
 gi|323181000|gb|EFZ66538.1| feS assembly scaffold SufA [Escherichia coli 1180]
 gi|323186043|gb|EFZ71399.1| feS assembly scaffold SufA [Escherichia coli 1357]
 gi|323378439|gb|ADX50707.1| FeS assembly scaffold SufA [Escherichia coli KO11]
 gi|323937287|gb|EGB33566.1| FeS assembly scaffold SufA [Escherichia coli E1520]
 gi|323940649|gb|EGB36840.1| FeS assembly scaffold SufA [Escherichia coli E482]
 gi|323948021|gb|EGB44013.1| FeS assembly scaffold SufA [Escherichia coli H120]
 gi|323962175|gb|EGB57770.1| FeS assembly scaffold SufA [Escherichia coli H489]
 gi|323973937|gb|EGB69109.1| FeS assembly scaffold SufA [Escherichia coli TA007]
 gi|324016514|gb|EGB85733.1| FeS assembly scaffold SufA [Escherichia coli MS 117-3]
 gi|324119168|gb|EGC13056.1| FeS assembly scaffold SufA [Escherichia coli E1167]
 gi|331039080|gb|EGI11300.1| FeS assembly scaffold SufA [Escherichia coli H736]
 gi|331063563|gb|EGI35474.1| FeS assembly scaffold SufA [Escherichia coli TA271]
 gi|331074015|gb|EGI45335.1| FeS assembly scaffold SufA [Escherichia coli H591]
 gi|332096004|gb|EGJ01009.1| feS assembly scaffold SufA [Shigella boydii 3594-74]
 gi|332101519|gb|EGJ04865.1| sufA [Shigella sp. D9]
 gi|332343403|gb|AEE56737.1| feS assembly scaffold SufA [Escherichia coli UMNK88]
          Length = 122

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 18  LTLTPAAAIHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 76  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 122


>gi|21740005|emb|CAD39021.1| hypothetical protein [Homo sapiens]
          Length = 149

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK+++   + +  G+++ ++  GC GL Y ++  T    D D+ + +DGV
Sbjct: 45  LTLTPSAVNKIKQLL-KDKPEHVGVKVGVRTRGCNGLSYTLEY-TKTKGDSDEEVIQDGV 102

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 103 RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 149


>gi|293409997|ref|ZP_06653573.1| FeS assembly scaffold SufA [Escherichia coli B354]
 gi|291470465|gb|EFF12949.1| FeS assembly scaffold SufA [Escherichia coli B354]
          Length = 122

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 18  LTLTPAAAVHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 76  KLFVPLHAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 122


>gi|332233919|ref|XP_003266153.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Nomascus leucogenys]
          Length = 216

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK++    + +  G+++ ++  GC GL Y ++  T    D D+ + +DGV
Sbjct: 112 LTLTPSAVNKIKQL-LKDKPEHVGVKVGVRTRGCNGLSYTLEY-TKTKGDSDEEVIQDGV 169

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 170 RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 216


>gi|187730715|ref|YP_001880443.1| iron-sulfur cluster assembly scaffold protein [Shigella boydii CDC
           3083-94]
 gi|187427707|gb|ACD06981.1| FeS assembly scaffold SufA [Shigella boydii CDC 3083-94]
          Length = 122

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 18  LTLTPAAAIHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 76  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 122


>gi|85544500|pdb|2D2A|A Chain A, Crystal Structure Of Escherichia Coli Sufa Involved In
           Biosynthesis Of Iron-Sulfur Clusters
 gi|85544501|pdb|2D2A|B Chain B, Crystal Structure Of Escherichia Coli Sufa Involved In
           Biosynthesis Of Iron-Sulfur Clusters
          Length = 145

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 41  LTLTPAAAIHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 98

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 99  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 145


>gi|89900963|ref|YP_523434.1| iron-sulfur cluster assembly protein IscA [Rhodoferax ferrireducens
           T118]
 gi|89345700|gb|ABD69903.1| iron-sulfur cluster assembly protein IscA [Rhodoferax ferrireducens
           T118]
          Length = 107

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 67/108 (62%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD-G 63
           VT+TEAA   +   +   +G+  G+R+ +K  GC+GL Y ++ V +  ++ +D++ +D G
Sbjct: 3   VTLTEAAARHVTRYL-AKRGRGVGVRLGVKTTGCSGLAYKLEYVDE--IEPEDMVFEDFG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV I+  S  Y+ GTE+DF  E L  GF F+NP +   CGCG+S  +
Sbjct: 60  VKVLIEPKSFAYLDGTELDFVREGLNEGFKFNNPRERDRCGCGESFRV 107


>gi|66559527|ref|XP_624993.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Apis mellifera]
          Length = 130

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IKE+    + +  G+R+S+K+ GC GL Y +D   +     +++++ DGV
Sbjct: 26  LTLTPSAVKKIKEL-LKDKSEFIGLRVSVKQRGCNGLSYTLDYAKEKSKLDEEVVQ-DGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + ID  + L +LGTE+D+   KL S F+F+NPN    CGCG+S  +
Sbjct: 84  CIMIDKKAQLSLLGTEMDYIETKLSSEFIFNNPNIKGTCGCGESFSV 130


>gi|301758436|ref|XP_002915054.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like, partial [Ailuropoda melanoleuca]
          Length = 126

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK++    + +  G+++ ++  GC GL Y ++  T    D D+ + +DGV
Sbjct: 22  LTLTPSAVNKIKQL-LKDKPEHVGLKVGVRTRGCNGLSYTLEY-TKTKGDSDEEVVQDGV 79

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 80  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 126


>gi|225677366|ref|ZP_03788337.1| HesB/YadR/YfhF family protein [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590593|gb|EEH11849.1| HesB/YadR/YfhF family protein [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 134

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 72/119 (60%), Gaps = 11/119 (9%)

Query: 4   IVTMTEAAVYRIKEIV-------FNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDG 55
           ++T+T  AV RIK ++            +A GIR+ +K+ GC+GL+Y ++   D  P++ 
Sbjct: 16  LITITAKAVERIKYLLDQKKHTNLEKSEEAIGIRVLIKQKGCSGLKYDMEYAYDTRPLES 75

Query: 56  ---DDLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
              ++  +   VKV ID  S++++LG+E+D+  EK  SGFVF NPN+   CGCG+S  +
Sbjct: 76  IIEENCSDDQKVKVLIDPKSVMFILGSEMDYVEEKCSSGFVFKNPNEKGKCGCGESFHV 134


>gi|145500512|ref|XP_001436239.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124403378|emb|CAK68842.1| unnamed protein product [Paramecium tetraurelia]
          Length = 125

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 70/110 (63%), Gaps = 2/110 (1%)

Query: 3   DIVTMTEAAVYRIKEIV-FNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           +++T+++ A  R+ E++   +      ++I ++K GC GL Y ++  ++ P   D+++E 
Sbjct: 17  NLITISDKAAERLTELMKLQNNPAIDAVKIGVRKRGCNGLTYTMNYCSE-PEKLDEVVES 75

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GVKV +DS +++ ++GTE+D+  + + S FVF NPNQ   CGCG+S  I
Sbjct: 76  KGVKVVVDSKAVMVLVGTEMDYVEDDIKSEFVFKNPNQKGQCGCGESFHI 125


>gi|149580480|ref|XP_001511499.1| PREDICTED: similar to HESB like domain containing 2
           [Ornithorhynchus anatinus]
          Length = 129

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK++    + +  G+++ ++  GC GL Y ++  T    D D+ + +DG+
Sbjct: 25  LTLTPSAVNKIKQL-LKDKPENVGVKVGVRTRGCNGLSYTLEY-TKTKGDSDEEVVQDGI 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|15965274|ref|NP_385627.1| hypothetical protein SMc02075 [Sinorhizobium meliloti 1021]
 gi|307309297|ref|ZP_07588965.1| iron-sulfur cluster assembly accessory protein [Sinorhizobium
           meliloti BL225C]
 gi|307317038|ref|ZP_07596479.1| iron-sulfur cluster assembly accessory protein [Sinorhizobium
           meliloti AK83]
 gi|15074454|emb|CAC46100.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306897126|gb|EFN27871.1| iron-sulfur cluster assembly accessory protein [Sinorhizobium
           meliloti AK83]
 gi|306900298|gb|EFN30915.1| iron-sulfur cluster assembly accessory protein [Sinorhizobium
           meliloti BL225C]
          Length = 109

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 3/84 (3%)

Query: 29  IRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDGVKVWIDSASLLYMLGTEIDFKTEK 87
           +R+S++ GGC+G  Y  DLV  +  + DDLI EKD  KV IDS SL+YM G+EIDF    
Sbjct: 28  MRVSVEGGGCSGFSYKFDLV--DAANADDLILEKDNAKVLIDSLSLVYMGGSEIDFVDNL 85

Query: 88  LYSGFVFHNPNQVSACGCGQSVEI 111
           L   F  +NPN V++CGCG S  I
Sbjct: 86  LGQSFQINNPNAVASCGCGTSFSI 109


>gi|194015328|ref|ZP_03053944.1| YutM [Bacillus pumilus ATCC 7061]
 gi|194012732|gb|EDW22298.1| YutM [Bacillus pumilus ATCC 7061]
          Length = 120

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 68/114 (59%), Gaps = 3/114 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV-DGDDLI 59
           MS  VT+TEAA  +IK+++   + +   +R+ +K GGC+GL Y +    D+ V + D   
Sbjct: 1   MSTPVTITEAAALQIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGF--DHEVSEKDTQF 58

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
           E+ G++V +DS SL  M GT IDFK   +  GF   NPN +++CGCG S    +
Sbjct: 59  EQQGIQVLVDSESLDIMNGTIIDFKQSLMGGGFTIDNPNAIASCGCGSSFRTAK 112


>gi|84687544|ref|ZP_01015420.1| Iron-sulfur cluster assembly family protein [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84664453|gb|EAQ10941.1| Iron-sulfur cluster assembly family protein [Rhodobacterales
           bacterium HTCC2654]
          Length = 109

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 63/105 (60%), Gaps = 4/105 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T+ A  R+ EI     GKA  +R++++ GGC+G +Y  D+  D P DGD ++E  G KV
Sbjct: 9   VTDRAFARLGEIGAGKDGKA--LRVAVEGGGCSGFQY--DIALDAPDDGDLVLEGAGEKV 64

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            ID  SL ++ G  IDF  E + + FV  NPN  S+CGCG S  +
Sbjct: 65  VIDEVSLPFLTGATIDFTEELIGARFVIDNPNASSSCGCGTSFSM 109


>gi|149183078|ref|ZP_01861530.1| hypothetical protein BSG1_14058 [Bacillus sp. SG-1]
 gi|148849207|gb|EDL63405.1| hypothetical protein BSG1_14058 [Bacillus sp. SG-1]
          Length = 125

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 67/108 (62%), Gaps = 1/108 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MSD+V +TEAA  +IK+++  ++ +   IR+S+K GGC+GL Y +    +   D D  +E
Sbjct: 6   MSDVVVITEAAALQIKDMMKQNEEEGAFIRVSIKGGGCSGLSYGMGFEHEAGED-DVQLE 64

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++G+KV ++      + GT+ID+K   +  GF   NPN ++ CGCG S
Sbjct: 65  QNGIKVVVNKQDAPILNGTKIDYKQSMMGGGFTIDNPNAIANCGCGSS 112


>gi|195448473|ref|XP_002071673.1| GK25017 [Drosophila willistoni]
 gi|194167758|gb|EDW82659.1| GK25017 [Drosophila willistoni]
          Length = 130

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 68/109 (62%), Gaps = 6/109 (5%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQ--GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +T+T AAV RIK ++   Q K    G+++ +++ GC GL Y +D  +      D+ + +D
Sbjct: 26  LTLTPAAVQRIKSLL---QDKPDFVGLKVGVRQRGCNGLSYTLDYASHKD-KLDEEVVQD 81

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVKV+ID  + L +LGTE+D+   KL S FVF+NPN    CGCG+S  +
Sbjct: 82  GVKVFIDKKAQLSLLGTEMDYVESKLSSEFVFNNPNIKGTCGCGESFNM 130


>gi|156537934|ref|XP_001608294.1| PREDICTED: similar to AT26381p [Nasonia vitripennis]
          Length = 130

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T  AV +IKEI    + +  G+++ +++ GC GL Y +D  TD     D+ + +DGV
Sbjct: 26  LVLTSNAVNKIKEI-LKDKPEYIGLKVGVRQRGCNGLSYTLDYATDKS-KLDEEVVQDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V ID  + L +LGTE+D+   KL S FVF+NPN    CGCG+S  +
Sbjct: 84  RVIIDRKAQLSLLGTEMDYIENKLSSEFVFNNPNIKGTCGCGESFSV 130


>gi|114762855|ref|ZP_01442287.1| Iron-sulfur cluster assembly family protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114544465|gb|EAU47472.1| Iron-sulfur cluster assembly family protein [Roseovarius sp.
           HTCC2601]
          Length = 107

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 65/105 (61%), Gaps = 4/105 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T+ A  R+ EI  ++QGKA  +R++++ GGC+G +Y + L  D+P D D ++E  G +V
Sbjct: 7   VTDRAFARLHEIGAHAQGKA--LRVAIEGGGCSGFQYEIKL--DDPADDDLVLEGSGEQV 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            ID  SL ++    IDF  E + + FV  NPN  S+CGCG S  +
Sbjct: 63  VIDEVSLPFLTNAVIDFSEELIGARFVIENPNATSSCGCGTSFSM 107


>gi|126656515|ref|ZP_01727776.1| HesB protein [Cyanothece sp. CCY0110]
 gi|126622201|gb|EAZ92908.1| HesB protein [Cyanothece sp. CCY0110]
          Length = 119

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 60/104 (57%), Gaps = 1/104 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE A  +++ +++ +     GIR+ +K GGC G EY ++LV +   + D   E+D V
Sbjct: 3   VTLTEKAALKLRTVLYGNSNNIAGIRVGVKDGGCNGYEYALNLVKETNSE-DVRFEQDNV 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            +++D  S+  + G  IDF      SGF F NPN    CGCG+S
Sbjct: 62  PIYVDPTSVSLLDGVVIDFVDSLTQSGFTFTNPNATDTCGCGKS 105


>gi|86749869|ref|YP_486365.1| HesB/YadR/YfhF [Rhodopseudomonas palustris HaA2]
 gi|86572897|gb|ABD07454.1| HesB/YadR/YfhF [Rhodopseudomonas palustris HaA2]
          Length = 110

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E A  RI EI+   +G    +RIS++ GGC+G +Y  D V     D D +I +DG 
Sbjct: 6   VTISERAARRIGEIL-KGEGDGAMLRISVEGGGCSGFQYKFD-VDRARTDDDVVIARDGA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +DSAS  ++ G+E+DF  + + + F  +NPN  ++CGCG S  I
Sbjct: 64  VVLVDSASAPFLAGSEVDFVDDLIGASFRVNNPNATASCGCGTSFSI 110


>gi|255714939|ref|XP_002553751.1| KLTH0E06182p [Lachancea thermotolerans]
 gi|238935133|emb|CAR23314.1| KLTH0E06182p [Lachancea thermotolerans]
          Length = 267

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 71/105 (67%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++T  AV  +K ++  +Q + + IR+ +K  GC+GL Y ++ +T  P   D+++E+DG
Sbjct: 163 LISLTPNAVDHLKLLL--NQPEPKLIRVGVKNRGCSGLTYDLEYITA-PGKFDEVVEQDG 219

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           V+V +DS +L  ++G+E+D+  ++L S FVF NPN    CGCG+S
Sbjct: 220 VRVILDSKALFSIVGSEMDWIDDRLSSRFVFKNPNSKGTCGCGES 264


>gi|229543326|ref|ZP_04432386.1| iron-sulfur cluster assembly accessory protein [Bacillus coagulans
           36D1]
 gi|229327746|gb|EEN93421.1| iron-sulfur cluster assembly accessory protein [Bacillus coagulans
           36D1]
          Length = 120

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 69/113 (61%), Gaps = 3/113 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV-DGDDLI 59
           MS+++ +TEAA ++IK+++  +  +    R+S+  GGC+GL Y + L  D+ + +GD + 
Sbjct: 1   MSEVIHLTEAAAFQIKDMMEQNDEQDAYFRVSVNGGGCSGLSYGLSL--DHEIKEGDAVG 58

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           E+ G+++ +D  S   + GT ID+K   L  GF   NPN +  CGCG S + K
Sbjct: 59  EQHGIRILVDHESAPILTGTVIDYKQSLLGGGFTIDNPNAIVTCGCGSSFKTK 111


>gi|170740699|ref|YP_001769354.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           sp. 4-46]
 gi|168194973|gb|ACA16920.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           sp. 4-46]
          Length = 108

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 61/111 (54%), Gaps = 3/111 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+DI T+T  A  RI EI+  S+     +RIS+  GGC+G +Y  D+  D   D D  +E
Sbjct: 1   MTDI-TLTPRAARRINEIM-GSEPPGSMLRISVNGGGCSGFQYAFDIARDRATD-DLAVE 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +DG  V +D  SL YM G  IDF  + +   F   NP   ++CGCG S  +
Sbjct: 58  RDGATVLVDPLSLEYMRGATIDFVNDLIGQSFKIENPQATASCGCGTSFSL 108


>gi|311695879|gb|ADP98752.1| FeS cluster insertion [marine bacterium HP15]
          Length = 117

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMT +AV  +++ +   +  A+GIR+++KK GC+G +Y    V D   D D +   DGV
Sbjct: 12  VTMTPSAVKHVRKQL-EKKPDAKGIRLAIKKSGCSGFKYETQWVEDTAAD-DKVFHIDGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V++    L  + G EIDF TE + S F F NPN  + CGCG+S  +
Sbjct: 70  DVFVKEEHLPLVNGIEIDFVTEGVNSMFQFRNPNATAECGCGESFTV 116


>gi|330794256|ref|XP_003285196.1| hypothetical protein DICPUDRAFT_28921 [Dictyostelium purpureum]
 gi|325084917|gb|EGC38335.1| hypothetical protein DICPUDRAFT_28921 [Dictyostelium purpureum]
          Length = 138

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 71/111 (63%), Gaps = 3/111 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDL-VTDNPVDGDDLIEK 61
           I +MT++A+ R+KEI+ +++     G+R+ +K+ GC+G+ Y +D   T N  D   + +K
Sbjct: 17  IFSMTDSAIKRVKEIMKDNKIDNCIGLRLGVKQRGCSGMSYTLDFATTKNKFDETVVADK 76

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           D + + +DS +LL ++GTE+D+  E +   F+F NPN  + CGCG+S   K
Sbjct: 77  D-INIIVDSKALLSVIGTEMDYIEEPIKKEFIFINPNATNTCGCGESFSTK 126


>gi|162148824|ref|YP_001603285.1| iron-binding protein iscA [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545428|ref|YP_002277657.1| iron-sulfur cluster assembly accessory protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787401|emb|CAP56996.1| putative iron-binding protein iscA [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533105|gb|ACI53042.1| iron-sulfur cluster assembly accessory protein [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 126

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 68/111 (61%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           +  ++ +T+ A  R++ +++ +    Q +RI++   GC+G  Y ++ V D    GD+++ 
Sbjct: 18  LPPLMALTDRAADRLR-VLYETAHAGQKLRIAVSTKGCSGHAYDMNFV-DAAGPGDEVVT 75

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GV V +D  + L+++GT +D++T +L SGF F NPN+   CGCG+S  +
Sbjct: 76  DKGVTVLVDRKATLFLIGTTMDYETRQLESGFTFSNPNEKGRCGCGESFHV 126


>gi|145632623|ref|ZP_01788357.1| co-chaperone HscB [Haemophilus influenzae 3655]
 gi|144986818|gb|EDJ93370.1| co-chaperone HscB [Haemophilus influenzae 3655]
          Length = 107

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+K  + +++GK  G+R+ +K  GC+GL Y+++ V D     D + E  GV
Sbjct: 3   ITLTEKAAQRVKAFL-DNRGKGIGLRLGVKTSGCSGLAYVLEFV-DVLNSEDQVFELHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S +Y+ G E+D+  E L  GF ++NPN   +CGCG+S  +
Sbjct: 61  NIIVDPKSFVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV 107


>gi|119583117|gb|EAW62713.1| HESB like domain containing 2, isoform CRA_b [Homo sapiens]
 gi|194382184|dbj|BAG58847.1| unnamed protein product [Homo sapiens]
          Length = 176

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK++    + +  G+++ ++  GC GL Y ++  T    D D+ + +DGV
Sbjct: 72  LTLTPSAVNKIKQL-LKDKPEHVGVKVGVRTRGCNGLSYTLEY-TKTKGDSDEEVIQDGV 129

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 130 RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 176


>gi|325284123|ref|YP_004256664.1| iron-sulfur cluster assembly accessory protein [Deinococcus
           proteolyticus MRP]
 gi|324315932|gb|ADY27047.1| iron-sulfur cluster assembly accessory protein [Deinococcus
           proteolyticus MRP]
          Length = 141

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++E    + + I+  S  +  G+R+ +K GGC+G +Y +  + D  ++GD ++   G
Sbjct: 20  VITISEYGAQKAQSILAGSGKQDAGVRVFIKSGGCSGYQYGM-AIDDRELEGDTIVYDRG 78

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           VK+ +D ASL  + G+E+DF    +  GF  +NPN  S+CGCG S     A
Sbjct: 79  VKLLVDQASLALLRGSEVDFVENLMGGGFTVNNPNATSSCGCGHSFRTDGA 129


>gi|157693629|ref|YP_001488091.1| iron sulfur assembly protein [Bacillus pumilus SAFR-032]
 gi|157682387|gb|ABV63531.1| possible iron sulfur assembly protein [Bacillus pumilus SAFR-032]
          Length = 120

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 67/109 (61%), Gaps = 3/109 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV-DGDDLI 59
           MS  VT+TEAA  +IK+++   + +   +R+ +K GGC+GL Y +    D+ V + D   
Sbjct: 1   MSTPVTITEAAALQIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGF--DHEVSEKDTQF 58

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           E+ G++V +DS SL  M GT IDFK   +  GF   NPN +++CGCG S
Sbjct: 59  EQQGIQVLVDSESLDIMNGTIIDFKQSLMGGGFTIDNPNAIASCGCGSS 107


>gi|187927981|ref|YP_001898468.1| iron-sulfur cluster assembly protein IscA [Ralstonia pickettii 12J]
 gi|241662563|ref|YP_002980923.1| iron-sulfur cluster assembly protein IscA [Ralstonia pickettii 12D]
 gi|309781146|ref|ZP_07675883.1| iron-sulfur cluster assembly protein IscA [Ralstonia sp. 5_7_47FAA]
 gi|187724871|gb|ACD26036.1| iron-sulfur cluster assembly protein IscA [Ralstonia pickettii 12J]
 gi|240864590|gb|ACS62251.1| iron-sulfur cluster assembly protein IscA [Ralstonia pickettii 12D]
 gi|308919967|gb|EFP65627.1| iron-sulfur cluster assembly protein IscA [Ralstonia sp. 5_7_47FAA]
          Length = 106

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+ A   +   +   +GK  G+R+ +K  GC+GL Y ++   D     D + E +G
Sbjct: 1   MITLTDKAAQHVSRYL-TRRGKGVGLRVGVKTTGCSGLAYKLEYA-DEIATEDQVFESNG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV +D  SL Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 59  VKVIVDPKSLPYIDGTELDYAREGLNEGFRFNNPNVKDECGCGESFRV 106


>gi|294490024|gb|ADE88780.1| FeS assembly scaffold SufA [Escherichia coli IHE3034]
          Length = 120

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 16  LTLTPAAAIHIRELVAKQPGMI-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 73

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 74  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 120


>gi|258542732|ref|YP_003188165.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256633810|dbj|BAH99785.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256636869|dbj|BAI02838.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-03]
 gi|256639922|dbj|BAI05884.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-07]
 gi|256642978|dbj|BAI08933.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-22]
 gi|256646033|dbj|BAI11981.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-26]
 gi|256649086|dbj|BAI15027.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-32]
 gi|256652073|dbj|BAI18007.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655130|dbj|BAI21057.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-12]
          Length = 122

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 70/111 (63%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           +  ++ +++AA  R++ + + +    Q +RIS+   GC+G  Y +  V D P +GD++++
Sbjct: 14  LPPLMRVSQAAADRLQHL-YATAHAGQLLRISVSTKGCSGKAYDMQFV-DAPGEGDEVVK 71

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GV + +D  + LY++G+E+D++   L +GFVF NPN+   CGCG+S  +
Sbjct: 72  DHGVTLLVDRKATLYLIGSEMDYQEGDLEAGFVFANPNEKGRCGCGESFHV 122


>gi|110641805|ref|YP_669535.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           536]
 gi|191171620|ref|ZP_03033167.1| FeS assembly scaffold SufA [Escherichia coli F11]
 gi|218689626|ref|YP_002397838.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           ED1a]
 gi|300987766|ref|ZP_07178344.1| FeS assembly scaffold SufA [Escherichia coli MS 200-1]
 gi|306815063|ref|ZP_07449219.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           NC101]
 gi|110343397|gb|ABG69634.1| SufA protein [Escherichia coli 536]
 gi|190907950|gb|EDV67542.1| FeS assembly scaffold SufA [Escherichia coli F11]
 gi|218427190|emb|CAR08076.2| Fe-S cluster assembly protein [Escherichia coli ED1a]
 gi|222033440|emb|CAP76181.1| Protein sufA [Escherichia coli LF82]
 gi|300306054|gb|EFJ60574.1| FeS assembly scaffold SufA [Escherichia coli MS 200-1]
 gi|305851711|gb|EFM52164.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           NC101]
 gi|312946284|gb|ADR27111.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|324011451|gb|EGB80670.1| FeS assembly scaffold SufA [Escherichia coli MS 60-1]
          Length = 122

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 18  LTLTPAAAVHIRELVAKQPGMI-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 76  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 122


>gi|58698558|ref|ZP_00373459.1| HesB/YadR/YfhF family protein [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225630587|ref|YP_002727378.1| HesB/YadR/YfhF family protein [Wolbachia sp. wRi]
 gi|58534940|gb|EAL59038.1| HesB/YadR/YfhF family protein [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225592568|gb|ACN95587.1| HesB/YadR/YfhF family protein [Wolbachia sp. wRi]
          Length = 137

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 75/121 (61%), Gaps = 15/121 (12%)

Query: 4   IVTMTEAAVYRIKEIV-------FNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDG 55
           ++T+T  AV RI+ ++            +A GIR+ +K+ GC+GL+Y ++   D  P++ 
Sbjct: 19  LITITAEAVERIRYLLDQKKHTNLEKPEEAIGIRVLIKQKGCSGLKYDIEYAYDTRPLE- 77

Query: 56  DDLIEK---DG--VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             +IE+   DG  VKV ID  S++++LG+E+D+  EK  SGFVF NPN+   CGCG+S  
Sbjct: 78  -SIIEENCSDGQKVKVLIDPKSVMFILGSEMDYVEEKFSSGFVFKNPNEKGKCGCGESFH 136

Query: 111 I 111
           +
Sbjct: 137 V 137


>gi|159466490|ref|XP_001691442.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii]
 gi|158279414|gb|EDP05175.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii]
          Length = 162

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 67/108 (62%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIV--FNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI--E 60
           +T+T  A+ +++++   F  Q +A  +R+ +K+GGC+G+ Y++D  + + V  DD +   
Sbjct: 52  ITLTPEALVQLRKLRADFKEQSEAMLLRVGVKQGGCSGMSYVMDFESQDKVTDDDHVISY 111

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            DG ++ +D  SLLY+ G ++ + T  +  GF F NPN   +CGCG+S
Sbjct: 112 DDGFRLVVDPKSLLYLFGMQLGYSTALIGGGFQFQNPNATDSCGCGKS 159


>gi|90424006|ref|YP_532376.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisB18]
 gi|90106020|gb|ABD88057.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisB18]
          Length = 109

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 68/111 (61%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  VT++E A  RI EI+ + +G    +RIS++ GGC+G +Y  D V  N  + D +I 
Sbjct: 1   MTASVTISERAARRIGEIL-SKEGTGAMLRISVEGGGCSGFQYKFD-VERNQNNDDTVIA 58

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +D   V +DSAS+ ++ G E+DF  + + + F  +NPN  ++CGCG S  I
Sbjct: 59  RDSAVVLVDSASVPFLEGAELDFVDDLIGASFRVNNPNATASCGCGTSFSI 109


>gi|297171888|gb|ADI22876.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF0500_32L01]
          Length = 112

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 67/109 (61%), Gaps = 3/109 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEKD 62
           +V+MT+ AV R++ ++   +     +R+ ++ GGC+G +Y      +   + DDL  E+D
Sbjct: 6   MVSMTQNAVQRLERLISAKEQSNLMLRVYVQGGGCSGFQYGFQF--EEQREEDDLEFERD 63

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVK+ +DS SL Y++G+EIDF  + + + FV  NPN  + CGCG S  +
Sbjct: 64  GVKLLVDSMSLQYLMGSEIDFVDDLMGTRFVVSNPNAATTCGCGSSFAV 112


>gi|26247934|ref|NP_753974.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           CFT073]
 gi|91210897|ref|YP_540883.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           UTI89]
 gi|117623863|ref|YP_852776.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           APEC O1]
 gi|215486859|ref|YP_002329290.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218558553|ref|YP_002391466.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           S88]
 gi|237705630|ref|ZP_04536111.1| iron-sulfur cluster assembly scaffold protein [Escherichia sp.
           3_2_53FAA]
 gi|300994857|ref|ZP_07180970.1| FeS assembly scaffold SufA [Escherichia coli MS 45-1]
 gi|301050985|ref|ZP_07197831.1| FeS assembly scaffold SufA [Escherichia coli MS 185-1]
 gi|312966837|ref|ZP_07781055.1| feS assembly scaffold SufA [Escherichia coli 2362-75]
 gi|331647175|ref|ZP_08348269.1| FeS assembly scaffold SufA [Escherichia coli M605]
 gi|331657659|ref|ZP_08358621.1| FeS assembly scaffold SufA [Escherichia coli TA206]
 gi|26108337|gb|AAN80539.1|AE016761_114 SufA protein [Escherichia coli CFT073]
 gi|91072471|gb|ABE07352.1| SufA scaffold protein for iron-sulfur cluster assembly [Escherichia
           coli UTI89]
 gi|115512987|gb|ABJ01062.1| Fe-S cluster assembly protein [Escherichia coli APEC O1]
 gi|215264931|emb|CAS09317.1| Fe-S cluster assembly protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218365322|emb|CAR03043.1| Fe-S cluster assembly protein [Escherichia coli S88]
 gi|226900387|gb|EEH86646.1| iron-sulfur cluster assembly scaffold protein [Escherichia sp.
           3_2_53FAA]
 gi|281178754|dbj|BAI55084.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|300297362|gb|EFJ53747.1| FeS assembly scaffold SufA [Escherichia coli MS 185-1]
 gi|300406197|gb|EFJ89735.1| FeS assembly scaffold SufA [Escherichia coli MS 45-1]
 gi|307626830|gb|ADN71134.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           UM146]
 gi|312288301|gb|EFR16203.1| feS assembly scaffold SufA [Escherichia coli 2362-75]
 gi|315286390|gb|EFU45826.1| FeS assembly scaffold SufA [Escherichia coli MS 110-3]
 gi|315290531|gb|EFU49905.1| FeS assembly scaffold SufA [Escherichia coli MS 153-1]
 gi|315299720|gb|EFU58960.1| FeS assembly scaffold SufA [Escherichia coli MS 16-3]
 gi|320195420|gb|EFW70045.1| Iron binding protein SufA for iron-sulfur cluster assembly
           [Escherichia coli WV_060327]
 gi|323952191|gb|EGB48064.1| FeS assembly scaffold SufA [Escherichia coli H252]
 gi|323956585|gb|EGB52323.1| FeS assembly scaffold SufA [Escherichia coli H263]
 gi|324007046|gb|EGB76265.1| FeS assembly scaffold SufA [Escherichia coli MS 57-2]
 gi|330911491|gb|EGH40001.1| iron binding protein SufA for iron-sulfur cluster assembly
           [Escherichia coli AA86]
 gi|331043958|gb|EGI16094.1| FeS assembly scaffold SufA [Escherichia coli M605]
 gi|331055907|gb|EGI27916.1| FeS assembly scaffold SufA [Escherichia coli TA206]
          Length = 122

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 18  LTLTPAAAIHIRELVAKQPGMI-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 76  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 122


>gi|47226595|emb|CAG08611.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 129

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV RI+ ++   + +  G+++ +K  GC GL Y +D  T      D+ + +DGV
Sbjct: 25  LTLTPSAVNRIR-LLLEDRPEYIGLKVGVKTRGCNGLTYTLDY-TKEKHKSDEEVLQDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+DF   KL S F+F+NPN    CGCG+S  +
Sbjct: 83  RVFIEKKAQLTLLGTEMDFVETKLTSEFIFNNPNIKGTCGCGESFSV 129


>gi|114320403|ref|YP_742086.1| iron-sulfur cluster assembly accessory protein [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114226797|gb|ABI56596.1| iron-sulfur cluster assembly accessory protein [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 108

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+ AV  +K+ +   +G   G+R+ +K  GC+GL Y VD   D     D++IE+DGV
Sbjct: 4   IQLTDKAVRHVKDYLARHEGGV-GLRLGVKTTGCSGLAYTVDY-ADRIEASDEVIEQDGV 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ++  SL ++ GTE+DF  + L   F F NPN    CGCG+S  +
Sbjct: 62  KVLVNRKSLPFLEGTEVDFVRDGLNQRFDFRNPNVKETCGCGESFTV 108


>gi|332260003|ref|XP_003279075.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Nomascus leucogenys]
          Length = 176

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK++    + +  G+++ ++  GC GL Y ++  T    D D+ + +DGV
Sbjct: 72  LTLTPSAVNKIKQL-LKDKPEHVGVKVGVRTRGCNGLSYTLEY-TKTKGDSDEEVIQDGV 129

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 130 RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 176


>gi|42520721|ref|NP_966636.1| HesB/YadR/YfhF family protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410461|gb|AAS14570.1| HesB/YadR/YfhF family protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 137

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 72/119 (60%), Gaps = 11/119 (9%)

Query: 4   IVTMTEAAVYRIKEIV-------FNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDG 55
           ++T+T  AV RI+ ++            +A GIR+ +K+ GC+GL+Y ++   D  P++ 
Sbjct: 19  LITITAEAVERIRYLLDQKKHTNLEKPEEAIGIRVLIKQKGCSGLKYDIEYAYDTRPLES 78

Query: 56  ---DDLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
              ++  +   VKV ID  S++++LG+E+D+  EK  SGFVF NPN+   CGCG+S  +
Sbjct: 79  VIEENCSDGQKVKVLIDPKSVMFILGSEMDYVEEKFSSGFVFKNPNEKGKCGCGESFHV 137


>gi|119505396|ref|ZP_01627470.1| probable iron-binding protein IscA [marine gamma proteobacterium
           HTCC2080]
 gi|119458851|gb|EAW39952.1| probable iron-binding protein IscA [marine gamma proteobacterium
           HTCC2080]
          Length = 107

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +TE A   ++  +  ++G+ +GIRI++K  GC+GL Y+++ V D     D + E  GV
Sbjct: 3   IAVTEQAAGHVQRQL-EARGRGEGIRIAVKTSGCSGLAYVLEFV-DAAETTDTIFEDFGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K++ID  SL+Y+ GT +D+  E L  G  F NPN    CGCG+S  +
Sbjct: 61  KLFIDPKSLVYLDGTIVDYAKEGLNEGLEFRNPNVAGECGCGESFTV 107


>gi|300918054|ref|ZP_07134675.1| FeS assembly scaffold SufA [Escherichia coli MS 115-1]
 gi|300414745|gb|EFJ98055.1| FeS assembly scaffold SufA [Escherichia coli MS 115-1]
          Length = 122

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 18  LTLTPAAAIHIRELVAKQPGIV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 76  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 122


>gi|255560329|ref|XP_002521181.1| iron-sulfur cluster assembly protein, putative [Ricinus communis]
 gi|223539628|gb|EEF41212.1| iron-sulfur cluster assembly protein, putative [Ricinus communis]
          Length = 132

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 66/106 (62%), Gaps = 3/106 (2%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           + +++T+AA  RI+ ++   Q     +R+ +K  GC GL Y ++   D     D+L+E  
Sbjct: 14  EALSLTDAAAARIRHLLVQRQRPF--LRLGVKARGCNGLSYTLNYA-DEKGKFDELVEDK 70

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           GVK+ ID  +L++++GT++DF  +KL S F+F NPN    CGCG+S
Sbjct: 71  GVKILIDPKALMHVIGTKMDFVDDKLRSEFIFINPNSKGQCGCGES 116


>gi|149914964|ref|ZP_01903493.1| FeS cluster assembly HesB family protein, putative [Roseobacter sp.
           AzwK-3b]
 gi|149811152|gb|EDM70989.1| FeS cluster assembly HesB family protein, putative [Roseobacter sp.
           AzwK-3b]
          Length = 107

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 65/106 (61%), Gaps = 4/106 (3%)

Query: 6   TMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVK 65
           T+TE A  R+ EI    +G+A  +RI+++ GGC+G +Y  D+  D P + D ++E  G K
Sbjct: 6   TVTERAFSRLCEIGAGDEGRA--LRIAVEGGGCSGFQY--DIRLDQPAEDDLVLEGLGQK 61

Query: 66  VWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V +DS SL ++ G  IDF  E + + F  +NPN  S+CGCG S  +
Sbjct: 62  VVVDSVSLPFLAGATIDFTEELIGARFTINNPNASSSCGCGTSFSM 107


>gi|16126252|ref|NP_420816.1| HesB/YadR/YfhF family protein [Caulobacter crescentus CB15]
 gi|221235025|ref|YP_002517461.1| HesB protein family [Caulobacter crescentus NA1000]
 gi|13423480|gb|AAK23984.1| HesB/YadR/YfhF family protein [Caulobacter crescentus CB15]
 gi|220964197|gb|ACL95553.1| HesB protein family [Caulobacter crescentus NA1000]
          Length = 110

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 66/108 (61%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEKDG 63
           +T++E A  RIK I   ++G+A  +R+++  GGC+G +Y  DLV  + V+ DDL +E+DG
Sbjct: 6   LTLSENAARRIKAI-GEAEGRALMLRVAVDGGGCSGFQYRFDLV--DSVEDDDLKVERDG 62

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
               +D  SL  + G+EIDF  E   + F   NPN  S+CGCG S  I
Sbjct: 63  AAALVDVVSLALLKGSEIDFVDELAGAEFRIRNPNAKSSCGCGVSFSI 110


>gi|196229720|ref|ZP_03128584.1| iron-sulfur cluster assembly accessory protein [Chthoniobacter
           flavus Ellin428]
 gi|196226046|gb|EDY20552.1| iron-sulfur cluster assembly accessory protein [Chthoniobacter
           flavus Ellin428]
          Length = 122

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 66/106 (62%), Gaps = 3/106 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQG-IRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +V +TE A  ++  +    QG+ QG +R+++  GGC+GL+Y +DLV D P + D ++E  
Sbjct: 16  LVKVTEKASAKLTSL-LTRQGRPQGALRVAVIGGGCSGLQYKMDLV-DGPANRDIMVESA 73

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           GVKV ID  S L++ G+ +DF  +    GF   NPN V+ C CG+S
Sbjct: 74  GVKVVIDPKSALFVSGSLLDFSDDLQKGGFKVTNPNAVAHCSCGES 119


>gi|157134795|ref|XP_001656446.1| hypothetical protein AaeL_AAEL000418 [Aedes aegypti]
 gi|108884323|gb|EAT48548.1| conserved hypothetical protein [Aedes aegypti]
          Length = 129

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 70/109 (64%), Gaps = 6/109 (5%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQ--GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +++T +AV R+K+++    GK++  G+++ +++ GC GL Y +D  T      D+ + +D
Sbjct: 25  LSLTPSAVARVKQLL---DGKSEYIGLKVGVRQRGCNGLSYTLDYATTKD-KLDEEVVQD 80

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVKV ID  + L +LGTE+D+   KL + FVF+NPN    CGCG+S  I
Sbjct: 81  GVKVLIDKKAQLSLLGTEMDYVETKLSAEFVFNNPNIKGTCGCGESFSI 129


>gi|302877887|ref|YP_003846451.1| iron-sulfur cluster assembly protein IscA [Gallionella
           capsiferriformans ES-2]
 gi|302580676|gb|ADL54687.1| iron-sulfur cluster assembly protein IscA [Gallionella
           capsiferriformans ES-2]
          Length = 107

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 66/108 (61%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEKDG 63
           VT+TEAA   +K  +   +G+  G+RI ++  GC+G+ Y ++    + ++ DDL  +  G
Sbjct: 3   VTLTEAAAKHVKNFI-AKRGRGIGLRIGVRTSGCSGMAYKLEFA--DVLEADDLPFDSFG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V V +D  SL Y+ G E+D+  E L  GF F+NPN   ACGCG+S ++
Sbjct: 60  VTVLVDPKSLPYIDGMELDYTREGLNEGFKFNNPNVKDACGCGESFQV 107


>gi|167619410|ref|ZP_02388041.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           thailandensis Bt4]
          Length = 95

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 55/89 (61%), Gaps = 1/89 (1%)

Query: 23  QGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEID 82
           +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GVKV++D  SL Y+ GTE+D
Sbjct: 8   RGKGLGLRLGVRTTGCSGLAYKLEYV-DELTPEDQMFESHGVKVFVDPKSLAYIDGTELD 66

Query: 83  FKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           F  E L  GF F+NPN    CGCG+S  +
Sbjct: 67  FAREGLNEGFKFNNPNVKDECGCGESFRV 95


>gi|73946570|ref|XP_849435.1| PREDICTED: similar to HESB like domain containing 2 [Canis
           familiaris]
          Length = 260

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK++    + +  G+++ ++  GC GL Y ++  T    D D+ + +DGV
Sbjct: 156 LTLTPSAVNKIKQL-LKDKPEHVGLKVGVRTRGCNGLSYTLEY-TKTKGDSDEEVVQDGV 213

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 214 RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 260


>gi|332186271|ref|ZP_08388016.1| iron-sulfur cluster assembly accessory family protein [Sphingomonas
           sp. S17]
 gi|332013639|gb|EGI55699.1| iron-sulfur cluster assembly accessory family protein [Sphingomonas
           sp. S17]
          Length = 117

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T +A  RI +++  +   A G+++S  + GC+GL Y VD VT+     D+ I+  G 
Sbjct: 12  LNLTPSAEARIADLMARAPEGAIGVKLSTPRRGCSGLAYSVDYVTEAKAF-DEKIDTPGG 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +++D  S+LY++G+ +D+  +   +GFVF NPN   ACGCG+S  +
Sbjct: 71  TLFVDGGSILYLIGSTMDWVEDDFTAGFVFQNPNAKGACGCGESFTV 117


>gi|121605188|ref|YP_982517.1| iron-sulfur cluster assembly protein IscA [Polaromonas
           naphthalenivorans CJ2]
 gi|120594157|gb|ABM37596.1| iron-sulfur cluster assembly protein IscA [Polaromonas
           naphthalenivorans CJ2]
          Length = 107

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+AA   +   +   +GK  G+R+ +K  GC+GL Y ++   D     D + E +GV
Sbjct: 3   VTLTDAAARHVTRYM-TKRGKGVGVRLGVKTTGCSGLAYKLEYA-DEIAPEDVVFEDNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  S+ Y+ GT++DF  E L  GF F NPN+   CGCG+S  +
Sbjct: 61  KVLVDPKSMAYIDGTQLDFVREGLNEGFKFINPNERDRCGCGESFRV 107


>gi|260574691|ref|ZP_05842694.1| iron-sulfur cluster assembly accessory protein [Rhodobacter sp.
           SW2]
 gi|259023108|gb|EEW26401.1| iron-sulfur cluster assembly accessory protein [Rhodobacter sp.
           SW2]
          Length = 112

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 65/105 (61%), Gaps = 3/105 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T+ A  R+ EI   S G+ + +R++++ GGC+G +Y  D+  D+P   D ++EKDG KV
Sbjct: 11  VTDRAFARLAEIAAAS-GEQRALRVAVEGGGCSGFQY--DIKLDDPAADDLVLEKDGQKV 67

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D+ SL ++    ID+  E + + FV  NPN  S+CGCG S  I
Sbjct: 68  LVDAVSLPFLANAVIDYSEELIGARFVIDNPNASSSCGCGTSFSI 112


>gi|240850750|ref|YP_002972150.1| iron-sulfur cluster assembly accessory protein [Bartonella grahamii
           as4aup]
 gi|240267873|gb|ACS51461.1| iron-sulfur cluster assembly accessory protein [Bartonella grahamii
           as4aup]
          Length = 107

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +++ A  +I +I+     K   +RIS++ GGC+G  Y  DLV++   D D +++KDG 
Sbjct: 3   VKISDVAAKKIAQILLREPDKI-ALRISVEGGGCSGFSYKYDLVSEMCKD-DLVLKKDGA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V+ID  SL +M G EIDF  + +   F  HNPN VS+CGCG S  I
Sbjct: 61  VVFIDLLSLPFMEGAEIDFVDDLMGQSFQIHNPNAVSSCGCGVSFSI 107


>gi|168011755|ref|XP_001758568.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162690178|gb|EDQ76546.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 127

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 69/104 (66%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TEAA  RI++++ + Q   + +R+ +K  GC GL Y ++   D+    D+++E  GV
Sbjct: 24  LSLTEAAANRIRKLLDHRQ--KEYLRLGVKVRGCNGLTYTLNYA-DDKGKFDEVVEDKGV 80

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV ID  +L++++GT++D+  E+L S FVF NPN    CGCG+S
Sbjct: 81  KVLIDPRALMHVVGTKMDYVEERLKSEFVFINPNSKGQCGCGES 124


>gi|192291569|ref|YP_001992174.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris TIE-1]
 gi|192285318|gb|ACF01699.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 110

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 68/109 (62%), Gaps = 6/109 (5%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQG--IRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           VT++E A  RI EI+   +G+ QG  +RI ++ GGC+G +Y  D V     D D +I K+
Sbjct: 6   VTISERAARRIGEIL---KGEGQGAMLRIRVEGGGCSGFQYKFD-VDRTKTDDDLVIAKE 61

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G  V +DSAS+ ++ G+E+DF  + + + F  +NPN  ++CGCG S  I
Sbjct: 62  GAVVLVDSASVPFLAGSEVDFVDDLIGASFRVNNPNATASCGCGTSFSI 110


>gi|83748485|ref|ZP_00945507.1| HesB protein family [Ralstonia solanacearum UW551]
 gi|207725257|ref|YP_002255653.1| hypothetical protein RSMK00197 [Ralstonia solanacearum MolK2]
 gi|207743632|ref|YP_002260024.1| hypothetical protein RSIPO_01815 [Ralstonia solanacearum IPO1609]
 gi|300692016|ref|YP_003753011.1| Fe-S cluster assembly and activation factor [Ralstonia solanacearum
           PSI07]
 gi|300704649|ref|YP_003746252.1| Fe-S cluster assembly and activation factor [Ralstonia solanacearum
           CFBP2957]
 gi|83724896|gb|EAP72052.1| HesB protein family [Ralstonia solanacearum UW551]
 gi|206590491|emb|CAQ37453.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
 gi|206595031|emb|CAQ61958.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
 gi|299066986|emb|CBJ38181.1| Fe-S cluster assembly and activation factor [Ralstonia solanacearum
           CMR15]
 gi|299072313|emb|CBJ43647.1| Fe-S cluster assembly and activation factor [Ralstonia solanacearum
           CFBP2957]
 gi|299079076|emb|CBJ51738.1| Fe-S cluster assembly and activation factor [Ralstonia solanacearum
           PSI07]
          Length = 106

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+ A   +   +   +GK  G+R+ +K  GC+GL Y ++   D     D++ E +G
Sbjct: 1   MITLTDKAAQHVTRYL-ARRGKGVGLRLGVKTTGCSGLAYKLEYA-DEIAAEDNVFESNG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV +D  SL Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 59  VKVIVDPKSLPYIDGTELDYAREGLNEGFRFNNPNVKDECGCGESFRV 106


>gi|227885897|ref|ZP_04003702.1| HesB family protein [Escherichia coli 83972]
 gi|227837076|gb|EEJ47542.1| HesB family protein [Escherichia coli 83972]
 gi|307553705|gb|ADN46480.1| SufA scaffold protein for iron-sulfur cluster assembly [Escherichia
           coli ABU 83972]
          Length = 122

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 64/106 (60%), Gaps = 2/106 (1%)

Query: 6   TMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVK 65
           T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG K
Sbjct: 19  TLTPAAAIHIRELVAKQPGMI-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGAK 76

Query: 66  VWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 77  LFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 122


>gi|21312189|ref|NP_081197.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Mus musculus]
 gi|81170639|sp|Q9D924|ISCA1_MOUSE RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|12840954|dbj|BAB25025.1| unnamed protein product [Mus musculus]
 gi|17391301|gb|AAH18547.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Mus
           musculus]
 gi|26337127|dbj|BAC32248.1| unnamed protein product [Mus musculus]
 gi|26354821|dbj|BAC41037.1| unnamed protein product [Mus musculus]
 gi|55250324|gb|AAH85482.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Mus
           musculus]
 gi|74139353|dbj|BAE40820.1| unnamed protein product [Mus musculus]
 gi|74149091|dbj|BAE32196.1| unnamed protein product [Mus musculus]
 gi|148709345|gb|EDL41291.1| HESB like domain containing 2 [Mus musculus]
          Length = 129

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK++    + +  G+++ ++  GC GL Y ++  T    D D+ + +DGV
Sbjct: 25  LTLTPSAVNKIKQL-LKDKPEHVGLKVGVRTRGCNGLSYSLEY-TKTKGDSDEEVIQDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  +
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFHV 129


>gi|31745170|ref|NP_853657.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Rattus norvegicus]
 gi|81170640|sp|Q80W96|ISCA1_RAT RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|30269948|gb|AAP29778.1| HesB protein [Rattus norvegicus]
 gi|47482102|gb|AAH70929.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Rattus
           norvegicus]
 gi|50926756|gb|AAH78677.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Rattus
           norvegicus]
 gi|149039760|gb|EDL93876.1| rCG24212 [Rattus norvegicus]
          Length = 129

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK++    + +  G+++ ++  GC GL Y ++  T    D D+ + +DGV
Sbjct: 25  LTLTPSAVNKIKQL-LKDKPEHVGLKVGVRTRGCNGLSYSLEY-TKTKGDADEEVIQDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  +
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNV 129


>gi|283833347|ref|ZP_06353088.1| FeS assembly scaffold SufA [Citrobacter youngae ATCC 29220]
 gi|291070988|gb|EFE09097.1| FeS assembly scaffold SufA [Citrobacter youngae ATCC 29220]
          Length = 122

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V   Q    G+R+ +K+ GCAG  Y++D V   P   D L E DG 
Sbjct: 18  LTLTPAAAAHIRELV-AKQPDMMGVRLGVKQTGCAGFGYVLDTVR-QPEKDDLLFETDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 76  RLYVPLQAMPFIDGTEVDFVREGLNQLFKFHNPKAQNECGCGESFGV 122


>gi|172035486|ref|YP_001801987.1| Fe-S cluster biosynthesis, putative nitrogen fixation related
           protein [Cyanothece sp. ATCC 51142]
 gi|57864824|gb|AAW56999.1| HesB protein [Cyanothece sp. ATCC 51142]
 gi|171696940|gb|ACB49921.1| Fe-S cluster biosynthesis, putative nitrogen fixation related
           protein [Cyanothece sp. ATCC 51142]
          Length = 119

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 62/105 (59%), Gaps = 3/105 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEKDG 63
           VT+TE A  +++ +++ +     GIR+ +K GGC G EY ++LV +   + +D+  E+D 
Sbjct: 3   VTLTEKAALKLRTVLYGNSNNITGIRVGVKDGGCNGYEYALNLVKE--ANNEDVRFEQDN 60

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           V +++D  S+  + G  IDF      SGF F NPN    CGCG+S
Sbjct: 61  VPIYVDPKSVSLLDGVVIDFVDSLTQSGFTFTNPNATDTCGCGKS 105


>gi|120556065|ref|YP_960416.1| iron-sulfur cluster assembly accessory protein [Marinobacter
           aquaeolei VT8]
 gi|120325914|gb|ABM20229.1| FeS assembly scaffold SufA [Marinobacter aquaeolei VT8]
          Length = 118

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 67/111 (60%), Gaps = 3/111 (2%)

Query: 2   SDI-VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           SD+ VTMT  AV  +++ + + + +A+GIR+++KK GC+G +Y    V + P   D +  
Sbjct: 9   SDVNVTMTPTAVKHVRKQL-DKKPEAKGIRLAIKKSGCSGFKYETQWV-ETPESDDRIFT 66

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            DGV V++    L  + G EIDF TE + S F F NPN  + CGCG+S  +
Sbjct: 67  IDGVDVFVKQEHLPLVNGIEIDFVTEGVNSLFRFRNPNATAECGCGESFTV 117


>gi|209484093|gb|ACI47521.1| iron-sulfer cluster scaffold protein ISA1 [Eucalyptus grandis]
          Length = 167

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 68/105 (64%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  RI+ ++   Q +   +R+ +K  GC GL Y ++   D+    D+L+E  G
Sbjct: 51  VLTVTDAAASRIRHLL--QQRQRPFLRLGVKARGCNGLSYTLNYA-DSKGKFDELVEDKG 107

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +K+ ++  +L++++GT++DF  +KL S F+F NPN    CGCG+S
Sbjct: 108 IKILVEPKALMHVIGTKMDFVDDKLRSEFIFINPNSKGQCGCGES 152


>gi|254521986|ref|ZP_05134041.1| HesB/YadR/YfhF [Stenotrophomonas sp. SKA14]
 gi|219719577|gb|EED38102.1| HesB/YadR/YfhF [Stenotrophomonas sp. SKA14]
          Length = 112

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 62/104 (59%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T  A  R++  V  + G A G+R  + K GC+G  ++ DL  D   +GD + ++DGV
Sbjct: 3   VSLTPIAFERVQRFVAQTPG-ALGLRFGVTKTGCSGWGHVTDLARDER-EGDTVFDQDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+++D+ SL  + GT IDF    L   F F NPN  + CGCG+S
Sbjct: 61  KIYVDAKSLALVDGTVIDFGKHGLSETFTFSNPNATAECGCGES 104


>gi|83942564|ref|ZP_00955025.1| Iron-sulfur cluster assembly family protein [Sulfitobacter sp.
           EE-36]
 gi|83846657|gb|EAP84533.1| Iron-sulfur cluster assembly family protein [Sulfitobacter sp.
           EE-36]
          Length = 107

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 64/105 (60%), Gaps = 4/105 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A  R+ EI   ++GKA  +R++++ GGC+G +Y  D+  D+P D D ++E  G KV
Sbjct: 7   VTPRAFDRLAEIGAAAEGKA--LRVAVEGGGCSGFQY--DIALDDPKDDDLILEGAGQKV 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +DS SL ++    IDF  E + + FV  NPN  SACGCG S  +
Sbjct: 63  VVDSISLPFLTNAVIDFSEELIGARFVIENPNATSACGCGTSFSM 107


>gi|282901477|ref|ZP_06309402.1| HesB/YadR/YfhF [Cylindrospermopsis raciborskii CS-505]
 gi|281193756|gb|EFA68728.1| HesB/YadR/YfhF [Cylindrospermopsis raciborskii CS-505]
          Length = 121

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 66/109 (60%), Gaps = 5/109 (4%)

Query: 5   VTMTEAAVYRIKEIVFNS--QGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +T+TE A +R++  +  S  Q    G+RIS+K GGC+G EY ++ +T  P   DD++ K 
Sbjct: 3   ITLTEKAEFRLRAFLKTSATQENQSGVRISVKNGGCSGYEYGIE-ITSQP-QPDDIVTKQ 60

Query: 63  G-VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           G V ++ID+ S   + G EIDF    + SGF F NPN    CGCG+S +
Sbjct: 61  GNVLLYIDAKSAPLLEGVEIDFIEGVMDSGFKFSNPNATDTCGCGKSFK 109


>gi|302658416|ref|XP_003020912.1| hypothetical protein TRV_04988 [Trichophyton verrucosum HKI 0517]
 gi|291184782|gb|EFE40294.1| hypothetical protein TRV_04988 [Trichophyton verrucosum HKI 0517]
          Length = 249

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 65/94 (69%), Gaps = 3/94 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T  A+ +++++V  SQ   + IRI +K  GC+GL Y ++ V + P   D+++E+DGV
Sbjct: 149 VSLTPTALSKLRDLV--SQPDPKLIRIGVKNRGCSGLSYHLEYV-EKPAPFDEVVEQDGV 205

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPN 98
           KV IDS +L  ++G+E+D+  + L S FVF+NPN
Sbjct: 206 KVLIDSKALFSIIGSEMDWHEDPLSSRFVFNNPN 239


>gi|283785086|ref|YP_003364951.1| Fe-S cluster assembly protein [Citrobacter rodentium ICC168]
 gi|282948540|emb|CBG88130.1| Fe-S cluster assembly protein [Citrobacter rodentium ICC168]
          Length = 127

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V + P   D L E DG 
Sbjct: 23  LTLTPAAAAHIRELVAKQPGML-GVRLGVKQTGCAGFGYVLDSVRE-PQQDDLLFESDGA 80

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+D+  E L   F FHNP   + CGCG+S  +
Sbjct: 81  KLYVPLQAMPFIDGTEVDYVQEGLNQLFKFHNPKAQNECGCGESFGV 127


>gi|83953784|ref|ZP_00962505.1| Iron-sulfur cluster assembly family protein [Sulfitobacter sp.
           NAS-14.1]
 gi|83841729|gb|EAP80898.1| Iron-sulfur cluster assembly family protein [Sulfitobacter sp.
           NAS-14.1]
          Length = 107

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 64/105 (60%), Gaps = 4/105 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A  R+ EI   ++GKA  +R++++ GGC+G +Y  D+  D+P D D ++E  G KV
Sbjct: 7   VTPRAFDRLAEIGAAAEGKA--LRVAVEGGGCSGFQY--DIALDDPKDDDLILEGAGQKV 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +DS SL ++    IDF  E + + FV  NPN  SACGCG S  +
Sbjct: 63  VVDSISLPFLANAVIDFSEELIGARFVIENPNATSACGCGTSFSM 107


>gi|300312140|ref|YP_003776232.1| transcription regulator protein [Herbaspirillum seropedicae SmR1]
 gi|83630795|gb|ABC26891.1| HesB family protein [Herbaspirillum seropedicae]
 gi|300074925|gb|ADJ64324.1| transcription regulator protein [Herbaspirillum seropedicae SmR1]
          Length = 106

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 62/107 (57%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+    F ++  A G+R+++K  GC+G+ Y ++   D     D   E  GV
Sbjct: 3   ITLTENAARRVH--AFLAKRSAVGLRLAVKTSGCSGMAYALEYA-DVAEPQDVRFESHGV 59

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V ID  SL Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 60  TVLIDPKSLPYLDGTELDFVREGLNEGFKFNNPNAKNQCGCGESFAV 106


>gi|91788053|ref|YP_549005.1| iron-sulfur cluster assembly protein IscA [Polaromonas sp. JS666]
 gi|91697278|gb|ABE44107.1| iron-sulfur cluster assembly protein IscA [Polaromonas sp. JS666]
          Length = 107

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+AA   +   +   +GK  G+R+ +K  GC+GL Y ++   D     D + E +GV
Sbjct: 3   VTLTDAAARHVTRYM-AKRGKGVGVRLGVKTTGCSGLAYKLEY-ADEIAPEDVVFEDNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  S+ Y+ GT++DF  E L  GF F NPN+   CGCG+S  +
Sbjct: 61  KVLVDPKSMAYIDGTQLDFVREGLNEGFKFINPNERDRCGCGESFRV 107


>gi|254503095|ref|ZP_05115246.1| HesB-like domain, putative [Labrenzia alexandrii DFL-11]
 gi|222439166|gb|EEE45845.1| HesB-like domain, putative [Labrenzia alexandrii DFL-11]
          Length = 113

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 68/109 (62%), Gaps = 6/109 (5%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQG--IRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           VT+++ A  RI +I+    G+A G  +R+S++ GGC+GL+Y  D+V     D D +IEK 
Sbjct: 9   VTVSDRAAKRIAKIL---SGEASGSMLRVSVEGGGCSGLQYKYDVVGAQE-DDDLVIEKL 64

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G  V IDS SL YM G+EIDF  + +   F  +NP+ V+ CGCG S  I
Sbjct: 65  GATVLIDSISLQYMGGSEIDFVDDLIGQAFQINNPHAVAGCGCGTSFTI 113


>gi|21242369|ref|NP_641951.1| hypothetical protein XAC1619 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21107806|gb|AAM36487.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 112

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (60%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T AA+ R++  V  + G A G+R  + K GC+G  ++ DL  +   D D + E+DGV
Sbjct: 3   VSLTPAALERVQRFVQQTPG-ALGLRFGVTKTGCSGWGHVTDLAREV-RDDDAVFEQDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++D ASL  + GT IDF    L   F F NPN  + CGCG+S
Sbjct: 61  RIFVDPASLPLVDGTCIDFGKHGLSETFTFSNPNATAECGCGES 104


>gi|326386617|ref|ZP_08208239.1| HesB/YadR/YfhF [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208932|gb|EGD59727.1| HesB/YadR/YfhF [Novosphingobium nitrogenifigens DSM 19370]
          Length = 122

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 69/108 (63%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           V +T++A  RI  ++ ++   + G+++S  + GC+GL Y VD VT  +P+D  + I+  G
Sbjct: 17  VILTDSAKARIATLMASAPEGSIGVKLSTPRRGCSGLAYSVDYVTSASPLD--EKIDTPG 74

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             ++ID  S+LY++G+ +D++ +   +GFVF NPN    CGCG+S  +
Sbjct: 75  GVLFIDGGSVLYLVGSTMDWREDDFQAGFVFTNPNAKGTCGCGESFTV 122


>gi|194366364|ref|YP_002028974.1| iron-sulfur cluster assembly accessory protein [Stenotrophomonas
           maltophilia R551-3]
 gi|194349168|gb|ACF52291.1| iron-sulfur cluster assembly accessory protein [Stenotrophomonas
           maltophilia R551-3]
          Length = 112

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T  A  R++  V  + G A G+R  + K GC+G  ++ DL  D   D D + ++DGV
Sbjct: 3   VSLTPIAFERVQRFVAQTPG-ALGLRFGVTKTGCSGWGHVTDLARDERAD-DTVFDQDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+++D+ SL  + GT IDF    L   F F NPN  + CGCG+S
Sbjct: 61  KIYVDAKSLALVDGTVIDFGKHGLSETFTFSNPNATAECGCGES 104


>gi|47226594|emb|CAG08610.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 177

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 65/104 (62%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV RI+ ++   + +  G+++ +K  GC GL Y +D  T      D+ + +DGV
Sbjct: 73  LTLTPSAVKRIR-LLLEDKPEYTGLKVGVKTRGCNGLTYTLDY-TKEKHKSDEEVLQDGV 130

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +V+ID  + L +LGTE+DF   KL S F+F+NPN    CGC +S
Sbjct: 131 RVFIDRKAQLTLLGTEMDFVETKLTSEFIFNNPNIKGVCGCRES 174


>gi|149263924|ref|XP_484225.3| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Mus musculus]
 gi|149264021|ref|XP_985754.2| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Mus musculus]
 gi|56206095|emb|CAI25004.1| HESB like domain containing 2 [Mus musculus]
 gi|148700701|gb|EDL32648.1| mCG50313 [Mus musculus]
          Length = 129

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK++    + +  G+++ ++  GC GL Y ++  T    D D+ + +DGV
Sbjct: 25  LTLTPSAVNKIKQL-LKDKPEHVGLKVGVRTRGCNGLSYSLEY-TKTKGDSDEEVIQDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  +
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFHV 129


>gi|66814210|ref|XP_641284.1| hypothetical protein DDB_G0280173 [Dictyostelium discoideum AX4]
 gi|74855965|sp|Q54VS1|ISCA1_DICDI RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=Iron-sulfur assembly
           protein isca1; Flags: Precursor
 gi|60469319|gb|EAL67313.1| hypothetical protein DDB_G0280173 [Dictyostelium discoideum AX4]
          Length = 139

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 70/111 (63%), Gaps = 3/111 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEK 61
           I +MT++A+ R+KEI+ + +     G+R+ +K+ GC+G+ Y +D  T  N  D   + +K
Sbjct: 17  IFSMTDSALKRVKEIMNDKKIDNCIGLRLGIKERGCSGMSYTLDFATQKNKFDETVVADK 76

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           D + + +DS +LL ++GTE+D+  E +   F+F NPN  + CGCG+S   K
Sbjct: 77  D-INIIVDSKALLSVIGTEMDYIEEPIKKEFIFINPNATNTCGCGESFTTK 126


>gi|23010339|ref|ZP_00051062.1| COG0316: Uncharacterized conserved protein [Magnetospirillum
          magnetotacticum MS-1]
          Length = 130

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 62/92 (67%), Gaps = 3/92 (3%)

Query: 4  IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLV-TDNPVDGDDLIEKD 62
          ++T+T+ A  RIK I+ ++     G+R+ ++ GGCAG+ Y ++     NP  G+D+IE  
Sbjct: 6  VITLTDRAAERIKAIMADADRPIAGLRVGVRNGGCAGMSYTMEYAEARNP--GEDVIEDR 63

Query: 63 GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVF 94
          GV V+ID  ++L++LGTE+DF+T KL S  VF
Sbjct: 64 GVTVFIDPKAVLFLLGTEMDFQTTKLSSPVVF 95


>gi|52425362|ref|YP_088499.1| IscA protein [Mannheimia succiniciproducens MBEL55E]
 gi|81387009|sp|Q65SZ6|ERPA_MANSM RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|52307414|gb|AAU37914.1| IscA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 113

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 63/112 (56%), Gaps = 3/112 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV-DGDDLI 59
           M+  +T T+AA  ++K ++   + +   +R+ +  GGC+G +Y      D  V DGD  I
Sbjct: 4   MTIPLTFTDAAAKKVKNLIIEEENQDLKLRVYITGGGCSGFQY--GFTFDEKVNDGDLTI 61

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           E DGVK+ ID  SL Y++G  +D+      S FV HNPN  + CGCG S  I
Sbjct: 62  ENDGVKLVIDPMSLQYLIGGTVDYTEGLEGSRFVVHNPNATTTCGCGSSFSI 113


>gi|85703272|ref|ZP_01034376.1| Iron-sulfur cluster assembly family protein [Roseovarius sp. 217]
 gi|85672200|gb|EAQ27057.1| Iron-sulfur cluster assembly family protein [Roseovarius sp. 217]
          Length = 107

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 4/105 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A  R+ EI    QG+A  +R++++ GGC+G +Y + L  D P   D ++E +G KV
Sbjct: 7   VTHRAFARLAEIGAGDQGQA--LRVAVEGGGCSGFQYEIRL--DQPAADDLILEGEGQKV 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +DS SL ++ G  IDF  E + + FV  NPN  S+CGCG S  +
Sbjct: 63  VVDSVSLPFLSGATIDFSEELIGARFVIDNPNASSSCGCGTSFSM 107


>gi|262195414|ref|YP_003266623.1| iron-sulfur cluster assembly accessory protein [Haliangium
           ochraceum DSM 14365]
 gi|262078761|gb|ACY14730.1| iron-sulfur cluster assembly accessory protein [Haliangium
           ochraceum DSM 14365]
          Length = 123

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 3/112 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIV-FNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           + + +++T+ A  ++ EI    S  +  G+R+ +  GGCAG  Y  DL  DN  D D   
Sbjct: 14  LEEFLSITDTAASKVNEIREAESIEQEMGLRVRVVGGGCAGFSY--DLYFDNTTDMDRTF 71

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             +GV+V +D  SL+Y++GTEID+      +GF F+NPN  S CGCG S  +
Sbjct: 72  GVNGVEVVVDEMSLMYLMGTEIDYVESLQGAGFKFNNPNVKSTCGCGSSFSM 123


>gi|164660828|ref|XP_001731537.1| hypothetical protein MGL_1720 [Malassezia globosa CBS 7966]
 gi|159105437|gb|EDP44323.1| hypothetical protein MGL_1720 [Malassezia globosa CBS 7966]
          Length = 182

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 71/106 (66%), Gaps = 4/106 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDG--DDLIEKD 62
           + +T  AV  I++++  S G  + +R+ ++  GCAG+ Y ++ VT    +G  D+ + +D
Sbjct: 76  IKLTPTAVEHIRKLLSASDG-PKLVRVGVRNKGCAGMSYHLEYVTPGE-EGRFDERVMQD 133

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           GV+V IDS +L  ++G+E+D+K +++ + FVF+NPN   ACGCG+S
Sbjct: 134 GVEVLIDSRALFSIIGSEMDWKEDRMSAKFVFNNPNIKDACGCGES 179


>gi|313675675|ref|YP_004053671.1| iron-sulfur cluster assembly accessory protein [Marivirga tractuosa
           DSM 4126]
 gi|312942373|gb|ADR21563.1| iron-sulfur cluster assembly accessory protein [Marivirga tractuosa
           DSM 4126]
          Length = 108

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 68/111 (61%), Gaps = 6/111 (5%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQG--IRISLKKGGCAGLEYMVDLVTDNPV-DGDDLIE 60
           ++ +T+ A  R+ ++  + +G A+   +R+S+K GGC+GL Y  DL  D  V DGD++ E
Sbjct: 1   MIIVTDKAKDRLGKLR-SEEGHAENSNVRVSVKGGGCSGLMY--DLSFDEEVKDGDEIFE 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GVK+ +D  S+LY+LGT +DF       GF F NPN    CGCG+S  I
Sbjct: 58  DKGVKLLVDKKSMLYLLGTTLDFSDGLNGKGFQFINPNATRTCGCGESFSI 108


>gi|255640925|gb|ACU20744.1| unknown [Glycine max]
          Length = 134

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 67/104 (64%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T+AA  RI++++   Q +   +++ +K  GC GL Y ++   +     D+L+E  GV
Sbjct: 22  VSLTDAAASRIRQLL--QQRQRPFLKLGVKARGCNGLSYTLNYANEKG-KFDELVEDKGV 78

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+ ID  +L++++GT++DF  +KL S F+F NPN    CGCG+S
Sbjct: 79  KILIDPKALMHVIGTKMDFVDDKLKSEFIFVNPNSKGQCGCGES 122


>gi|53803003|ref|YP_115278.1| HesB/YadR/YfhF family protein [Methylococcus capsulatus str. Bath]
 gi|53756764|gb|AAU91055.1| HesB/YadR/YfhF family protein [Methylococcus capsulatus str. Bath]
          Length = 107

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 61/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE A  +I       +G   G+R+ +++ GC+G  Y+VD   +   D D + E+ GV
Sbjct: 3   VTVTENAAAQIAR-QLRRRGHGLGLRLGVRQAGCSGYSYVVDYADEIAAD-DAVFEQHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V + +A L Y+ G EID+  E L   F FHNP   ++CGCG+S  +
Sbjct: 61  TVVVKTADLTYLDGVEIDYTREGLNETFRFHNPKATASCGCGESFAV 107


>gi|294464585|gb|ADE77802.1| unknown [Picea sitchensis]
          Length = 129

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  RI++++   Q     +R+ +K  GC GL Y ++   D     D+L+E  GV
Sbjct: 26  LTLTETAAARIRQLLEMRQKPF--LRLGVKARGCNGLSYTLN-YADEKGKFDELVEDKGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +V ID  +L++++GT++DF  ++L S F+F NPN    CGCG+S
Sbjct: 83  RVLIDPKALMHVVGTKMDFLEDRLKSEFIFINPNSKGECGCGES 126


>gi|223948961|gb|ACN28564.1| unknown [Zea mays]
          Length = 130

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 67/104 (64%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV RI++++  S  +   +R+ +K  GC GL Y ++   D     D+L+E+ GV
Sbjct: 19  LTLTNAAVSRIRQLL--SLRQRPYLRLGVKARGCNGLSYTLNYA-DEKGKFDELVEEKGV 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV ID  +L++++GT++D+  + L S FVF NPN    CGCG+S
Sbjct: 76  KVLIDPKALMHVIGTKMDYVDDPLKSEFVFINPNSKGQCGCGES 119


>gi|254578016|ref|XP_002494994.1| ZYRO0B00968p [Zygosaccharomyces rouxii]
 gi|238937884|emb|CAR26061.1| ZYRO0B00968p [Zygosaccharomyces rouxii]
          Length = 255

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 69/105 (65%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +++++  A+  ++ ++   Q + + IRI +   GC+GL Y +  +T+ P   D+++E+DG
Sbjct: 151 LISLSPRAMTHLRSLL--DQPEPKLIRIGVTNRGCSGLSYDLQYITE-PGKYDEIVEQDG 207

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +KV +DS +L  ++G+E+D+  ++L S FVF NPN    CGCG+S
Sbjct: 208 IKVIVDSKALFSVVGSEMDWIDDRLSSRFVFRNPNSKGTCGCGES 252


>gi|226314355|ref|YP_002774251.1| hypothetical protein BBR47_47700 [Brevibacillus brevis NBRC 100599]
 gi|226097305|dbj|BAH45747.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 119

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 71/113 (62%), Gaps = 3/113 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQ-GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++T+TE+A  ++KE++  ++GK    +R+ ++ GGC+G  Y +    +   +GD+  E++
Sbjct: 1   MITLTESASLKVKEML-AAEGKPDVFLRVGVRTGGCSGFTYGMGW-DEEMKEGDETFEQN 58

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           GVK+ +D  S  Y+ GT+IDFK   +  GF   NPN V++CGCG S +   A+
Sbjct: 59  GVKIVVDKDSYPYIKGTQIDFKESMMGGGFSIENPNAVASCGCGSSFKTALAE 111


>gi|291485680|dbj|BAI86755.1| hypothetical protein BSNT_04758 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 121

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 64/108 (59%), Gaps = 1/108 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS+ VT+TEAA   IK+++   + +   +R+ +K GGC+GL Y +    +   + D + +
Sbjct: 2   MSNPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKS-ESDSVFD 60

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           + G+ V +D  SL  M GT ID+K   L  GF   NPN +++CGCG S
Sbjct: 61  QHGITVLVDKESLDIMNGTVIDYKQSMLGGGFTIDNPNAIASCGCGSS 108


>gi|325922529|ref|ZP_08184290.1| Iron-sulfur cluster assembly accessory protein [Xanthomonas
           gardneri ATCC 19865]
 gi|325546994|gb|EGD18087.1| Iron-sulfur cluster assembly accessory protein [Xanthomonas
           gardneri ATCC 19865]
          Length = 112

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T AA+ R++  V  + G   G+R  + K GC+G  ++ DL  D   D D + E+DGV
Sbjct: 3   ISLTPAALERVQRFVQQTPGTL-GLRFGVTKTGCSGWGHITDLARDQ-RDDDAVFEQDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++D  SL  + GT IDF    L   F F NPN  + CGCG+S
Sbjct: 61  RIFVDPTSLPLVDGTCIDFGKHGLSETFTFSNPNATAECGCGES 104


>gi|209523438|ref|ZP_03271993.1| iron-sulfur cluster assembly accessory protein [Arthrospira maxima
           CS-328]
 gi|209496180|gb|EDZ96480.1| iron-sulfur cluster assembly accessory protein [Arthrospira maxima
           CS-328]
          Length = 120

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 66/107 (61%), Gaps = 6/107 (5%)

Query: 5   VTMTEAAVYRIKEIVF--NSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV-DGDDLIEK 61
           + MT+AAV   ++++F    QG+   +R+ +++GGC+G+ YM+D +  N + D D++ + 
Sbjct: 14  IQMTDAAV---QQVLFLREKQGRDLCLRVGVRQGGCSGMSYMMDFIEPNNIQDTDEVFDH 70

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +G +V  D  SLLY+ G  +D+    +  GF F NPN    CGCG+S
Sbjct: 71  NGFQVVCDPKSLLYIYGMVLDYSNALIGGGFQFTNPNASQTCGCGKS 117


>gi|16080269|ref|NP_391096.1| chaperone involved in Fe-S cluster assembly [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221311158|ref|ZP_03593005.1| hypothetical protein Bsubs1_17456 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221315485|ref|ZP_03597290.1| hypothetical protein BsubsN3_17372 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221320400|ref|ZP_03601694.1| hypothetical protein BsubsJ_17335 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221324684|ref|ZP_03605978.1| hypothetical protein BsubsS_17486 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321312760|ref|YP_004205047.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           subtilis BSn5]
 gi|6648028|sp|O32113|YUTM_BACSU RecName: Full=Uncharacterized protein yutM
 gi|2635713|emb|CAB15206.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|320019034|gb|ADV94020.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           subtilis BSn5]
          Length = 120

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 64/108 (59%), Gaps = 1/108 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS+ VT+TEAA   IK+++   + +   +R+ +K GGC+GL Y +    +   + D + +
Sbjct: 1   MSNPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKS-ESDSVFD 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           + G+ V +D  SL  M GT ID+K   L  GF   NPN +++CGCG S
Sbjct: 60  QHGITVLVDKESLDIMNGTVIDYKQSMLGGGFTIDNPNAIASCGCGSS 107


>gi|149277991|ref|ZP_01884130.1| scaffold protein for iron-sulphur cluster assembly [Pedobacter sp.
           BAL39]
 gi|149231189|gb|EDM36569.1| scaffold protein for iron-sulphur cluster assembly [Pedobacter sp.
           BAL39]
          Length = 108

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 65/109 (59%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++T+T+ A  +I  ++ ++   ++  +R+S+K GGC+GL Y +D   +    GD   E  
Sbjct: 1   MITITDKAKSKIDHLMQDAHLDESYFLRVSVKGGGCSGLSYNLDFDNEEKT-GDQFFEDR 59

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVK+ +D  S LY+ GTE+DF       GF F+NPN   +CGCG+S  +
Sbjct: 60  GVKIALDMKSFLYLAGTELDFTDGLNGKGFNFNNPNASRSCGCGESFSV 108


>gi|190571644|ref|YP_001976002.1| HesB/YadR/YfhF family protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019046|ref|ZP_03334853.1| HesB/YadR/YfhF family protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357916|emb|CAQ55377.1| HesB/YadR/YfhF family protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995155|gb|EEB55796.1| HesB/YadR/YfhF family protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 128

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 71/115 (61%), Gaps = 8/115 (6%)

Query: 5   VTMTEAAVYRIKEIVFNSQG----KAQGIRISLKKGGCAGLEYMVDLVTD-NPVDG---D 56
           +T+T  AV R++ ++   +     +A GIR+ +K+ GC+GL+Y ++   D  P++    +
Sbjct: 14  ITLTANAVERVRFLLDKKKHANLEEAIGIRVLIKQKGCSGLKYDIEYAYDVRPLESVIEE 73

Query: 57  DLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
              +   VKV ID  S++++LG+E+D+  EK  SGF+F NPN+   CGCG+S  +
Sbjct: 74  SCSDDQKVKVLIDPKSIMFILGSEMDYVEEKFSSGFIFKNPNEKGKCGCGESFHV 128


>gi|296331800|ref|ZP_06874267.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|305675810|ref|YP_003867482.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           subtilis subsp. spizizenii str. W23]
 gi|296151125|gb|EFG92007.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|305414054|gb|ADM39173.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           subtilis subsp. spizizenii str. W23]
          Length = 120

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 64/108 (59%), Gaps = 1/108 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS+ VT+TEAA   IK+++   + +   +R+ +K GGC+GL Y +    +   + D + +
Sbjct: 1   MSNPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKG-ESDSMFD 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           + G+ V +D  SL  M GT ID+K   L  GF   NPN +++CGCG S
Sbjct: 60  QHGITVLVDKESLDIMNGTVIDYKQSMLGGGFTIDNPNAIASCGCGSS 107


>gi|149376036|ref|ZP_01893802.1| iron-binding protein IscA [Marinobacter algicola DG893]
 gi|149359673|gb|EDM48131.1| iron-binding protein IscA [Marinobacter algicola DG893]
          Length = 117

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMT  AV  +++ + + + +A+GIR+++KK GC+G +Y    V +   D D +   DGV
Sbjct: 12  VTMTPTAVKHVRKQL-DKKPEAKGIRLAIKKSGCSGFKYETQWVEEAAAD-DKVFHIDGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V++    L  + G EIDF TE + S F F NPN  + CGCG+S  +
Sbjct: 70  DVFVKEEHLPLVNGIEIDFVTEGVNSLFQFRNPNATAECGCGESFTV 116


>gi|220922155|ref|YP_002497456.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           nodulans ORS 2060]
 gi|219946761|gb|ACL57153.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           nodulans ORS 2060]
          Length = 108

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 61/108 (56%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEKDG 63
           +T+T  A  RI EI+  ++     +RIS+  GGC+G +Y  D+  D    GDD+ +E+DG
Sbjct: 4   ITLTPRAARRINEIM-GAEPPGSMLRISVNGGGCSGFQYAFDIARDRA--GDDIAVERDG 60

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             V +D  SL YM G+ IDF  + +   F   NP   ++CGCG S  +
Sbjct: 61  ATVLVDPLSLEYMRGSTIDFVNDLIGQSFKIENPQATASCGCGTSFSL 108


>gi|255082211|ref|XP_002508324.1| predicted protein [Micromonas sp. RCC299]
 gi|226523600|gb|ACO69582.1| predicted protein [Micromonas sp. RCC299]
          Length = 222

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 66/108 (61%), Gaps = 5/108 (4%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI---EKDG 63
           +TEAA  RIKE++  ++     ++I ++  GC G+ Y ++   D      D +   E  G
Sbjct: 117 LTEAAAARIKELL--AKRAKPYLKIGVRTRGCNGMTYTMNYADDGDKGKFDEVVTHEASG 174

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV ID A+L++++GT++DF T++L S FVF NPN    CGCG+S  +
Sbjct: 175 VKVIIDPAALMHVVGTKMDFVTDRLRSEFVFENPNAKGECGCGESFNV 222


>gi|188582822|ref|YP_001926267.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           populi BJ001]
 gi|179346320|gb|ACB81732.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           populi BJ001]
          Length = 108

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 63/112 (56%), Gaps = 5/112 (4%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-I 59
           M+DI T+T  A  RI EI+  S+     +RIS+  GGC+G  Y  D+ +    +GDD+ I
Sbjct: 1   MADI-TLTPRAAKRINEIM-GSEPPGSSLRISVNGGGCSGFSYAFDITSAR--EGDDIVI 56

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           E+DG  V +D  SL YM G  IDF  + +   F   NP   ++CGCG S  I
Sbjct: 57  ERDGATVLVDPVSLEYMGGATIDFVNDLIGQSFKIENPLATASCGCGTSFAI 108


>gi|31206473|ref|XP_312196.1| AGAP002730-PA [Anopheles gambiae str. PEST]
 gi|21295988|gb|EAA08133.1| AGAP002730-PA [Anopheles gambiae str. PEST]
          Length = 130

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 69/113 (61%), Gaps = 6/113 (5%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQ--GIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           M   +++T AAV RIK+++   +GK +  G+++ +++ GC GL Y +D         D+ 
Sbjct: 22  MRAALSLTPAAVNRIKQLL---EGKNEFIGLKVGVRQRGCNGLSYTLDYAATKD-KMDEE 77

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + +DGVKV ID  + L +LGTE+D+    L + FVF+NPN    CGCG+S  I
Sbjct: 78  VVQDGVKVLIDKKAQLSLLGTEMDYVETDLSAEFVFNNPNIKGTCGCGESFSI 130


>gi|171677201|ref|XP_001903552.1| hypothetical protein [Podospora anserina S mat+]
 gi|170936668|emb|CAP61327.1| unnamed protein product [Podospora anserina S mat+]
          Length = 231

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 66/104 (63%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T AAV  ++ ++   Q   + I++ ++  GC+GL Y ++ V + P   D+ +E+DGV
Sbjct: 128 MKLTPAAVDHLRALL--DQPDPKLIKVGVRNRGCSGLAYHLEFV-EKPGAFDETVEQDGV 184

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV IDS +L  ++G+E+D+  +KL   FVF NPN    CGCG+S
Sbjct: 185 KVLIDSKALFSIIGSEMDWIEDKLSQRFVFRNPNIKEQCGCGES 228


>gi|212640227|ref|YP_002316747.1| Fe-S cluster assembly scaffold protein [Anoxybacillus flavithermus
           WK1]
 gi|212561707|gb|ACJ34762.1| Fe-S cluster assembly scaffold protein [Anoxybacillus flavithermus
           WK1]
          Length = 120

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 63/108 (58%), Gaps = 1/108 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M  IV +TE AV ++K+++  S  +    R+ +  GGC+GL Y +     N  + D   E
Sbjct: 1   MEQIVLLTEKAVEQVKQMMKESGEEHAYFRVGVYGGGCSGLSYAMGF-EHNKREDDHEFE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++G+++ +D  S L + GT ID++   +  GF  HNPN +++CGCG S
Sbjct: 60  QNGLRILVDKESALVLKGTTIDYEQGAMGGGFTIHNPNAIASCGCGSS 107


>gi|197105432|ref|YP_002130809.1| HesB/YadR/YfhF family protein [Phenylobacterium zucineum HLK1]
 gi|196478852|gb|ACG78380.1| HesB/YadR/YfhF family protein [Phenylobacterium zucineum HLK1]
          Length = 111

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++ AA  RI+ +   ++G+   +R++++ GGC+G +Y  DLV D P   D  +E+DG 
Sbjct: 7   VTLSPAAAERIRAL-GEAEGRPVMLRVAVEGGGCSGFQYQFDLV-DQPQADDLKVERDGA 64

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
              +D  SL  + G+EIDF  E   + F   NPN  S+CGCG S  I
Sbjct: 65  AALVDVVSLALLKGSEIDFVDELAGAEFRIRNPNARSSCGCGVSFSI 111


>gi|311069710|ref|YP_003974633.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           atrophaeus 1942]
 gi|310870227|gb|ADP33702.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           atrophaeus 1942]
          Length = 120

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 64/108 (59%), Gaps = 1/108 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS+ VT+TEAA   IK+++   + +   +R+ +K GGC+GL Y +    +   + D   E
Sbjct: 1   MSNPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKG-EQDSAFE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           + G+ V +D+ S+  M GT IDFK   +  GF   NPN +++CGCG S
Sbjct: 60  QHGITVLVDNESMDIMNGTIIDFKQSMMGGGFTIDNPNAIASCGCGSS 107


>gi|171913432|ref|ZP_02928902.1| iron-sulfur cluster assembly accessory protein [Verrucomicrobium
           spinosum DSM 4136]
          Length = 110

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 67/111 (60%), Gaps = 5/111 (4%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGI--RISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           ++ +T+ AV  ++E++  SQ  A G+  R+ +KKGGCAG EY + L  D+P   D +   
Sbjct: 1   MIAVTDNAVKHLRELL-ESQNAAAGVGLRLMVKKGGCAGWEYAMKL--DSPGAADRVFGP 57

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           +GV V++D  SL Y+ G+++D+      +GF   NPN   +CGCG S E K
Sbjct: 58  EGVSVFVDPESLEYLDGSQLDYSEGLSDAGFKVENPNAARSCGCGSSFEPK 108


>gi|218463282|ref|ZP_03503373.1| iron-sulfur cluster assembly accessory protein [Rhizobium etli Kim
           5]
 gi|218673945|ref|ZP_03523614.1| iron-sulfur cluster assembly accessory protein [Rhizobium etli
           GR56]
          Length = 110

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+++AA  RI  I+    GK+  +R+S++ GGC+G  Y  DL  D+  D D ++EK+  
Sbjct: 6   VTLSDAAAKRIAAIIGAEAGKS-ALRVSVEGGGCSGFSYKFDLA-DSAGDDDIIVEKNDA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS SL+YM G+EIDF    L   F   NPN V++CGCG S  I
Sbjct: 64  KVLIDSLSLVYMAGSEIDFVDNLLGQSFQIKNPNAVASCGCGTSFSI 110


>gi|325192644|emb|CCA27067.1| ironsulfur cluster assembly protein putative [Albugo laibachii
           Nc14]
          Length = 154

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 67/111 (60%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           +   + +T AA  RI+E++ N + +A GIR+ ++  GC GL Y ++   D     ++ ++
Sbjct: 46  LPPPLKITNAAADRIRELMKN-KPEALGIRLGVRTRGCNGLSYTMNYA-DRKAPLEEEVK 103

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GV V+++  +L +++GT +DF T  L S FVF NPN   +CGCG+S  +
Sbjct: 104 DKGVCVFVEPKALFHVVGTTMDFHTSPLASEFVFENPNAKGSCGCGESFNV 154


>gi|121604472|ref|YP_981801.1| iron-sulfur cluster assembly protein IscA [Polaromonas
           naphthalenivorans CJ2]
 gi|120593441|gb|ABM36880.1| iron-sulfur cluster assembly protein IscA [Polaromonas
           naphthalenivorans CJ2]
          Length = 107

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T AA   + E     +G   G+R+++K  GC+G  Y ++ V     D D   E  G 
Sbjct: 3   ISLTPAAARHV-EKSLAKRGSGIGLRLAVKTSGCSGFAYALEFVDAMTAD-DQAFETHGT 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ IDS SL  + GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  KIIIDSRSLAMLDGTELDFVREGLNEGFKFNNPNAKANCGCGESFAV 107


>gi|56707820|ref|YP_169716.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|89256820|ref|YP_514182.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. holarctica LVS]
 gi|110670291|ref|YP_666848.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. tularensis FSC198]
 gi|115315206|ref|YP_763929.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. holarctica OSU18]
 gi|118497209|ref|YP_898259.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. novicida U112]
 gi|134302407|ref|YP_001122377.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|156502986|ref|YP_001429051.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. holarctica FTNF002-00]
 gi|167009859|ref|ZP_02274790.1| HesB/YadR/YfhF family protein [Francisella tularensis subsp.
           holarctica FSC200]
 gi|187932014|ref|YP_001891999.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|194323508|ref|ZP_03057285.1| conserved hypothetical protein, putative [Francisella tularensis
           subsp. novicida FTE]
 gi|208779002|ref|ZP_03246348.1| conserved hypothetical protein [Francisella novicida FTG]
 gi|224456891|ref|ZP_03665364.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|254368102|ref|ZP_04984122.1| hypothetical protein FTHG_01432 [Francisella tularensis subsp.
           holarctica 257]
 gi|254369704|ref|ZP_04985714.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|254370316|ref|ZP_04986321.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254372574|ref|ZP_04988063.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|254374033|ref|ZP_04989515.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|254874634|ref|ZP_05247344.1| iron-binding protein erpA [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|290953516|ref|ZP_06558137.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. holarctica URFT1]
 gi|295313208|ref|ZP_06803867.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. holarctica URFT1]
 gi|81597692|sp|Q5NGX6|ERPA_FRATT RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|122324797|sp|Q0BKU2|ERPA_FRATO RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|122500401|sp|Q2A270|ERPA_FRATH RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|122970999|sp|Q14IC8|ERPA_FRAT1 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160380672|sp|A7NDP2|ERPA_FRATF RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160380673|sp|A0Q5J0|ERPA_FRATN RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160380674|sp|A4IZA5|ERPA_FRATW RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|226694549|sp|B2SDK6|ERPA_FRATM RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|54112963|gb|AAV29115.1| NT02FT0998 [synthetic construct]
 gi|56604312|emb|CAG45333.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|89144651|emb|CAJ79975.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|110320624|emb|CAL08716.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115130105|gb|ABI83292.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica OSU18]
 gi|118423115|gb|ABK89505.1| conserved protein of unknown function [Francisella novicida U112]
 gi|134050184|gb|ABO47255.1| iron-sulfur cluster assembly accessory protein with HesB-like
           domain [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|134253912|gb|EBA53006.1| hypothetical protein FTHG_01432 [Francisella tularensis subsp.
           holarctica 257]
 gi|151568559|gb|EDN34213.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|151570301|gb|EDN35955.1| conserved hypothetical protein [Francisella novicida GA99-3549]
 gi|151571753|gb|EDN37407.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|156253589|gb|ABU62095.1| iron-sulfur cluster assembly accessory protein/HesB-like domain
           [Francisella tularensis subsp. holarctica FTNF002-00]
 gi|157122663|gb|EDO66792.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|187712923|gb|ACD31220.1| conserved hypothetical protein [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|194322363|gb|EDX19844.1| conserved hypothetical protein, putative [Francisella tularensis
           subsp. novicida FTE]
 gi|208744802|gb|EDZ91100.1| conserved hypothetical protein [Francisella novicida FTG]
 gi|254840633|gb|EET19069.1| iron-binding protein erpA [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282158996|gb|ADA78387.1| HesB/YadR/YfhF family protein [Francisella tularensis subsp.
           tularensis NE061598]
 gi|328676681|gb|AEB27551.1| putative iron binding protein from the HesB_IscA_SufA family
           [Francisella cf. novicida Fx1]
          Length = 116

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 64/110 (58%), Gaps = 3/110 (2%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEK 61
           D +  TEAA  ++KE++      +  +R+ +  GGC+G +Y      DN V  DD+ I K
Sbjct: 9   DPINFTEAASLKVKELIEEEGDNSLSLRVYITGGGCSGFQYA--FAFDNEVKEDDMVITK 66

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +GV++ +DS S  Y++G ++D+K +   + FV  NPN  + CGCG S  +
Sbjct: 67  NGVRLLVDSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV 116


>gi|294501681|ref|YP_003565381.1| iron-sulfur cluster assembly accessory protein [Bacillus megaterium
           QM B1551]
 gi|295707029|ref|YP_003600104.1| iron-sulfur cluster assembly accessory protein [Bacillus megaterium
           DSM 319]
 gi|294351618|gb|ADE71947.1| iron-sulfur cluster assembly accessory protein [Bacillus megaterium
           QM B1551]
 gi|294804688|gb|ADF41754.1| iron-sulfur cluster assembly accessory protein [Bacillus megaterium
           DSM 319]
          Length = 121

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 65/106 (61%), Gaps = 1/106 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           DI+T+TEAA ++IK+++   + +   +R+++  GGC+GL Y +    +   + D L E+ 
Sbjct: 4   DILTITEAASFQIKDMMKEHEEENAYLRVNVNGGGCSGLSYGMGFAHE-VNENDTLFEQH 62

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           G+K+ +DS S   +   +ID+K   L  GF   NPN ++ACGCG S
Sbjct: 63  GIKILVDSESAPILKDVKIDYKQSMLGGGFTIDNPNAIAACGCGSS 108


>gi|309701909|emb|CBJ01221.1| Fe-S cluster assembly protein [Escherichia coli ETEC H10407]
          Length = 122

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 18  LTLTPAAAIHIRELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGC +S  +
Sbjct: 76  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCSESFGV 122


>gi|221504900|gb|EEE30565.1| iron-sulfur cluster assembly accessory protein, putative
           [Toxoplasma gondii VEG]
          Length = 504

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 59/97 (60%), Gaps = 11/97 (11%)

Query: 23  QGKAQGIRISLKKGGCAGLEYMVDLVTD-----------NPVDGDDLIEKDGVKVWIDSA 71
           + +A GIRI L+K GC+GL Y VD+ T             P   D++IE  G ++ + S 
Sbjct: 405 KARAIGIRIGLEKRGCSGLSYTVDVATQSNASSSAASGKQPWAADEVIETAGGRLVVASD 464

Query: 72  SLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++++GTE+DF   +L   FVF NPN+  +CGCG+S
Sbjct: 465 AVMFLVGTEVDFVDTELERKFVFKNPNEKQSCGCGKS 501


>gi|221484723|gb|EEE23017.1| iron-sulfur cluster assembly accessory protein, putative
           [Toxoplasma gondii GT1]
          Length = 504

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 59/97 (60%), Gaps = 11/97 (11%)

Query: 23  QGKAQGIRISLKKGGCAGLEYMVDLVTD-----------NPVDGDDLIEKDGVKVWIDSA 71
           + +A GIRI L+K GC+GL Y VD+ T             P   D++IE  G ++ + S 
Sbjct: 405 KARAIGIRIGLEKRGCSGLSYTVDVATQSSASSSAASGKQPWAADEVIETAGGRLVVASD 464

Query: 72  SLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++++GTE+DF   +L   FVF NPN+  +CGCG+S
Sbjct: 465 AVMFLVGTEVDFVDTELERKFVFKNPNEKQSCGCGKS 501


>gi|320539148|ref|ZP_08038819.1| Fe-S cluster assembly protein [Serratia symbiotica str. Tucson]
 gi|320030786|gb|EFW12794.1| Fe-S cluster assembly protein [Serratia symbiotica str. Tucson]
          Length = 123

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++AV +I +++   + +A+G+++ +K+ GCAG  Y++DL  D P D D L E+ G 
Sbjct: 19  ITLSDSAVQQIIKLM-QQKPQAKGLQLGVKQSGCAGFAYVLDLSCD-PADDDLLFERGGA 76

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GT +DF  E L   F F+NP    ACGCG+S  I
Sbjct: 77  KLYVPLKAMPFIDGTTVDFVREGLNQMFKFNNPKAQHACGCGESFGI 123


>gi|312114729|ref|YP_004012325.1| iron-sulfur cluster assembly accessory protein [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219858|gb|ADP71226.1| iron-sulfur cluster assembly accessory protein [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 106

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 64/105 (60%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TEAA   ++  +  +    +G+R+++  GGCAG +Y++ LV D P   D ++E+ G
Sbjct: 1   MIYLTEAAANAVRTAIKGANTPIEGLRLAVDAGGCAGFKYLMGLVAD-PNPEDIVVEERG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV++D  S+  + GT +DF      SGF F NP   ++C CG+S
Sbjct: 60  VKVFVDRDSVQMLEGTTVDFVIGLQSSGFTFDNPQATASCSCGKS 104


>gi|158424432|ref|YP_001525724.1| HesB protein [Azorhizobium caulinodans ORS 571]
 gi|158331321|dbj|BAF88806.1| HesB protein [Azorhizobium caulinodans ORS 571]
          Length = 140

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T++A  RI EI  +++     +R+S++ GGC+G +Y  D+  +   D D +IE+DG 
Sbjct: 36  VIVTDSAARRISEI-LSAEAPESALRVSVEGGGCSGFQYRFDVTRERNPD-DIVIEQDGA 93

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  SL YM G  IDF  + + + F   NP+  ++CGCG S  I
Sbjct: 94  TVLVDKVSLDYMSGCRIDFVDDLIGAAFKIENPHATASCGCGTSFSI 140


>gi|170019966|ref|YP_001724920.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli
           ATCC 8739]
 gi|169754894|gb|ACA77593.1| FeS assembly scaffold SufA [Escherichia coli ATCC 8739]
          Length = 122

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I E+V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 18  LTLTPAAAIHICELVAKQPGMV-GVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 76  KLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV 122


>gi|328675737|gb|AEB28412.1| putative iron binding protein from the HesB_IscA_SufA family
           [Francisella cf. novicida 3523]
          Length = 116

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 64/110 (58%), Gaps = 3/110 (2%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EK 61
           D +  TEAA  ++KE++      +  +R+ +  GGC+G +Y      DN V  DD+I  K
Sbjct: 9   DPINFTEAASLKVKELIEEEGDNSLSLRVYITGGGCSGFQYA--FAFDNEVKEDDMIITK 66

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +GV++ +DS S  Y++G ++D+K +   + FV  NPN  + CGCG S  +
Sbjct: 67  NGVRLLVDSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV 116


>gi|226941777|ref|YP_002796851.1| hypothetical protein LHK_02863 [Laribacter hongkongensis HLHK9]
 gi|226716704|gb|ACO75842.1| hypothetical protein LHK_02863 [Laribacter hongkongensis HLHK9]
          Length = 107

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++E A   +   +   +GK  G+R+ +K  GC+G+ Y ++ V D P   D   E  GV
Sbjct: 3   ITLSERAATHVLGFL-ARRGKGVGLRLGVKTSGCSGMAYKLEFV-DVPDPDDISFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V+ D+ SL Y+ GTE+D+  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  TVFTDAKSLAYIDGTELDYTKEGLNEGFRFNNPNVKNECGCGESFNV 107


>gi|116251799|ref|YP_767637.1| HesB family protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256447|emb|CAK07531.1| putative HesB family protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 110

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+++AA  RI  IV    GK+  +R+S++ GGC+G  Y  DL      D D ++EK+  
Sbjct: 6   VTLSDAAAKRIAAIVGAEAGKS-ALRVSVEGGGCSGFSYKFDLADSADDD-DIIVEKNDA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS SL+YM G+EIDF    L   F   NPN V++CGCG S  I
Sbjct: 64  KVLIDSLSLVYMAGSEIDFVDNLLGQSFQIKNPNAVASCGCGTSFSI 110


>gi|260428225|ref|ZP_05782204.1| HesB/YadR/YfhF [Citreicella sp. SE45]
 gi|260422717|gb|EEX15968.1| HesB/YadR/YfhF [Citreicella sp. SE45]
          Length = 107

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 62/105 (59%), Gaps = 4/105 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T+ A  R+ EI   +QGKA  +R++++ GGC+G +Y  D+  D P D D ++E  G +V
Sbjct: 7   VTDRAFARLSEIGAGAQGKA--LRVAVEGGGCSGFQY--DIKLDEPADDDLVLEASGERV 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            ID  SL ++    IDF  E + + F   NPN  S+CGCG S  +
Sbjct: 63  VIDEISLPFLANATIDFTEELIGARFTIENPNASSSCGCGTSFSM 107


>gi|118353659|ref|XP_001010095.1| Iron-sulfur cluster assembly accessory protein [Tetrahymena
           thermophila]
 gi|89291862|gb|EAR89850.1| Iron-sulfur cluster assembly accessory protein [Tetrahymena
           thermophila SB210]
          Length = 199

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 69/110 (62%), Gaps = 2/110 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGK-AQGIRISLKKGGCAGLEYMVDLVTDNPVDG-DDLIEK 61
            +T+T+ A  RIKE++     +  +G++I +++ GC+GL Y ++  T    +  D++I  
Sbjct: 90  FLTLTDRAAARIKELMMKRTSEDVKGVKIGVRRRGCSGLTYTMNYCTSLSENKFDEIIND 149

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GV + ID+ +L+ ++GTE+D+  + L + FVF+NPN    CGCG+S  I
Sbjct: 150 KGVTIVIDNKALMALVGTEMDWVEDDLKAEFVFNNPNSKGTCGCGESFHI 199


>gi|328771838|gb|EGF81877.1| hypothetical protein BATDEDRAFT_10349 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 102

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 66/101 (65%), Gaps = 2/101 (1%)

Query: 8   TEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVW 67
           T AAV R++ +  +  G  + +++  KK GC+G  Y ++ VT+     D+++ +DGV+V 
Sbjct: 1   TPAAVNRLRLLTLDLNG-PKLLKVGTKKKGCSGQTYTLEYVTEKS-KFDEVVVQDGVQVL 58

Query: 68  IDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           IDS +L  ++G+E+D+  +KL + FVF+NPN    CGCGQS
Sbjct: 59  IDSKALFSLIGSEMDYVEDKLSAQFVFNNPNVKEMCGCGQS 99


>gi|261199912|ref|XP_002626357.1| iron-binding protein iscA [Ajellomyces dermatitidis SLH14081]
 gi|239594565|gb|EEQ77146.1| iron-binding protein iscA [Ajellomyces dermatitidis SLH14081]
          Length = 276

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 64/102 (62%), Gaps = 3/102 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A+  ++ +    Q   + +R+ +K  GC+GL Y ++ V D     D+++E+DGV++
Sbjct: 175 ITPEAIVHLRRLT--DQPDPKLVRVGVKNRGCSGLSYHLEYV-DKAAPFDEVVEQDGVRI 231

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            IDS +L  ++G+E+D++ + L S FVF NPN    CGCG+S
Sbjct: 232 LIDSKALFSIIGSEMDWQEDSLASRFVFRNPNIKDECGCGES 273


>gi|300022778|ref|YP_003755389.1| iron-sulfur cluster assembly accessory protein [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299524599|gb|ADJ23068.1| iron-sulfur cluster assembly accessory protein [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 107

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE A  RI EI  +  G    +R+S++ GGC+G +Y  DL      D D +IE+ G 
Sbjct: 3   VTVTEQAATRISEIAGSEPGSPV-LRVSVEGGGCSGFQYKFDLTNARAAD-DFVIERAGA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V ID  SL YM G EIDF  + + + F   NP   ++CGCG S  +
Sbjct: 61  VVVIDPVSLQYMEGAEIDFVDDLIGAAFKIKNPVATASCGCGTSFSV 107


>gi|152970690|ref|YP_001335799.1| iron-sulfur cluster assembly scaffold protein [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|238895191|ref|YP_002919926.1| iron-sulfur cluster assembly scaffold protein [Klebsiella
           pneumoniae NTUH-K2044]
 gi|262044173|ref|ZP_06017245.1| iron-sulfur cluster assembly protein IscA [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|330012601|ref|ZP_08307436.1| FeS assembly scaffold SufA [Klebsiella sp. MS 92-3]
 gi|150955539|gb|ABR77569.1| iron-sulfur cluster assembly scaffold protein [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|238547508|dbj|BAH63859.1| iron-sulfur cluster assembly scaffold protein [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259038470|gb|EEW39669.1| iron-sulfur cluster assembly protein IscA [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|328533760|gb|EGF60449.1| FeS assembly scaffold SufA [Klebsiella sp. MS 92-3]
          Length = 125

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT AA   I++++   Q   +G+R+ +K  GCAG  Y+++++ + P   D L E DG 
Sbjct: 18  LTMTPAAAAHIRDLM-RKQPDKKGLRLGIKTSGCAGFGYVLEMIAE-PAPDDLLFESDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           K++    ++ ++ GTE+D+  E L   F FHNP     CGCG+S  ++
Sbjct: 76  KLFAPLQAMPFIDGTELDYVREGLNEIFKFHNPKAQHECGCGESFGVQ 123


>gi|114600081|ref|XP_001134901.1| PREDICTED: similar to GK004 isoform 2 [Pan troglodytes]
          Length = 163

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV  IK+++   + +  G+++ ++  GC GL Y ++  T    D D    +DGV
Sbjct: 25  LTLTPSAVNTIKQLL-KDKPEHVGVKVGVRTRGCNGLSYTLEY-TKTKGDSDKEFIQDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I+
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNIR 130


>gi|327350430|gb|EGE79287.1| iron-binding protein iscA [Ajellomyces dermatitidis ATCC 18188]
          Length = 276

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 64/102 (62%), Gaps = 3/102 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A+  ++ +    Q   + +R+ +K  GC+GL Y ++ V D     D+++E+DGV++
Sbjct: 175 ITPEAIVHLRRLT--DQPDPKLVRVGVKNRGCSGLSYHLEYV-DKAAPFDEVVEQDGVRI 231

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            IDS +L  ++G+E+D++ + L S FVF NPN    CGCG+S
Sbjct: 232 LIDSKALFSIIGSEMDWQEDSLASRFVFRNPNIKDECGCGES 273


>gi|307104394|gb|EFN52648.1| hypothetical protein CHLNCDRAFT_14993 [Chlorella variabilis]
          Length = 106

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AAV R+KE++       + +++ +K  GC G+ Y ++   D+    D+++E++GV
Sbjct: 3   LELTDAAVERVKELLHKRN--KEFLKLGVKTRGCNGMAYTLNY-ADSKGRFDEVVEQEGV 59

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  +L+++LGT++D+  ++L S F+F NPN    CGCG+S  +
Sbjct: 60  KVLIDPGALMHVLGTKMDWVEDRLRSEFIFVNPNAKGTCGCGESFTV 106


>gi|162454146|ref|YP_001616513.1| hypothetical protein sce5870 [Sorangium cellulosum 'So ce 56']
 gi|161164728|emb|CAN96033.1| hypothetical protein sce5870 [Sorangium cellulosum 'So ce 56']
          Length = 107

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 61/108 (56%), Gaps = 1/108 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+ A  ++ EI    +   QG+R+ +  GGCAG  Y +    D P + D+  E  G
Sbjct: 1   MITITQKAAEKVMEIATAEELLGQGLRLRVVGGGCAGFSYDL-YFEDKPTEFDEEFEDRG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +K++ID  S  Y+ GTEID+      SGF F NP+  S CGCG S  +
Sbjct: 60  IKLYIDPLSFQYLDGTEIDYVEGLHGSGFKFSNPSVKSTCGCGSSFSV 107


>gi|241204408|ref|YP_002975504.1| iron-sulfur cluster assembly accessory protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240858298|gb|ACS55965.1| iron-sulfur cluster assembly accessory protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 110

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+++AA  RI  IV    GK+  +R+S++ GGC+G  Y  DL      D D ++EK+  
Sbjct: 6   VTLSDAAAKRIAAIVGAETGKS-ALRVSVEGGGCSGFSYKFDLADGAGDD-DIIVEKNDA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS SL+YM G+EIDF    L   F   NPN V++CGCG S  I
Sbjct: 64  KVLIDSLSLVYMAGSEIDFVDNLLGQSFQIKNPNAVASCGCGTSFSI 110


>gi|269926518|ref|YP_003323141.1| iron-sulfur cluster assembly accessory protein [Thermobaculum
           terrenum ATCC BAA-798]
 gi|269790178|gb|ACZ42319.1| iron-sulfur cluster assembly accessory protein [Thermobaculum
           terrenum ATCC BAA-798]
          Length = 118

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 66/108 (61%), Gaps = 3/108 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKD 62
           +VT+TE+A  +IK+++     +   +R+ +  GGC+GL Y   +  +  VD +D + E++
Sbjct: 1   MVTITESAAAKIKDLMEKEGQQGAALRLYVAGGGCSGLNY--GMAFEEEVDPEDHVFEQN 58

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           GVK+ IDS S  Y+ G+EID+      SGF  +NPN VS C CG S +
Sbjct: 59  GVKILIDSYSYPYVKGSEIDYIDGLFGSGFTINNPNAVSTCACGHSFD 106


>gi|170768731|ref|ZP_02903184.1| FeS assembly scaffold SufA [Escherichia albertii TW07627]
 gi|170122279|gb|EDS91210.1| FeS assembly scaffold SufA [Escherichia albertii TW07627]
          Length = 120

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (60%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I E+V   Q    G+R+ +K+ GCAG  Y++D V++ P   D L E DG 
Sbjct: 16  LTLTPAAAVHICELV-AKQPSMVGVRLGVKQTGCAGFGYVLDSVSE-PDKDDLLFEHDGA 73

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S
Sbjct: 74  KLYVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGES 117


>gi|119509266|ref|ZP_01628416.1| HesB protein [Nodularia spumigena CCY9414]
 gi|119466108|gb|EAW46995.1| HesB protein [Nodularia spumigena CCY9414]
          Length = 123

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 66/110 (60%), Gaps = 5/110 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGK----AQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           V++TE A +R++  +  S  +    ++GIR+S+K GGC+G EY +D VT  P   D +I+
Sbjct: 3   VSLTEKAEFRLRSFIRGSSPENNDASKGIRVSVKDGGCSGYEYGID-VTSKPQPDDLVIQ 61

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +  V +++D+ S   + G  IDF    + SGF F NPN    CGCG+S +
Sbjct: 62  QGNVLIYVDAKSAPLLDGVVIDFVEGVMESGFKFTNPNASDTCGCGKSFK 111


>gi|239607955|gb|EEQ84942.1| iron-binding protein iscA [Ajellomyces dermatitidis ER-3]
          Length = 276

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 64/102 (62%), Gaps = 3/102 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A+  ++ +    Q   + +R+ +K  GC+GL Y ++ V D     D+++E+DGV++
Sbjct: 175 ITPEAIVHLRRLT--DQPDPKLVRVGVKNRGCSGLSYHLEYV-DKAAPFDEVVEQDGVRI 231

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            IDS +L  ++G+E+D++ + L S FVF NPN    CGCG+S
Sbjct: 232 LIDSKALFSIIGSEMDWQEDSLASRFVFRNPNIKDECGCGES 273


>gi|126734648|ref|ZP_01750394.1| FeS cluster assembly HesB family protein, putative [Roseobacter sp.
           CCS2]
 gi|126715203|gb|EBA12068.1| FeS cluster assembly HesB family protein, putative [Roseobacter sp.
           CCS2]
          Length = 108

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 64/105 (60%), Gaps = 4/105 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A  R+ EI  ++QGKA  +RI+++ GGC+G +Y +DL  D   D D L+ + G  V
Sbjct: 8   VTTRAFERLAEIGASAQGKA--LRIAVEGGGCSGFQYEIDL--DEAKDDDLLLSEKGETV 63

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IDS SL ++    IDF  E + + FV +NPN  S+CGCG S  +
Sbjct: 64  VIDSVSLPFLADAVIDFSEELIGARFVINNPNATSSCGCGTSFSM 108


>gi|15805466|ref|NP_294162.1| HesB/YadR/YfhF family protein [Deinococcus radiodurans R1]
 gi|6458121|gb|AAF10017.1|AE001903_5 HesB/YadR/YfhF family protein [Deinococcus radiodurans R1]
          Length = 139

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 62/104 (59%), Gaps = 1/104 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++E    + + I+  S  +  G+R+ +K GGC+G +Y +  + D  ++GD ++   GV
Sbjct: 18  ITISEFGASKAQTILAGSGKENAGVRVFIKSGGCSGYQYGM-AIDDRELEGDTIVVDRGV 76

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+ +D  S+  + G+E+DF    +  GF  HNPN  S+CGCG S
Sbjct: 77  KLLVDRMSIELLRGSEVDFVENMMGGGFTVHNPNATSSCGCGHS 120


>gi|261339556|ref|ZP_05967414.1| FeS assembly scaffold SufA [Enterobacter cancerogenus ATCC 35316]
 gi|288318373|gb|EFC57311.1| FeS assembly scaffold SufA [Enterobacter cancerogenus ATCC 35316]
          Length = 122

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 64/104 (61%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I E+V   + +  G+R+ +K+ GCAG  Y++D VT+ P   D + E DG 
Sbjct: 18  LTLTPAAAAHIHELV-AKKPEILGVRLGVKQTGCAGFGYVLDTVTE-PAKDDLVFETDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+++   ++ ++ GTE+D+  E L   F FHNP   + CGCG+S
Sbjct: 76  KLYVALQAMPFIDGTEVDYVREGLNQLFKFHNPKAQNECGCGES 119


>gi|222150815|ref|YP_002559968.1| hypothetical protein MCCL_0565 [Macrococcus caseolyticus JCSC5402]
 gi|222119937|dbj|BAH17272.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402]
          Length = 119

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 62/109 (56%), Gaps = 3/109 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQG-IRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           V +T+AA Y +K ++    G  +G +RIS+K GGC GL Y +    + P D D+++    
Sbjct: 4   VILTKAAAYEVKSMM-EQNGMPEGFLRISVKGGGCTGLSYGMS-AEEAPADNDEVLNFYD 61

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           VKV +D A    + GT +DFK   +  GF   NPN +++CGCG S   K
Sbjct: 62  VKVLVDKADAPILKGTTVDFKQSLMGGGFAIENPNAIASCGCGSSFRTK 110


>gi|226494025|ref|NP_001147131.1| HESB-like domain-containing protein 2 [Zea mays]
 gi|195607514|gb|ACG25587.1| HESB-like domain-containing protein 2 [Zea mays]
          Length = 130

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 67/104 (64%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA  RI++++  S  +   +R+ +K  GC GL Y ++   D     D+L+E+ GV
Sbjct: 19  LTLTDAAASRIRQLL--SLRQRPFLRLGVKARGCNGLSYTLNYA-DEKGKFDELVEEKGV 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV ID  +L++++GT++D+  + L S FVF NPN    CGCG+S
Sbjct: 76  KVLIDPKALMHVIGTKMDYVDDPLKSEFVFVNPNSKGECGCGES 119


>gi|257093607|ref|YP_003167248.1| iron-sulfur cluster assembly protein IscA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257046131|gb|ACV35319.1| iron-sulfur cluster assembly protein IscA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 107

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E A   +   +   +GK  G+R+ ++  GC+G+ Y ++    +  D D   E  GV
Sbjct: 3   VTLSERAASHVANYMV-KRGKGIGLRLGVRTSGCSGMAYKLEFADVSHPD-DIEFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V +D+ SL Y+ GTE+D+  E L  GF F+NPN   ACGCG+S  +
Sbjct: 61  RVLVDAKSLPYLDGTELDYAREGLNEGFRFNNPNVKDACGCGESFNV 107


>gi|89068212|ref|ZP_01155622.1| Iron-sulfur cluster assembly family protein [Oceanicola granulosus
           HTCC2516]
 gi|89046129|gb|EAR52187.1| Iron-sulfur cluster assembly family protein [Oceanicola granulosus
           HTCC2516]
          Length = 108

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 63/102 (61%), Gaps = 4/102 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A  R+ EI   S+GKA  +R++++ GGC+G +Y +DL  D P + D ++E  G +V
Sbjct: 8   VTPRAFERLAEIGAASEGKA--LRVAVEGGGCSGFQYQIDL--DEPAEDDLVLEGAGERV 63

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            ID+ SL ++    IDF  E + + FV  NPN  S+CGCG S
Sbjct: 64  VIDAVSLPFLSDAVIDFADEIIGARFVIENPNASSSCGCGTS 105


>gi|226532810|ref|NP_001149194.1| HESB-like domain-containing protein 2 [Zea mays]
 gi|195625362|gb|ACG34511.1| HESB-like domain-containing protein 2 [Zea mays]
 gi|195625638|gb|ACG34649.1| HESB-like domain-containing protein 2 [Zea mays]
 gi|223947595|gb|ACN27881.1| unknown [Zea mays]
          Length = 130

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 67/104 (64%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA  RI++++  S  +   +R+ +K  GC GL Y ++   D     D+L+E+ GV
Sbjct: 19  LTLTDAAASRIRQLL--SLRQRPFLRLGVKARGCNGLSYTLNYA-DEKGKFDELVEEKGV 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV ID  +L++++GT++D+  + L S FVF NPN    CGCG+S
Sbjct: 76  KVLIDPKALMHVIGTKMDYVDDPLKSEFVFVNPNSKGECGCGES 119


>gi|288957498|ref|YP_003447839.1| NifU-like iron-sulfur cluster assembly protein [Azospirillum sp.
           B510]
 gi|288909806|dbj|BAI71295.1| NifU-like iron-sulfur cluster assembly protein [Azospirillum sp.
           B510]
          Length = 135

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 64/105 (60%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +VT+T+AAV  ++ ++  S G A G+RI++  GGCAGL+Y + L      D D ++    
Sbjct: 1   MVTLTDAAVSTLERVLAKSGGAAAGLRIAVTDGGCAGLKYQMGLEA-AATDDDAVLSFGP 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           V +++D+ S  ++ G  +DF      SGF F NPN  S+CGCG+S
Sbjct: 60  VTIFVDANSQPFLSGVVVDFVEGIEGSGFKFDNPNATSSCGCGKS 104


>gi|213421911|ref|ZP_03354977.1| iron-sulfur cluster assembly protein [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
          Length = 94

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 1/90 (1%)

Query: 22  SQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEI 81
           ++GK  G+R+ ++  GC+G+ Y+++ V D P   D + E  GVKV +D  SL ++ GT++
Sbjct: 6   NRGKGFGLRLGVRTSGCSGMAYVLEFV-DEPTAEDTVFEDKGVKVVVDGKSLQFLDGTQL 64

Query: 82  DFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DF  E L  GF F NPN    CGCG+S  +
Sbjct: 65  DFVKEGLNEGFKFSNPNVKDECGCGESFHV 94


>gi|325106547|ref|YP_004276201.1| iron-sulfur cluster assembly accessory protein [Pedobacter saltans
           DSM 12145]
 gi|324975395|gb|ADY54379.1| iron-sulfur cluster assembly accessory protein [Pedobacter saltans
           DSM 12145]
          Length = 117

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 65/108 (60%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +++T+ A   +K+++   + G   G+RI ++ GGC+G+ Y++    D   DGD   + DG
Sbjct: 12  ISLTDGAKKEVKKLMSQQELGPDFGLRIGVEGGGCSGMNYVLGF--DQQKDGDTEYDIDG 69

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +++++  A  LY+ G E+DF+      GFVF+NPN  S CGCG S  +
Sbjct: 70  IRIFMHKAHGLYLAGMEVDFQQGLNARGFVFNNPNAASTCGCGTSFSV 117


>gi|284053021|ref|ZP_06383231.1| hypothetical protein AplaP_16248 [Arthrospira platensis str.
           Paraca]
 gi|291566297|dbj|BAI88569.1| iron-sulfur cluster assembly accessory protein [Arthrospira
           platensis NIES-39]
          Length = 120

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 66/107 (61%), Gaps = 6/107 (5%)

Query: 5   VTMTEAAVYRIKEIVF--NSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV-DGDDLIEK 61
           + MT+AAV   ++++F    QG+   +R+ +++GGC+G+ YM+D V  + + D D++ + 
Sbjct: 14  IQMTDAAV---QQVLFLREKQGRDLCLRVGVRQGGCSGMSYMMDFVEPDSIQDTDEVFDH 70

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +G +V  D  SLLY+ G  +D+    +  GF F NPN    CGCG+S
Sbjct: 71  NGFQVVCDPKSLLYIYGMVLDYSNALIGGGFQFTNPNASQTCGCGKS 117


>gi|164423381|ref|XP_963568.2| hypothetical protein NCU08707 [Neurospora crassa OR74A]
 gi|9453818|emb|CAB99386.1| conserved hypothetical protein [Neurospora crassa]
 gi|157070068|gb|EAA34332.2| hypothetical protein NCU08707 [Neurospora crassa OR74A]
          Length = 261

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 66/104 (63%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T AAV  ++ ++   Q + + I++ ++  GC+GL Y ++ V D     D+ +E+DGV
Sbjct: 158 INLTSAAVEHLRAML--DQPEPKLIKVGVRNRGCSGLAYHLEYV-DKAGAFDETVEQDGV 214

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV IDS +L  ++G+E+D+  +KL   FVF NPN    CGCG+S
Sbjct: 215 KVLIDSKALFSIIGSEMDWVEDKLSQRFVFRNPNIKEQCGCGES 258


>gi|300773830|ref|ZP_07083699.1| iron-sulfur cluster assembly protein IscA [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|300760001|gb|EFK56828.1| iron-sulfur cluster assembly protein IscA [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 111

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 63/112 (56%), Gaps = 2/112 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M  ++T+T+ A  RI+ I+   Q   +  +R++++ GGC+GL Y +D   +    GD   
Sbjct: 1   MDSMITITDKAKERIQSIMKTEQYDDSYFVRVAVESGGCSGLSYKLDFDNEEK-KGDQFS 59

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           E  G+K+ +D  S LY+ GTE+D+       GF FHNPN    C CG+S  +
Sbjct: 60  EDKGIKICLDIKSYLYLAGTELDYSDGLNGKGFEFHNPNASRTCACGESFSV 111


>gi|219115866|ref|XP_002178728.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217409495|gb|EEC49426.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 105

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (1%)

Query: 7   MTEAAVYRIKEIVFNSQGK-AQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVK 65
           +T+AA  RI+E++     K A GIR+  K+ GC GL Y ++   + P + D  +E  GV+
Sbjct: 1   LTQAAADRIQELLRGENAKGAIGIRLGTKRRGCNGLSYTLNYALEKP-EKDVAMESHGVQ 59

Query: 66  VWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V+I+  +L  ++GT +D++  +L S F F+NPN    CGCG+S  +
Sbjct: 60  VFIEPMALFNIVGTVMDWEESELSSEFTFNNPNSKGECGCGESFNV 105


>gi|156934264|ref|YP_001438180.1| iron-sulfur cluster assembly scaffold protein [Cronobacter
           sakazakii ATCC BAA-894]
 gi|156532518|gb|ABU77344.1| hypothetical protein ESA_02094 [Cronobacter sakazakii ATCC BAA-894]
          Length = 125

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 67/108 (62%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT  A   I++++    G   G+R+S+K+ GCAG  Y++D V++ P D D + E DG 
Sbjct: 18  LTMTPDAARHIRDLMAQKPGLL-GVRLSVKQSGCAGFGYVLDTVSE-PKDEDLVFETDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           ++++   ++ ++ GTE+D+  E L   F F+NP    ACGCG+S  ++
Sbjct: 76  RLYVPLQAMPFIDGTEVDYVREGLNQIFKFNNPKAQHACGCGESFGVQ 123


>gi|302039298|ref|YP_003799620.1| iron-sulfur cluster assembly protein IscA [Candidatus Nitrospira
           defluvii]
 gi|300607362|emb|CBK43695.1| Iron-sulfur cluster assembly protein IscA [Candidatus Nitrospira
           defluvii]
          Length = 119

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 5/107 (4%)

Query: 4   IVTMTEAAVYRIKEIVFNSQG-KAQGIRISLKKGGCAGLEYMVDLVTDNPVDG-DDLIEK 61
           ++T+++AA+  +K ++ N QG +  G+R+ +K GGC+GL Y ++   D  +   D + E 
Sbjct: 13  VITLSDAALKEVKRLI-NVQGIEEGGLRLGVKGGGCSGLSYTINF--DEKIGQYDQVYEF 69

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           DGVKV +D+ S +Y+ GT++DF+ + +   F F NPN    CGCG+S
Sbjct: 70  DGVKVIVDAKSAIYLQGTQLDFQKDLMGGNFKFVNPNANKTCGCGES 116


>gi|251789305|ref|YP_003004026.1| FeS assembly scaffold SufA [Dickeya zeae Ech1591]
 gi|247537926|gb|ACT06547.1| FeS assembly scaffold SufA [Dickeya zeae Ech1591]
          Length = 124

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 67/104 (64%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T++AV  I+ ++   +   QGIR+++K+ GCAGL Y+++LV   P   D + + +G 
Sbjct: 20  LTLTDSAVAHIRSLMRRDE-SVQGIRLTVKQSGCAGLGYVLELV-HQPDPTDQIYQHEGA 77

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +++I   ++ ++ GTE+DF  E +   F F+NP    ACGCG+S
Sbjct: 78  RLFIPLKAMPFLDGTEVDFVQEGINQVFKFNNPKARHACGCGES 121


>gi|260597663|ref|YP_003210234.1| iron-sulfur cluster assembly scaffold protein [Cronobacter
           turicensis z3032]
 gi|260216840|emb|CBA30349.1| Protein sufA [Cronobacter turicensis z3032]
          Length = 137

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 67/108 (62%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT  A   I++++    G   G+R+S+K+ GCAG  Y++D V++ P D D + E DG 
Sbjct: 30  LTMTPDAAKHIRDLMAQKPGLL-GVRLSVKQSGCAGFGYVLDTVSE-PKDEDLVFEADGA 87

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           ++++   ++ ++ GTE+D+  E L   F F+NP    ACGCG+S  ++
Sbjct: 88  RLYVPLQAMPFIDGTEVDYVREGLNQIFKFNNPKAQHACGCGESFGVQ 135


>gi|90406926|ref|ZP_01215117.1| Putative hesB family protein [Psychromonas sp. CNPT3]
 gi|90311968|gb|EAS40062.1| Putative hesB family protein [Psychromonas sp. CNPT3]
          Length = 107

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +   + N +GK  G+R+ +K  GC+G+ Y+++ V     D +  I+K GV
Sbjct: 3   ITITEPAAKHVANFLVN-RGKGIGLRLGVKTSGCSGMAYVLEFVDVLNEDDEVFIDK-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL+Y+ GTE+DF    L  GF F+NPN    CGCG+S  +
Sbjct: 61  SIIVDKKSLVYLNGTELDFVKNGLNEGFEFNNPNIDGECGCGESFSV 107


>gi|138896543|ref|YP_001126996.1| HesB protein [Geobacillus thermodenitrificans NG80-2]
 gi|196250902|ref|ZP_03149587.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           G11MC16]
 gi|134268056|gb|ABO68251.1| HesB protein [Geobacillus thermodenitrificans NG80-2]
 gi|196209631|gb|EDY04405.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           G11MC16]
          Length = 121

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 63/105 (60%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I+T+TEAA ++IK+++   + +   +R+ +  GGC+GL Y +    +   D D  +E+ G
Sbjct: 5   IITLTEAAAFQIKDMMKEQEEENAYLRVGVHGGGCSGLSYGMGFAHERN-DDDIELEQHG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +K+ ID  S   + GT ID+K   L  GF  +NPN ++ CGCG S
Sbjct: 64  IKILIDRDSAPILRGTVIDYKQSLLGGGFTINNPNAIATCGCGSS 108


>gi|56551325|ref|YP_162164.1| iron-sulfur cluster assembly accessory protein [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|241760978|ref|ZP_04759067.1| iron-sulfur cluster assembly accessory protein [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|260753056|ref|YP_003225949.1| iron-sulfur cluster assembly accessory protein [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|56542899|gb|AAV89053.1| iron-sulfur cluster assembly accessory protein [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|241374597|gb|EER64058.1| iron-sulfur cluster assembly accessory protein [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|258552419|gb|ACV75365.1| iron-sulfur cluster assembly accessory protein [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 113

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 66/110 (60%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           + ++T+T  A  RIK+++  +     G+++S  K GC+GL Y ++  TD     D+ I  
Sbjct: 5   ASVITLTPNAKMRIKKLLSEAPEGTVGVKLSTPKKGCSGLAYSLEY-TDKADPLDERIVI 63

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           D   ++ID+ASLLY++G+E+D+  +   + F F NPN    CGCG+S  +
Sbjct: 64  DDAVLFIDNASLLYLIGSEMDWVEDDFQAAFQFKNPNATGMCGCGESFTV 113


>gi|332821405|ref|XP_003310762.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Pan troglodytes]
          Length = 249

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV  IK+++   + +  G+++ ++  GC GL Y ++  T    D D    +DGV
Sbjct: 111 LTLTPSAVNTIKQLL-KDKPEHVGVKVGVRTRGCNGLSYTLEY-TKTKGDSDKEFIQDGV 168

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I+
Sbjct: 169 RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNIR 216


>gi|75676001|ref|YP_318422.1| HesB/YadR/YfhF [Nitrobacter winogradskyi Nb-255]
 gi|74420871|gb|ABA05070.1| HesB/YadR/YfhF [Nitrobacter winogradskyi Nb-255]
          Length = 110

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++E A  RI+EI+  S+G    +RIS++ GGC+G +Y  D +     D D +I +D  
Sbjct: 6   ITVSERAARRIREIL-KSEGDGAMLRISVEGGGCSGFQYKFD-IERAKADDDLVIARDSA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D AS+ ++ G+E+DF  + + + F   NPN  ++CGCG S  I
Sbjct: 64  VVLVDPASVPFLSGSEVDFVDDLIGASFRVVNPNATASCGCGTSFSI 110


>gi|304311757|ref|YP_003811355.1| Iron-sulphur cluster assembly protein [gamma proteobacterium HdN1]
 gi|301797490|emb|CBL45710.1| Iron-sulphur cluster assembly protein [gamma proteobacterium HdN1]
          Length = 117

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 63/109 (57%), Gaps = 4/109 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE-KDG 63
           ++ T  A+  +++I+      AQG+R+S+K  GC+G  Y++D   D P + D  +E   G
Sbjct: 12  LSFTPNAIAHLRKIL--QSNTAQGVRVSVKMSGCSGYRYVLD-CADQPKENDLSLEVASG 68

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           + V+ID  SL  + GTE+D+  E L S   F NPN    CGCG+S  +K
Sbjct: 69  LIVFIDPESLPMLAGTEVDYVREGLNSSLQFRNPNATGECGCGESFTVK 117


>gi|325983000|ref|YP_004295402.1| iron-sulfur cluster assembly accessory protein [Nitrosomonas sp.
           AL212]
 gi|325532519|gb|ADZ27240.1| iron-sulfur cluster assembly accessory protein [Nitrosomonas sp.
           AL212]
          Length = 111

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 64/112 (57%), Gaps = 4/112 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKD 62
           ++T+TE A   I++ +   +GK   +R+ +KK GC+G  Y  D   + NP   D+L E  
Sbjct: 2   LITLTENAAKYIQQQL-AKRGKGLALRVGIKKSGCSGFSYTFDYADEINP--DDELFESY 58

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
             K+ +D  SL Y+ G++IDF  E L S F F NPN  + CGCG S  IK +
Sbjct: 59  KTKIVVDRYSLPYLDGSQIDFVKEGLNSSFQFVNPNIDNTCGCGDSFSIKES 110


>gi|21492743|ref|NP_659818.1| Fe-S cofactor nitrogenase synthesis protein [Rhizobium etli CFN 42]
 gi|190894229|ref|YP_001984523.1| Fe-S cofactor nitrogenase synthesis protein [Rhizobium etli CIAT
           652]
 gi|218671750|ref|ZP_03521419.1| Fe-S cofactor nitrogenase synthesis protein [Rhizobium etli GR56]
 gi|15027099|emb|CAC44785.1| nitrogen fixation protein, IscN [Rhizobium etli]
 gi|21467168|gb|AAM54831.1| Fe-S cofactor nitrogenase synthesis protein [Rhizobium etli CFN 42]
 gi|190699890|gb|ACE93973.1| Fe-S cofactor nitrogenase synthesis protein [Rhizobium etli CIAT
           652]
 gi|327189262|gb|EGE56439.1| Fe-S cofactor nitrogenase synthesis protein [Rhizobium etli
           CNPAF512]
          Length = 105

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 65/105 (61%), Gaps = 2/105 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I  +  +   +A+G RI+++ GGCAG +Y+V L +    +GD +IE +G
Sbjct: 1   MIKLTENAA-AIMNVTLSRAEQAEGFRIAVEAGGCAGYKYLVGLESVQG-EGDAVIETNG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV++D+ S  ++ G  IDF T    SGFVF NPN    C CG+S
Sbjct: 59  VKVFVDADSQAHINGMTIDFVTGPETSGFVFDNPNAHQNCTCGKS 103


>gi|227539685|ref|ZP_03969734.1| iron sulfur assembly protein [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227240327|gb|EEI90342.1| iron sulfur assembly protein [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 111

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 63/112 (56%), Gaps = 2/112 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M  ++T+T+ A  RI  I+ + Q   +  +R++++ GGC+GL Y +D   +    GD   
Sbjct: 1   MDSMITITDKAKERIHSIMKSEQYDDSYFVRVAVESGGCSGLSYKLDFDNEEK-KGDQFS 59

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           E  G+K+ +D  S LY+ GTE+D+       GF FHNPN    C CG+S  +
Sbjct: 60  EDKGIKICLDIKSYLYLAGTELDYSDGLNGKGFEFHNPNASRTCACGESFSV 111


>gi|254486140|ref|ZP_05099345.1| HesB/YadR/YfhF [Roseobacter sp. GAI101]
 gi|214043009|gb|EEB83647.1| HesB/YadR/YfhF [Roseobacter sp. GAI101]
          Length = 107

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 62/105 (59%), Gaps = 4/105 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A  R+ EI   + GKA  +R++++ GGC+G +Y  D+  D P D D ++E  G KV
Sbjct: 7   VTSRAFDRLAEIGAAADGKA--LRVAVEGGGCSGFQY--DIALDAPKDDDLILEGAGQKV 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +DS SL ++    IDF  E + + FV  NPN  SACGCG S  +
Sbjct: 63  VVDSISLPFLTNAIIDFSEELIGARFVIENPNATSACGCGTSFSM 107


>gi|237843641|ref|XP_002371118.1| iron-sulfur cluster assembly accessory protein, putative
           [Toxoplasma gondii ME49]
 gi|49234802|gb|AAT57939.1| hesB-like domain-containing protein [Toxoplasma gondii]
 gi|211968782|gb|EEB03978.1| iron-sulfur cluster assembly accessory protein, putative
           [Toxoplasma gondii ME49]
          Length = 504

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%), Gaps = 11/97 (11%)

Query: 23  QGKAQGIRISLKKGGCAGLEYMVDLVTD-----------NPVDGDDLIEKDGVKVWIDSA 71
           + +A GIRI L+K GC+GL Y VD+               P   D+LIE  G ++ + S 
Sbjct: 405 KARAIGIRIGLEKRGCSGLSYTVDVAIQSNASSSAASGKQPWAADELIETAGGRLVVASD 464

Query: 72  SLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++++GTE+DF   +L   FVF NPN+  +CGCG+S
Sbjct: 465 AVMFLVGTEVDFVDTELERKFVFKNPNEKQSCGCGKS 501


>gi|237731310|ref|ZP_04561791.1| iron-sulfur cluster assembly scaffold protein [Citrobacter sp.
           30_2]
 gi|226906849|gb|EEH92767.1| iron-sulfur cluster assembly scaffold protein [Citrobacter sp.
           30_2]
          Length = 122

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I+E+V   Q    G+R+ +K+ GCAG  Y++D V   P   D L E +G 
Sbjct: 18  LTLTPAAAAHIRELV-AKQPDMLGVRLGVKQTGCAGFGYVLDTVR-QPEKDDLLFETEGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++++   ++ ++ GTE+DF  E L   F FHNP   + CGCG+S  +
Sbjct: 76  RLYVPLQAMPFIDGTEVDFVREGLNQLFKFHNPKAQNECGCGESFGV 122


>gi|307131461|ref|YP_003883477.1| Fe-S cluster assembly protein [Dickeya dadantii 3937]
 gi|306528990|gb|ADM98920.1| Fe-S cluster assembly protein [Dickeya dadantii 3937]
          Length = 123

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 66/104 (63%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T++AV  I  ++   +   QGIR+++K+ GCAG  Y+++LV   P   D L +++G 
Sbjct: 19  LTLTDSAVAHISNLMRRDE-SVQGIRLAVKQSGCAGFGYVLELV-HQPDPSDRLYQREGA 76

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +++I   ++ ++ GTE+DF  E +   F F+NP    ACGCG+S
Sbjct: 77  RLFIPLKAMPFLDGTEVDFVQEGINQVFKFNNPKARHACGCGES 120


>gi|115488590|ref|NP_001066782.1| Os12g0485500 [Oryza sativa Japonica Group]
 gi|77555730|gb|ABA98526.1| HesB/YadR/YfhF family protein, putative, expressed [Oryza sativa
           Japonica Group]
 gi|113649289|dbj|BAF29801.1| Os12g0485500 [Oryza sativa Japonica Group]
 gi|125536644|gb|EAY83132.1| hypothetical protein OsI_38346 [Oryza sativa Indica Group]
 gi|125579354|gb|EAZ20500.1| hypothetical protein OsJ_36107 [Oryza sativa Japonica Group]
 gi|215678677|dbj|BAG92332.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215704533|dbj|BAG94166.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 133

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA  R+++++   Q     +R+ +K  GC GL Y ++   D     D+L+E  GV
Sbjct: 22  LTLTDAAASRVRQLLGVRQ--RAYLRLGVKARGCNGLSYTMNYA-DEKGKFDELVEDKGV 78

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+ ID  +L++++GT++DF  + L S FVF NPN    CGCG+S
Sbjct: 79  KILIDPKALMHVIGTKMDFIDDPLRSEFVFMNPNSKGECGCGES 122


>gi|325917963|ref|ZP_08180132.1| Iron-sulfur cluster assembly accessory protein [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325535820|gb|EGD07647.1| Iron-sulfur cluster assembly accessory protein [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 112

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (59%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T AA+ R++  V  + G A G+R  + K GC+G  ++ DL  +   D D + E+ GV
Sbjct: 3   ISLTPAALERVQRFVQQTPG-ALGLRFGVTKTGCSGWGHITDLAREK-RDDDAVFEQGGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++D ASL  + GT IDF    L   F F NPN  + CGCG+S
Sbjct: 61  RIFVDPASLPLVDGTCIDFGKHGLSETFTFSNPNATAECGCGES 104


>gi|226507382|ref|NP_001148392.1| HESB-like domain-containing protein 2 [Zea mays]
 gi|195618922|gb|ACG31291.1| HESB-like domain-containing protein 2 [Zea mays]
 gi|195649825|gb|ACG44380.1| HESB-like domain-containing protein 2 [Zea mays]
          Length = 130

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 66/104 (63%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA  RI++++  S  +   +R+ +K  GC GL Y ++   D     D+L+E+ GV
Sbjct: 19  LTLTNAAASRIRQLL--SLRQRPYLRLGVKARGCNGLSYTLNYA-DEKGKFDELVEEKGV 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV ID  +L++++GT++D+  + L S FVF NPN    CGCG+S
Sbjct: 76  KVLIDPKALMHVIGTKMDYVDDPLKSEFVFINPNSKGQCGCGES 119


>gi|193216384|ref|YP_001997583.1| iron-sulfur cluster assembly accessory protein [Chloroherpeton
           thalassium ATCC 35110]
 gi|193089861|gb|ACF15136.1| iron-sulfur cluster assembly accessory protein [Chloroherpeton
           thalassium ATCC 35110]
          Length = 108

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 63/110 (57%), Gaps = 4/110 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQ-GIRISLKKGGCAGLEYMVDLVTDNPV-DGDDLIEK 61
           ++T+T+ A  ++K +          G+R+S+K GGC+GL Y +D   DN   +GD + E 
Sbjct: 1   MITVTDKAAQQVKRLKTEQNLTDDFGLRVSVKGGGCSGLSYGLDF--DNETKNGDQVFED 58

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GVKV++D  S LY+ GT +DF       GF F NPN    CGCG+S  +
Sbjct: 59  KGVKVFVDMKSFLYLAGTTLDFSDGLNGKGFHFINPNANRTCGCGESFSV 108


>gi|255263868|ref|ZP_05343210.1| iron-sulfur cluster assembly family protein [Thalassiobium sp.
           R2A62]
 gi|255106203|gb|EET48877.1| iron-sulfur cluster assembly family protein [Thalassiobium sp.
           R2A62]
          Length = 108

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 64/107 (59%), Gaps = 6/107 (5%)

Query: 6   TMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDGV 64
           T+T  A  R+ EI    QGKA  +R++++ GGC+G +Y ++L   + V  DDL+ E  G 
Sbjct: 7   TVTNRAFERLAEIGAADQGKA--LRVAVEGGGCSGFQYEIEL---DVVGEDDLVLEGSGE 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS SL ++    IDF  E + + FV  NPN  S+CGCG S  I
Sbjct: 62  KVVIDSVSLPFLAQATIDFSEELIGARFVIENPNATSSCGCGTSFSI 108


>gi|312891369|ref|ZP_07750886.1| iron-sulfur cluster assembly accessory protein [Mucilaginibacter
           paludis DSM 18603]
 gi|311296063|gb|EFQ73215.1| iron-sulfur cluster assembly accessory protein [Mucilaginibacter
           paludis DSM 18603]
          Length = 108

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 63/109 (57%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNS-QGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +VT+T+ A  +I  ++ ++    +  +R+S++ GGC+GL Y +D   +    GD   E  
Sbjct: 1   MVTITDKAKSKIDHLMQDAGMDTSYFLRVSVQGGGCSGLSYNLDFDNEEK-KGDQFFEDK 59

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G+++ +D  S LY+ GTE+DF       GF FHNPN    CGCG+S  +
Sbjct: 60  GIRMALDMKSFLYLAGTELDFSDGLNGKGFNFHNPNATRTCGCGESFSV 108


>gi|330994041|ref|ZP_08317971.1| Iron-binding protein iscA [Gluconacetobacter sp. SXCC-1]
 gi|329758987|gb|EGG75501.1| Iron-binding protein iscA [Gluconacetobacter sp. SXCC-1]
          Length = 127

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 66/111 (59%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           +  ++TMT+ A  R+ E ++ +      +RI++   GC+G  Y +  V + P  GD+++ 
Sbjct: 19  LPPLLTMTDRAAQRL-EKLYQTNHAGHLLRIAISTKGCSGHAYDMSFV-EQPGPGDEVVV 76

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GV + +D  + L+++G+ +D++  +L SGF F NPN+   CGCG+S  +
Sbjct: 77  DKGVTLLVDRKATLFLIGSVMDYEVRQLESGFTFSNPNEKGRCGCGESFHV 127


>gi|331005916|ref|ZP_08329264.1| Iron binding protein IscA for iron-sulfur cluster assembly [gamma
           proteobacterium IMCC1989]
 gi|330420272|gb|EGG94590.1| Iron binding protein IscA for iron-sulfur cluster assembly [gamma
           proteobacterium IMCC1989]
          Length = 107

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTE A   I + +   +G A GIR+ +K  GC+GL Y+++ V D+  + D + ++   
Sbjct: 3   ISMTEVAKSHIGKQI-QGRGNALGIRVGVKTAGCSGLSYVLEFV-DSLEETDHVFDQGDF 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL+Y+ GT++DF  E L  GF F NPN  + CGCG+S  +
Sbjct: 61  SLVVDPKSLVYLDGTQMDFVKEGLNEGFEFKNPNMKNECGCGESFHV 107


>gi|218246626|ref|YP_002371997.1| iron-sulfur cluster assembly accessory protein [Cyanothece sp. PCC
           8801]
 gi|257059669|ref|YP_003137557.1| iron-sulfur cluster assembly accessory protein [Cyanothece sp. PCC
           8802]
 gi|2183309|gb|AAC35199.1| HesB [Cyanothece sp. PCC 8801]
 gi|218167104|gb|ACK65841.1| iron-sulfur cluster assembly accessory protein [Cyanothece sp. PCC
           8801]
 gi|256589835|gb|ACV00722.1| iron-sulfur cluster assembly accessory protein [Cyanothece sp. PCC
           8802]
          Length = 119

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 57/104 (54%), Gaps = 1/104 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T+ A +R++  +     K  GIR+ +K GGC G EY ++LV + P   D   E++ V
Sbjct: 3   VNLTDKAAFRLRTFIRGEGSKVTGIRVGVKDGGCNGYEYTLNLVKE-PNSEDLRFEQNNV 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            +++D  S   + G  IDF      SGF F NPN    CGCG+S
Sbjct: 62  PIYVDVHSASLLEGVVIDFVESLTQSGFTFTNPNASDTCGCGKS 105


>gi|311031747|ref|ZP_07709837.1| iron-sulfur cluster assembly accessory protein [Bacillus sp. m3-13]
          Length = 120

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 66/108 (61%), Gaps = 1/108 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MSD++T+TEAA ++IK+++     ++  +R+ +K GGC+GL Y +    +   + D  +E
Sbjct: 1   MSDVITITEAAAFQIKDMMKEHGDESVFLRVGVKGGGCSGLSYGMGF-EEEKGEKDIELE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           + G+K+ ID+ S   +   +IDFK   +  GF   NPN ++ CGCG S
Sbjct: 60  QHGIKILIDAESKPILQDVKIDFKQSMMGGGFTIDNPNAIANCGCGSS 107


>gi|116623293|ref|YP_825449.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Solibacter usitatus Ellin6076]
 gi|116226455|gb|ABJ85164.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 107

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 65/108 (60%), Gaps = 1/108 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +V +T+ AV +++EI+ + +    G+RI++  GGC+G  Y +    + P   D     +G
Sbjct: 1   MVQITDRAVGKVREIMASQEPAPAGLRIAVVGGGCSGFSYSMAF-ENQPNVLDKTYNYEG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +K+++D ASLLY+ G E+D+      SGF F+NP   S CGCG S ++
Sbjct: 60  LKIFVDQASLLYLDGAEVDYVETLEGSGFKFNNPQVKSTCGCGSSFQV 107


>gi|88607054|ref|YP_505258.1| iron-sulfur cluster assembly accessory protein [Anaplasma
           phagocytophilum HZ]
 gi|88598117|gb|ABD43587.1| iron-sulfur cluster assembly accessory protein [Anaplasma
           phagocytophilum HZ]
          Length = 121

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 70/109 (64%), Gaps = 5/109 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQ--GIRISLKKGGCAGLEYMVDLVTD-NP--VDGDDLI 59
           V +T+AA+ R+KE++     +A+   IRI +K+ GC GL+Y ++   D  P  V  + +I
Sbjct: 10  VVITDAALRRMKELLLAKGDEAENVAIRILIKQKGCYGLKYHIEYAYDVRPLEVKVEKVI 69

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++  V + I+  +++++ GT ID+ ++KL SGF F NPN+   CGCG+S
Sbjct: 70  DEFSVTILIEPKAMMFIRGTVIDYYSDKLSSGFTFKNPNEKGRCGCGES 118


>gi|88657844|ref|YP_507441.1| iron-sulfur cluster assembly accessory protein [Ehrlichia
           chaffeensis str. Arkansas]
 gi|88599301|gb|ABD44770.1| iron-sulfur cluster assembly accessory protein [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 147

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 67/107 (62%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIE--K 61
           + +TE+A+ +I+E++   +G   GIRI +K+ GC GL+Y ++   D   +D +  +E   
Sbjct: 38  IIITESAIKKIRELIKQKEGAVIGIRIMVKQKGCFGLKYNIEYAHDIKLLDVEIKVEYQN 97

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +   + ID  +++++ GTE+D    K+ SGF F+NPN+   CGCG+S
Sbjct: 98  ENFTILIDPKAMMFINGTEMDHVENKISSGFTFNNPNEKGRCGCGES 144


>gi|302835421|ref|XP_002949272.1| iron-sulfur cluster assembly protein [Volvox carteri f.
           nagariensis]
 gi|300265574|gb|EFJ49765.1| iron-sulfur cluster assembly protein [Volvox carteri f.
           nagariensis]
          Length = 155

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 67/112 (59%), Gaps = 7/112 (6%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQG---IRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           +  +T+T  A+ +++++   ++ K Q    +R+ +K+GGC+GL Y +D  T + V  DD 
Sbjct: 43  ASAITLTAEALEQLRKL--RAEHKNQESLLLRVGVKQGGCSGLSYHMDFETQDKVSEDDH 100

Query: 59  IEK--DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +    DG ++ +D  SLLY+ G  + + +  +  GF FHNPN   +CGCG+S
Sbjct: 101 VMSYDDGFRLVVDPKSLLYLFGMRLGYSSALIGGGFQFHNPNATDSCGCGKS 152


>gi|78047216|ref|YP_363391.1| putative iron-sulfur cluster assembly accessory protein
           [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|294626362|ref|ZP_06704964.1| iron-sulfur cluster assembly accessory protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|294665954|ref|ZP_06731218.1| iron-sulfur cluster assembly accessory protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|325928163|ref|ZP_08189372.1| Iron-sulfur cluster assembly accessory protein [Xanthomonas
           perforans 91-118]
 gi|78035646|emb|CAJ23337.1| putative iron-sulfur cluster assembly accessory protein
           [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|292599363|gb|EFF43498.1| iron-sulfur cluster assembly accessory protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|292604257|gb|EFF47644.1| iron-sulfur cluster assembly accessory protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|325541459|gb|EGD12992.1| Iron-sulfur cluster assembly accessory protein [Xanthomonas
           perforans 91-118]
          Length = 112

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 62/104 (59%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T AA+ R++  V  + G A G+R  + K GC+G  ++ DL  +   D D + E+ GV
Sbjct: 3   VSLTPAALERVQRFVQQTPG-ALGLRFGVTKTGCSGWGHVTDLAREA-RDDDAVFEQGGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++D ASL  + GT IDF    L   F F NPN  + CGCG+S
Sbjct: 61  RIFVDPASLPLVDGTCIDFGKHGLSETFTFSNPNATAECGCGES 104


>gi|307207446|gb|EFN85161.1| Iron-sulfur cluster assembly 1-like protein, mitochondrial
           [Harpegnathos saltator]
          Length = 130

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IKEI    + +   +++ +++ GC GL Y +D   +     +++++ D V
Sbjct: 26  LTLTPSAVNKIKEI-LKDKSEYIALKVGVRQRGCNGLSYTLDYAKEKSKLDEEVVQ-DDV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +++ID  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  +
Sbjct: 84  RIFIDRKAQLSLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFSV 130


>gi|15227287|ref|NP_179262.1| hesB-like domain-containing protein [Arabidopsis thaliana]
 gi|88909163|sp|Q8LBM4|ISAM1_ARATH RecName: Full=Iron-sulfur assembly protein IscA-like 1,
           mitochondrial; Flags: Precursor
 gi|4581114|gb|AAD24604.1| putative HesB-like protein [Arabidopsis thaliana]
 gi|28466893|gb|AAO44055.1| At2g16710 [Arabidopsis thaliana]
 gi|110735817|dbj|BAE99885.1| putative HesB-like protein [Arabidopsis thaliana]
 gi|330251434|gb|AEC06528.1| Iron-sulfur assembly protein IscA-like 1 [Arabidopsis thaliana]
          Length = 137

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 66/106 (62%), Gaps = 3/106 (2%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++T+T+ A  R+  ++   Q +   +R+ +K  GC GL Y ++   D     D+L+E+ 
Sbjct: 21  QVLTLTDEAASRVHHLL--QQRQKPFLRLGVKARGCNGLSYTLNYA-DEKGKFDELVEEK 77

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           GV++ ++  +L++++GT++DF  +KL S FVF NPN    CGCG+S
Sbjct: 78  GVRILVEPKALMHVIGTKMDFVDDKLRSEFVFINPNSQGQCGCGES 123


>gi|161503534|ref|YP_001570646.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160864881|gb|ABX21504.1| hypothetical protein SARI_01610 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 122

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 65/105 (61%), Gaps = 4/105 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDG 63
           +T+T AA   I+E+     G   G+R+S+K+ GCAG  Y++D V +   D DDL+ E +G
Sbjct: 18  LTLTPAAAAHIRELAAKQPG-ILGVRLSVKQTGCAGFGYVLDTVREP--DKDDLVFEAEG 74

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            K+++   ++ ++ GTE+D+  E L   F FHNP   + CGCG+S
Sbjct: 75  AKLFVPLKAMPFIDGTEVDYVQEGLNQLFKFHNPKAQNECGCGES 119


>gi|19075612|ref|NP_588112.1| iron-sulfur protein Isa1 [Schizosaccharomyces pombe 972h-]
 gi|2495216|sp|P78859|ISA1_SCHPO RecName: Full=Iron-sulfur assembly protein 1
 gi|1749626|dbj|BAA13870.1| unnamed protein product [Schizosaccharomyces pombe]
 gi|4539275|emb|CAB39899.1| iron-sulfur protein Isa1 [Schizosaccharomyces pombe]
          Length = 190

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +++ +T  AV  +K++  ++  K + +RI +K+ GCAG  Y ++ + + P   D+++++D
Sbjct: 81  NVIKLTPLAVEHLKKMQSSASMKGKMLRIGVKQKGCAGQAYSLEYI-EKPDKFDEIVKQD 139

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           G+ + +   +LL ++G+ +D++ + L S F+F NPN  S CGCG+S
Sbjct: 140 GISIIVARRALLQIIGSVMDYRDDDLQSRFIFSNPNVKSTCGCGES 185


>gi|300863581|ref|ZP_07108527.1| iron-sulfur cluster assembly accessory protein [Oscillatoria sp.
           PCC 6506]
 gi|300338448|emb|CBN53669.1| iron-sulfur cluster assembly accessory protein [Oscillatoria sp.
           PCC 6506]
          Length = 117

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 64/105 (60%), Gaps = 2/105 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV-DGDDLIEKDG 63
           + MTE+A+ ++  +  + QGK   +R+ +++GGC+G+ YM+D    + V + D++ + +G
Sbjct: 11  IQMTESAIRQVLSLR-DKQGKDLCLRVGVRQGGCSGMSYMMDFTDPSTVGEHDEVFDYNG 69

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            +V  D  SLLY+ G  +DF    +  GF F NPN    CGCG+S
Sbjct: 70  FQVVCDRKSLLYLYGLVLDFSDAMIGGGFQFTNPNASQTCGCGKS 114


>gi|242008035|ref|XP_002424818.1| hes-B, putative [Pediculus humanus corporis]
 gi|212508368|gb|EEB12080.1| hes-B, putative [Pediculus humanus corporis]
          Length = 130

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T  AV +IKEI+   + +  G+++ +++ GC GL Y +D   +     +++++ DGV
Sbjct: 26  LVLTPNAVKKIKEIL-KDKTEYIGLKVGVRQRGCNGLSYTLDYAIEKGKLDEEVVQ-DGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+ID  + L +LGTE+D+  +KL   FVF+NPN    CGCG+S  I
Sbjct: 84  RVFIDRKAQLTLLGTEMDYVKDKLSEEFVFNNPNIKGTCGCGESFSI 130


>gi|84516349|ref|ZP_01003709.1| Iron-sulfur cluster assembly family protein [Loktanella
           vestfoldensis SKA53]
 gi|84510045|gb|EAQ06502.1| Iron-sulfur cluster assembly family protein [Loktanella
           vestfoldensis SKA53]
          Length = 116

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 62/102 (60%), Gaps = 4/102 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A  R+ EI   +QGKA  +RI+++ GGC+G +Y +DL  D P D D ++   G  V
Sbjct: 16  VTPRAFERLAEIGAAAQGKA--LRIAVEGGGCSGFQYEIDL--DEPKDDDLILSDKGETV 71

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            ID+ SL ++    IDF  E + + FV +NPN  S+CGCG S
Sbjct: 72  VIDAISLPFLTDAVIDFSEELIGARFVINNPNASSSCGCGTS 113


>gi|297832260|ref|XP_002884012.1| hypothetical protein ARALYDRAFT_480553 [Arabidopsis lyrata subsp.
           lyrata]
 gi|21592728|gb|AAM64677.1| putative HesB-like protein [Arabidopsis thaliana]
 gi|297329852|gb|EFH60271.1| hypothetical protein ARALYDRAFT_480553 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 137

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 66/106 (62%), Gaps = 3/106 (2%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++T+T+ A  R+  ++   Q +   +R+ +K  GC GL Y ++   D     D+L+E+ 
Sbjct: 21  QVLTLTDEAASRVHHLL--QQRQKPFLRLGVKARGCNGLSYTLNYA-DEKGKFDELVEEK 77

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           GV++ ++  +L++++GT++DF  +KL S FVF NPN    CGCG+S
Sbjct: 78  GVRILVEPKALMHVIGTKMDFVDDKLRSEFVFINPNSQGQCGCGES 123


>gi|321454597|gb|EFX65762.1| hypothetical protein DAPPUDRAFT_303520 [Daphnia pulex]
          Length = 130

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T +AV ++K++ F  Q    G++I +K+ GC G  Y +D  +      D+ + +DGV
Sbjct: 26  LVLTPSAVNQVKKL-FEGQNDYIGLKIGVKQRGCNGFSYTLDFASKKE-KFDEEVLQDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  + L++LGTE+D+   +L S FVF+NPN    CGCG+S  +
Sbjct: 84  RILVDMKAQLHLLGTEMDYVENELSSEFVFNNPNIKGTCGCGESFSV 130


>gi|301610979|ref|XP_002935018.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Xenopus (Silurana) tropicalis]
          Length = 129

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV ++K+++ +      G++++++  GC GL Y ++         +++++ DGV
Sbjct: 25  LTLTPAAVNKVKKLLQDKPDNI-GLKVAVRTRGCNGLSYYLEYAKSKGPSDEEVVQ-DGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|297583479|ref|YP_003699259.1| iron-sulfur cluster assembly accessory protein [Bacillus
           selenitireducens MLS10]
 gi|297141936|gb|ADH98693.1| iron-sulfur cluster assembly accessory protein [Bacillus
           selenitireducens MLS10]
          Length = 116

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 66/105 (62%), Gaps = 2/105 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TEAA  ++K+++   +  A+ +R+ ++ GGC+GL Y +   T+   D D L+E DG
Sbjct: 1   MLEITEAAATQVKQMM-EDEADAKFLRVGVQGGGCSGLSYGMGFDTEKAED-DTLLEVDG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++V +D  S   + GT+ID+K   +  GF   NPN V++CGCG S
Sbjct: 59  IEVLVDKESEPMLKGTKIDYKENMMGGGFTIDNPNAVASCGCGSS 103


>gi|153006429|ref|YP_001380754.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           sp. Fw109-5]
 gi|152030002|gb|ABS27770.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           sp. Fw109-5]
          Length = 127

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 60/104 (57%), Gaps = 1/104 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T  AV  +K+ +        GIR+ +  GGCAG +Y +D   D P +GD   E++GV
Sbjct: 22  VRLTAKAVEMVKDAMEREGLSEYGIRVGVMGGGCAGFQYSMDFEKD-PREGDVSFEQEGV 80

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K++ID  S +Y+ G  ID+      +GF F+NPN  + CGCG S
Sbjct: 81  KLFIDPMSSMYLQGVTIDYVVGLQGAGFKFNNPNARTTCGCGSS 124


>gi|88813724|ref|ZP_01128949.1| HesB/YadR/YfhF [Nitrococcus mobilis Nb-231]
 gi|88789017|gb|EAR20159.1| HesB/YadR/YfhF [Nitrococcus mobilis Nb-231]
          Length = 117

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 62/107 (57%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T++AV +++E++   +     +R+ +  GGC+G EY   +  +N  +GD +IEKDGV
Sbjct: 12  LVFTDSAVEKVRELLHKEEKGDLKLRVYITGGGCSGFEYGF-MFDENDEEGDTVIEKDGV 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S+ Y+ G EIDF      + FV  NPN  + CGCG S  +
Sbjct: 71  TMVVDPMSIQYLSGAEIDFVESLEGAQFVIRNPNATTTCGCGSSFSV 117


>gi|329114101|ref|ZP_08242865.1| Iron--sulfur cluster insertion protein ErpA [Acetobacter pomorum
           DM001]
 gi|326696640|gb|EGE48317.1| Iron--sulfur cluster insertion protein ErpA [Acetobacter pomorum
           DM001]
          Length = 142

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 64/114 (56%), Gaps = 8/114 (7%)

Query: 6   TMTEAAVYRIKEIVFNSQGKAQ-------GIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           +++E+A  RI  ++   Q  A         +R+S++ GGC G +Y+  L+    ++ DD 
Sbjct: 28  SVSESAANRIASVIAKKQATATPETPAPVAMRVSVEAGGCNGFQYLFTLIPAADIEADDT 87

Query: 59  -IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IEK+G  V +D AS+  + G E+DF  + + + F  +NPN  S+CGCG S  +
Sbjct: 88  RIEKNGALVVVDPASMDLLSGAELDFADKLMGAHFAVNNPNAASSCGCGTSFSV 141


>gi|218463041|ref|ZP_03503132.1| Fe-S cofactor nitrogenase synthesis protein [Rhizobium etli Kim 5]
 gi|218511100|ref|ZP_03508978.1| Fe-S cofactor nitrogenase synthesis protein [Rhizobium etli Brasil
           5]
 gi|218678054|ref|ZP_03525951.1| Fe-S cofactor nitrogenase synthesis protein [Rhizobium etli CIAT
           894]
          Length = 105

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 64/105 (60%), Gaps = 2/105 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I  +  +   +A+G RI+++ GGCAG +Y+V L +     GD +IE +G
Sbjct: 1   MIKLTENAA-AIMNVTLSRAEQAEGFRIAVEAGGCAGYKYLVGLESVQG-QGDAVIETNG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV++D+ S  ++ G  IDF T    SGFVF NPN    C CG+S
Sbjct: 59  VKVFVDADSQAHINGMTIDFVTGPETSGFVFDNPNAHQNCTCGKS 103


>gi|163735843|ref|ZP_02143272.1| FeS cluster assembly HesB family protein, putative [Roseobacter
           litoralis Och 149]
 gi|161390929|gb|EDQ15269.1| FeS cluster assembly HesB family protein, putative [Roseobacter
           litoralis Och 149]
          Length = 107

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 64/105 (60%), Gaps = 4/105 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A  R+ EI  +  GKA  +R++++ GGC+G +Y +DL  D P D D ++E  G KV
Sbjct: 7   VTPRAFERLAEIGASDDGKA--LRVAVEGGGCSGFQYEIDL--DEPKDDDLVLEGVGQKV 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            ID+ SL ++    IDF  E + + FV +NPN  S+CGCG S  +
Sbjct: 63  VIDAVSLPFLADAVIDFTEELIGARFVINNPNASSSCGCGTSFSM 107


>gi|258543181|ref|YP_003188614.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256634259|dbj|BAI00235.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256637319|dbj|BAI03288.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-03]
 gi|256640371|dbj|BAI06333.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-07]
 gi|256643428|dbj|BAI09383.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-22]
 gi|256646483|dbj|BAI12431.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-26]
 gi|256649536|dbj|BAI15477.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-32]
 gi|256652522|dbj|BAI18456.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655580|dbj|BAI21507.1| iron-sulfur (Fe-S) cluster assembly protein HesB/YadR/YfhF
           [Acetobacter pasteurianus IFO 3283-12]
          Length = 122

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 64/114 (56%), Gaps = 8/114 (7%)

Query: 6   TMTEAAVYRIKEIVFNSQGKAQ-------GIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           +++E+A  RI  ++   Q  A         +R+S++ GGC G +Y+  L+ +  +  DD 
Sbjct: 8   SVSESAANRIASVIAKKQATAAPEKPAPVAMRVSVEAGGCNGFQYLFTLIPEADIAADDT 67

Query: 59  -IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IE++G  V +D AS+  + G E+DF  + + + F  +NPN  S+CGCG S  +
Sbjct: 68  RIERNGALVVVDPASMDLLAGAELDFADKLMGAHFAVNNPNAASSCGCGTSFSV 121


>gi|167626448|ref|YP_001676948.1| iron-sulfur cluster insertion protein ErpA [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
 gi|241668880|ref|ZP_04756458.1| iron-sulfur cluster insertion protein ErpA [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254877412|ref|ZP_05250122.1| iron-binding protein erpA [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|189037863|sp|B0TZ08|ERPA_FRAP2 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|167596449|gb|ABZ86447.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|254843433|gb|EET21847.1| iron-binding protein erpA [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 116

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 64/110 (58%), Gaps = 3/110 (2%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEK 61
           D +  TE+A  ++KE++      +  +R+ +  GGC+G +Y      DN +  DD+ I K
Sbjct: 9   DPINFTESASLKVKELIEEEGDNSLSLRVYITGGGCSGFQYA--FAFDNEIKEDDMVITK 66

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +GV++ +DS S  Y++G ++D+K +   + FV  NPN  + CGCG S  +
Sbjct: 67  NGVRLLVDSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV 116


>gi|323137647|ref|ZP_08072723.1| iron-sulfur cluster assembly accessory protein [Methylocystis sp.
           ATCC 49242]
 gi|322396944|gb|EFX99469.1| iron-sulfur cluster assembly accessory protein [Methylocystis sp.
           ATCC 49242]
          Length = 113

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 64/109 (58%), Gaps = 6/109 (5%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQG--IRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           V +T+ A  RI  ++    G+A G   R+S++ GGC+G +Y    ++  P + D +IE+D
Sbjct: 9   VVLTDQAAKRIGALL---AGEAPGAVFRVSVEGGGCSGFQYQF-AISPAPTEEDAVIERD 64

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +V ID AS+ ++ G +IDF  + +   F   NPN  ++CGCG S  I
Sbjct: 65  GARVAIDPASMGFLAGAKIDFVDDLMGQSFRVENPNATASCGCGTSFSI 113


>gi|145526781|ref|XP_001449196.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124416773|emb|CAK81799.1| unnamed protein product [Paramecium tetraurelia]
          Length = 126

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 69/111 (62%), Gaps = 3/111 (2%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKA-QGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           +++T+++ A  RI E++      A   ++I ++K GC GL Y ++  +  P   D+++E 
Sbjct: 17  NLITISDKAAERITELMKQQNNPAFDAVKIGVRKRGCNGLSYTMNYCS-GPDKLDEVVEA 75

Query: 62  DG-VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            G VKV +DS +++ ++GTE+D+  + + S FVF NPNQ   CGCG+S  I
Sbjct: 76  KGCVKVIVDSKAVMVLVGTEMDYVEDDIKSEFVFKNPNQKGQCGCGESFHI 126


>gi|320332680|ref|YP_004169391.1| iron-sulfur cluster assembly accessory protein [Deinococcus
           maricopensis DSM 21211]
 gi|319753969|gb|ADV65726.1| iron-sulfur cluster assembly accessory protein [Deinococcus
           maricopensis DSM 21211]
          Length = 131

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 62/105 (59%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ ++E    +   I+ +S  +  G+R+ +K GGC+G +Y +  + D  ++GD +I   G
Sbjct: 8   VIGISEFGAQKALGILASSGKENAGVRVFVKSGGCSGYQYGM-AIDDRELEGDTVILDRG 66

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VK+ +D  SL  + G+E+DF    +  GF  HNPN  SACGCG S
Sbjct: 67  VKLIVDRMSLPLLQGSEVDFIENMMGGGFTVHNPNATSACGCGHS 111


>gi|307190801|gb|EFN74670.1| Iron-sulfur cluster assembly 1-like protein, mitochondrial
           [Camponotus floridanus]
          Length = 130

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T  AV +IKEI    + +  G+++ +++ GC GL Y ++   +     +++I+ DGV
Sbjct: 26  LVLTPNAVNKIKEI-LKDKTEYIGLKVGVRQRGCNGLSYTMNYAKEKSKLDEEVIQ-DGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +++ID  + L +LGTE+D+   KL S FVF+NPN    CGCG+S  +
Sbjct: 84  RIFIDRKAQLSLLGTEMDYVENKLSSEFVFNNPNIKGTCGCGESFSV 130


>gi|168007157|ref|XP_001756275.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162692785|gb|EDQ79141.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 114

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 65/105 (61%), Gaps = 2/105 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKDG 63
           +T+TE A+  +K++   SQ K   +R+ +++GGC+G+ Y++D    + V  DD +I+ + 
Sbjct: 8   ITLTEKALSHLKKLR-ASQDKELCLRVGVRQGGCSGMSYVMDFEETSNVRSDDSIIDYES 66

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            K+  D  SLL++ G ++D+    +  GF F NPN  S CGCG+S
Sbjct: 67  FKMVCDPKSLLFLYGMQLDYSDALIGGGFAFSNPNASSTCGCGKS 111


>gi|159479100|ref|XP_001697636.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii]
 gi|16798390|gb|AAL29443.1|AF428268_1 iron-sulfur cluster assembly protein IscA [Chlamydomonas
           reinhardtii]
 gi|158274246|gb|EDP00030.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii]
          Length = 129

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 68/104 (65%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +TEAA  RIKE++ N + K + +++ +K  GC+G+ Y ++   DN    D+++E  GV
Sbjct: 26  VELTEAAAGRIKELL-NKRHK-EYLKLGVKTRGCSGMSYTLNYA-DNKGKFDEVVEDKGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++ I+  +L+++LGT++D+  + L   FVF NPN    CGCG+S
Sbjct: 83  RIIIEPQALMHVLGTKMDYVKDDLRQEFVFVNPNAKGTCGCGES 126


>gi|307106304|gb|EFN54550.1| hypothetical protein CHLNCDRAFT_135340 [Chlorella variabilis]
          Length = 140

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 67/116 (57%), Gaps = 6/116 (5%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDL----VTDNPVDGDD 57
           SD + ++++AV R+KE+   S G    +R++++ GGC+G +Y   +            D 
Sbjct: 26  SDGLALSDSAVERLKELQAESSGPV-ALRVTVEGGGCSGFQYEFAIEEGAAAQQLAPTDR 84

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFH-NPNQVSACGCGQSVEIK 112
           L E+DGV++  D  SL ++ G  +DF+++ + S FV H NPN  S+CGCG S   K
Sbjct: 85  LFERDGVRLVCDDISLEFLKGAVVDFESDLMRSAFVIHNNPNAASSCGCGSSFVAK 140


>gi|254449206|ref|ZP_05062655.1| iron-sulfur cluster assembly protein IscA [gamma proteobacterium
           HTCC5015]
 gi|198261183|gb|EDY85479.1| iron-sulfur cluster assembly protein IscA [gamma proteobacterium
           HTCC5015]
          Length = 103

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 60/105 (57%), Gaps = 2/105 (1%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           MT++A   I E     +G   GIR+ +K  GC+G  Y ++ V D+  D D + E  GVKV
Sbjct: 1   MTQSAAQHI-ERYLEMRGTGLGIRLGIKTTGCSGYAYTLEYV-DDLKDDDQVYEHLGVKV 58

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +   SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 59  VVSKDSLPYVDGTELDFTKEGLNEGFKFNNPNVKDECGCGESFSV 103


>gi|320594059|gb|EFX06462.1| iron-sulfur cluster assembly accessory protein [Grosmannia
           clavigera kw1407]
          Length = 184

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 65/102 (63%), Gaps = 3/102 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T AAV +I+ ++     K   +++ ++  GC+GL Y ++ V   P   D+L+E+DGV+V
Sbjct: 83  LTPAAVEQIRALLEGPDPKL--LKVGVRNRGCSGLAYNLEYV-GKPGAFDELVEQDGVRV 139

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            +DS +L  ++G+E+D+  +KL   FVF NPN    CGCG+S
Sbjct: 140 LVDSKALFSIIGSEMDWVEDKLNQRFVFRNPNIKEQCGCGES 181


>gi|297567115|ref|YP_003686087.1| iron-sulfur cluster assembly accessory protein [Meiothermus
           silvanus DSM 9946]
 gi|296851564|gb|ADH64579.1| iron-sulfur cluster assembly accessory protein [Meiothermus
           silvanus DSM 9946]
          Length = 139

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 65/113 (57%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A  + +EI+         IR+ +K GGC+G +Y +  V +  ++GD  +E  G
Sbjct: 18  VLTITENAAAKAQEILQKYNKPQAAIRVFIKSGGCSGYQYGM-AVDERELEGDTFVEMHG 76

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           V++ +D  SL  ++G+++D+    +  GF  +NPN  S+CGCG S     A +
Sbjct: 77  VRLVVDRMSLPLLIGSQVDWVESMMGGGFTVNNPNATSSCGCGHSFRTDGAKV 129


>gi|162146271|ref|YP_001600730.1| hesB protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209543725|ref|YP_002275954.1| iron-sulfur cluster assembly accessory protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|11034775|gb|AAG27072.1|AF105225_8 unknown [Gluconacetobacter diazotrophicus PAl 5]
 gi|161784846|emb|CAP54389.1| putative hesB protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531402|gb|ACI51339.1| iron-sulfur cluster assembly accessory protein [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 106

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 64/105 (60%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ MT +A   ++  +  +    +GIRI ++ GGC+G +YM+ LV   P   D +++ DG
Sbjct: 1   MIEMTPSACEAVRAAIAGAATPVEGIRIMVESGGCSGFKYMMGLVA-APEPSDVVVDIDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV++D+ S  ++ GT++DF      SGF F NPN  S C CG+S
Sbjct: 60  VKVFVDAESGPHLQGTKVDFVVTLEQSGFSFDNPNAASKCSCGKS 104


>gi|94984431|ref|YP_603795.1| HesB/YadR/YfhF [Deinococcus geothermalis DSM 11300]
 gi|94554712|gb|ABF44626.1| HesB/YadR/YfhF [Deinococcus geothermalis DSM 11300]
          Length = 140

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 62/110 (56%), Gaps = 1/110 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++E    +   I+  S  +  G+R+ +K GGC+G +Y +  + D  ++GD ++   GV
Sbjct: 18  ISISEFGAQKALAILAQSGKENAGVRVFIKSGGCSGYQYGM-AIDDRELEGDTIVVDRGV 76

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           K+ +D  SL  + G+E+DF    +  GF  HNPN  S+CGCG S     A
Sbjct: 77  KLLVDRMSLPLLRGSEVDFVENMMGGGFTVHNPNATSSCGCGHSFRTDGA 126


>gi|258592357|emb|CBE68666.1| Iron-binding protein IscA (iron-sulfur cluster assembly protein)
           [NC10 bacterium 'Dutch sediment']
          Length = 100

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 59/102 (57%), Gaps = 2/102 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE+A  ++ +++       +G+R+ +  GGC+GL Y ++   D P   D + E  G
Sbjct: 1   MITLTESAATKVADLLKTQAKPEEGLRVRVVGGGCSGLSYQLEF--DEPQAADQVFETHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGC 105
           VKV +D  S +Y+ G+EID+      +GF   NPN  + CGC
Sbjct: 59  VKVLVDPQSYVYLAGSEIDYLDSLQGAGFSLKNPNPKANCGC 100


>gi|154253460|ref|YP_001414284.1| iron-sulfur cluster assembly accessory protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154157410|gb|ABS64627.1| iron-sulfur cluster assembly accessory protein [Parvibaculum
           lavamentivorans DS-1]
          Length = 116

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 69/109 (63%), Gaps = 6/109 (5%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGI--RISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +T+T+ A  RI  I+   +G+ +G+  R++++ GGC+G +Y   L      D D +IEK+
Sbjct: 12  ITVTDNAAKRIARIL---EGEGEGVMLRVAVQGGGCSGFQYGFTLDDLQNDD-DLVIEKN 67

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVKV IDS S+ Y+ G+EIDF  + + S F  +NPN  +ACGCG S  +
Sbjct: 68  GVKVLIDSVSVEYLAGSEIDFVDDLIGSAFKINNPNATAACGCGTSFSV 116


>gi|291296653|ref|YP_003508051.1| iron-sulfur cluster assembly accessory protein [Meiothermus ruber
           DSM 1279]
 gi|290471612|gb|ADD29031.1| iron-sulfur cluster assembly accessory protein [Meiothermus ruber
           DSM 1279]
          Length = 130

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 63/105 (60%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++T  A  R KEI+         IR+ +K GGC+G +Y +  V +  ++GD ++E  G
Sbjct: 7   VLSITPLAAERAKEILHRYNKPDAAIRVFIKSGGCSGYQYGM-AVDERELEGDTVVEMHG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           V++ +D  SL  ++G+E+D+    +  GF  +NPN  S+CGCG S
Sbjct: 66  VRLVVDRMSLPLLVGSEVDWVENLMGGGFSVNNPNATSSCGCGHS 110


>gi|182416357|ref|YP_001821423.1| iron-sulfur cluster assembly accessory protein [Opitutus terrae
           PB90-1]
 gi|177843571|gb|ACB77823.1| iron-sulfur cluster assembly accessory protein [Opitutus terrae
           PB90-1]
          Length = 138

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 64/109 (58%), Gaps = 2/109 (1%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++V +T AA  ++  ++   + +   +RI++  GGC GL Y +  V + P  GD L+   
Sbjct: 32  NLVRLTPAAGTKVAALLAR-ENQGDFLRIAITGGGCNGLSYKMKFVPE-PRRGDLLVRTA 89

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +V +DS S LY+ GT++D+ +  +  GF F NPN  ++C CG+S  +
Sbjct: 90  GAEVLVDSKSALYLKGTQLDYSSAMVSGGFKFSNPNAKASCSCGESFSV 138


>gi|52081706|ref|YP_080497.1| hypothetical protein BL03149 [Bacillus licheniformis ATCC 14580]
 gi|52787091|ref|YP_092920.1| YutM [Bacillus licheniformis ATCC 14580]
 gi|319647622|ref|ZP_08001840.1| YutM protein [Bacillus sp. BT1B_CT2]
 gi|52004917|gb|AAU24859.1| conserved protein YutM [Bacillus licheniformis ATCC 14580]
 gi|52349593|gb|AAU42227.1| YutM [Bacillus licheniformis ATCC 14580]
 gi|317389963|gb|EFV70772.1| YutM protein [Bacillus sp. BT1B_CT2]
          Length = 121

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (58%), Gaps = 1/104 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TEAA   IK+++   + +   +RI +K GGC+GL Y +    +   D ++ ++  G+
Sbjct: 6   VTVTEAAALHIKDMMKEHEEENAFLRIGVKGGGCSGLSYGMGFEHEKNEDDNEFVQH-GI 64

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            V +D  SL  M GT IDFK   +  GF   NPN +++CGCG S
Sbjct: 65  TVLVDQESLDIMNGTVIDFKQSMMGGGFTIDNPNAIASCGCGSS 108


>gi|269836798|ref|YP_003319026.1| iron-sulfur cluster assembly accessory protein [Sphaerobacter
           thermophilus DSM 20745]
 gi|269786061|gb|ACZ38204.1| iron-sulfur cluster assembly accessory protein [Sphaerobacter
           thermophilus DSM 20745]
          Length = 121

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 64/107 (59%), Gaps = 1/107 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T  AV R+KE + +   +   +R+ +  GGC+GL+Y +  V +   + D +IE+DG
Sbjct: 1   MITITPEAVERLKEYLVDEGFEDAMLRVFVAPGGCSGLQYGMS-VEEVAEEDDQIIEQDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +K+ +D  S +Y+ G EID+    +  GF   NPN V+ C CG S +
Sbjct: 60  IKLLVDQFSAMYLEGAEIDYVNSLMGGGFTVRNPNAVATCACGHSFD 106


>gi|62179959|ref|YP_216376.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|161614217|ref|YP_001588182.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167551666|ref|ZP_02345420.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|168233559|ref|ZP_02658617.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168239250|ref|ZP_02664308.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168240878|ref|ZP_02665810.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168463224|ref|ZP_02697155.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168822235|ref|ZP_02834235.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194444355|ref|YP_002040624.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194449606|ref|YP_002045374.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194470619|ref|ZP_03076603.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194736992|ref|YP_002114384.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|204927567|ref|ZP_03218768.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|224584119|ref|YP_002637917.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|62127592|gb|AAX65295.1| putative HesB-like domain [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161363581|gb|ABX67349.1| hypothetical protein SPAB_01960 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403018|gb|ACF63240.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194407910|gb|ACF68129.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194456983|gb|EDX45822.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194712494|gb|ACF91715.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195634534|gb|EDX52886.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197287973|gb|EDY27360.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|204322909|gb|EDZ08105.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205323637|gb|EDZ11476.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205332320|gb|EDZ19084.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205339349|gb|EDZ26113.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205341346|gb|EDZ28110.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|224468646|gb|ACN46476.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|320086150|emb|CBY95924.1| putative iron-sulfur cluster insertion protein erpA [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
 gi|322616753|gb|EFY13662.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322619987|gb|EFY16860.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322622298|gb|EFY19143.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322627821|gb|EFY24611.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322633080|gb|EFY29823.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322636674|gb|EFY33377.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322641301|gb|EFY37942.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322644931|gb|EFY41464.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322650230|gb|EFY46644.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322655805|gb|EFY52107.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322660131|gb|EFY56370.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322665303|gb|EFY61491.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322669560|gb|EFY65708.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673486|gb|EFY69588.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322677414|gb|EFY73478.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322679923|gb|EFY75962.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322687395|gb|EFY83367.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|322714426|gb|EFZ05997.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|323192348|gb|EFZ77579.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323198633|gb|EFZ83734.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323203114|gb|EFZ88145.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323208679|gb|EFZ93617.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323213806|gb|EFZ98584.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323217656|gb|EGA02371.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323219077|gb|EGA03582.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323227194|gb|EGA11367.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323229458|gb|EGA13581.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323232681|gb|EGA16777.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323240281|gb|EGA24325.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323242731|gb|EGA26752.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323245942|gb|EGA29930.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323252814|gb|EGA36651.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323256695|gb|EGA40424.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323260087|gb|EGA43712.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323267148|gb|EGA50633.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323271528|gb|EGA54949.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
          Length = 122

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 65/108 (60%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDG 63
           +T+T AA   I+E+     G   G+R+S+K+ GCAG  Y++D V +   D DDL+ E +G
Sbjct: 18  LTLTPAAAAHIRELAAKQPGML-GVRLSVKQTGCAGFGYVLDTVREP--DKDDLVFEAEG 74

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            K++    ++ ++ GTE+D+  E L   F FHNP   + CGCG+S  +
Sbjct: 75  AKLFAPLQAMPFIDGTEVDYVQEGLNQLFKFHNPKAQNECGCGESFGV 122


>gi|325116008|emb|CBZ51562.1| hypothetical protein NCLIV_013550 [Neospora caninum Liverpool]
          Length = 506

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 38/91 (41%), Positives = 59/91 (64%), Gaps = 8/91 (8%)

Query: 25  KAQGIRISLKKGGCAGLEYMVDLVTDNPVD-------GDDLIEKDGVKVWIDSASLLYML 77
           +A GIRI L+K GC+GL Y VD+ T   VD        D++IE  G K+ + S ++++++
Sbjct: 414 RAIGIRIGLEKRGCSGLSYTVDVATQT-VDSRKQTWGADEVIETAGGKLVVASDAVMFLV 472

Query: 78  GTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           GTE+D+   ++   FVF NPN+  +CGCG+S
Sbjct: 473 GTEVDYVDTEIERKFVFKNPNEKQSCGCGKS 503


>gi|227821926|ref|YP_002825896.1| protein HesB, vegetative [Sinorhizobium fredii NGR234]
 gi|227340925|gb|ACP25143.1| protein HesB, vegetative [Sinorhizobium fredii NGR234]
          Length = 110

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M + VT+++AA  RI  I+     K   +R+S++ GGC+G  Y  DLV D   D D ++E
Sbjct: 2   MQETVTLSDAAARRIAAILQTEHDKT-AMRVSVEGGGCSGFSYKFDLV-DQENDDDLVLE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K   KV IDS SL+YM G+EIDF    L   F   NPN V++CGCG S  +
Sbjct: 60  KGNAKVLIDSLSLVYMGGSEIDFVDNLLGQSFQIKNPNAVASCGCGTSFSV 110


>gi|89095109|ref|ZP_01168035.1| HesB/YadR/YfhF protein [Oceanospirillum sp. MED92]
 gi|89080604|gb|EAR59850.1| HesB/YadR/YfhF protein [Oceanospirillum sp. MED92]
          Length = 118

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 60/107 (56%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T +A  ++K ++   +  +  +R+ +  GGCAG  Y      ++  D D +IE+DGV
Sbjct: 13  MAFTASAAAKVKSLIEEEENDSLKLRVFITGGGCAGFSYGFTF-DESAADDDTVIERDGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S  Y++G+E+DFK     S FV +NPN  + CGCG S  I
Sbjct: 72  TMVVDPMSFQYLVGSEVDFKEGLQGSQFVINNPNATTTCGCGSSFSI 118


>gi|84623952|ref|YP_451324.1| hypothetical protein XOO_2295 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|84367892|dbj|BAE69050.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 112

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (59%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T AA+ R++  V  + G A G+R  + K GC+G  +++DL  +   D D + E+ GV
Sbjct: 3   VSLTPAALERVQRFVQQTPG-ALGLRFGVTKTGCSGWGHIIDLAREA-RDDDAVFEQGGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++D  SL  + GT IDF    L   F F NPN  + CGCG+S
Sbjct: 61  RIFVDPVSLPLVDGTCIDFGKHGLSETFTFSNPNATAECGCGES 104


>gi|110638909|ref|YP_679118.1| iron-sulfur cluster assembly scaffold protein [Cytophaga
           hutchinsonii ATCC 33406]
 gi|110281590|gb|ABG59776.1| scaffold protein for iron-sulfur cluster assembly [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 108

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 52/84 (61%), Gaps = 3/84 (3%)

Query: 29  IRISLKKGGCAGLEYMVDLVTDNPVD-GDDLIEKDGVKVWIDSASLLYMLGTEIDFKTEK 87
           IR+S+K GGC+GL  M DL  DN +D  D + E  GVK+ +D  SLLY+LGT +DF    
Sbjct: 27  IRVSVKGGGCSGL--MYDLDFDNKIDEADQVFEDKGVKILVDKKSLLYLLGTTLDFTDGL 84

Query: 88  LYSGFVFHNPNQVSACGCGQSVEI 111
              GF F NPN    CGCG+S  +
Sbjct: 85  NGKGFHFVNPNASRTCGCGESFSV 108


>gi|224097616|ref|XP_002311012.1| predicted protein [Populus trichocarpa]
 gi|222850832|gb|EEE88379.1| predicted protein [Populus trichocarpa]
          Length = 141

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (60%), Gaps = 3/105 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T+ A  RI+ ++   Q +   +R+ +K  GC GL Y ++   D     D+L+   G
Sbjct: 25  VLDLTDTAATRIRHLL--QQRQRPFLRLGVKARGCNGLSYTLNYA-DEKGRFDELVADKG 81

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VK+ ID  +L++++GT++DF  +KL S FVF NPN    CGCG+S
Sbjct: 82  VKILIDPKALMHVIGTKMDFVDDKLRSEFVFINPNSQGQCGCGES 126


>gi|114327926|ref|YP_745083.1| hesB protein family protein [Granulibacter bethesdensis CGDNIH1]
 gi|114316100|gb|ABI62160.1| hesB protein family [Granulibacter bethesdensis CGDNIH1]
          Length = 139

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 60/106 (56%), Gaps = 6/106 (5%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           ++ +A  RI EI      + Q +R+S+  GGC+G +Y   L      D D +IE+DG  V
Sbjct: 40  VSASAAARIAEIA-----QGQALRVSVLAGGCSGFQYQFAL-DGQRADDDVVIERDGAVV 93

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
            +D ASL ++ G E+D+K   + S F   NPN  ++CGCG S  ++
Sbjct: 94  LVDPASLEFLAGAELDYKDALMGSHFTIRNPNATASCGCGTSFSVE 139


>gi|16760538|ref|NP_456155.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29141701|ref|NP_805043.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56413657|ref|YP_150732.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|168263804|ref|ZP_02685777.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|197248770|ref|YP_002146670.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197362581|ref|YP_002142218.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|213029362|ref|ZP_03343809.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
 gi|213053495|ref|ZP_03346373.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213419545|ref|ZP_03352611.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
 gi|213428573|ref|ZP_03361323.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213581034|ref|ZP_03362860.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213611284|ref|ZP_03370110.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
 gi|213649931|ref|ZP_03379984.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|213852803|ref|ZP_03382335.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|238910815|ref|ZP_04654652.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|289810024|ref|ZP_06540653.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhi str. AG3]
 gi|289825920|ref|ZP_06545079.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|25310146|pir||AC0703 conserved hypothetical protein STY1754 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16502834|emb|CAD01996.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137329|gb|AAO68892.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56127914|gb|AAV77420.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197094058|emb|CAR59558.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197212473|gb|ACH49870.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|205347631|gb|EDZ34262.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 122

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 65/108 (60%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDG 63
           +T+T AA   I+E+     G   G+R+S+K+ GCAG  Y++D V +   D DDL+ E +G
Sbjct: 18  LTLTPAAAAHIRELAAKQPGML-GVRLSVKQTGCAGFGYVLDTVREP--DKDDLVFEAEG 74

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            K++    ++ ++ GTE+D+  E L   F FHNP   + CGCG+S  +
Sbjct: 75  AKLFAPLQAMPFIDGTEVDYVQEGLNQLFKFHNPKAQNECGCGESFGV 122


>gi|282899629|ref|ZP_06307593.1| HesB/YadR/YfhF [Cylindrospermopsis raciborskii CS-505]
 gi|281195508|gb|EFA70441.1| HesB/YadR/YfhF [Cylindrospermopsis raciborskii CS-505]
          Length = 118

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDG-DDLIEKDG 63
           + ++EAA+ ++K +    QG+   +R+ +++GGC+G+ YM+D    + +   DD+ + DG
Sbjct: 12  IILSEAALRQVKSLQ-AQQGQDLCLRVGVRQGGCSGMSYMMDFEDLSKITPQDDVFDYDG 70

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            K+  D  SLLY+ G  +D+ +  +  GF F NPN    CGCG+S  +
Sbjct: 71  FKIVCDRKSLLYLYGLMLDYSSAMIGGGFQFTNPNASQTCGCGKSFGV 118


>gi|298492904|ref|YP_003723081.1| iron-sulfur cluster assembly accessory protein ['Nostoc azollae'
           0708]
 gi|298234822|gb|ADI65958.1| iron-sulfur cluster assembly accessory protein ['Nostoc azollae'
           0708]
          Length = 118

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDG-DDLIEKDG 63
           + ++EAA+ ++K +   SQG+   +R+ +++GGC+G+ YM+D    + +   D++ + DG
Sbjct: 12  ILLSEAALVQVKSLQ-ASQGQDLCLRVGVRQGGCSGMSYMMDFEDISKITPQDEVFDYDG 70

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            K+  D  SLLY+ G  +D+    +  GF F NPN    CGCG+S  +
Sbjct: 71  FKILCDRKSLLYLYGLMLDYSNAMIGGGFQFTNPNASQTCGCGKSFGV 118


>gi|205374722|ref|ZP_03227516.1| hypothetical protein Bcoam_16845 [Bacillus coahuilensis m4-4]
          Length = 120

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 68/109 (62%), Gaps = 3/109 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-I 59
           MS++V +TEAA ++IK+++  ++ +   +R+S+  GGC+GL Y +    D+    DD+ +
Sbjct: 1   MSEVVIITEAASFQIKDMMKQNEEEGAFLRVSVNGGGCSGLSYGMGF--DHEQKEDDVEV 58

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++ G+ + +D  S   + GT ID+K   +  GF   NPN ++ACGCG S
Sbjct: 59  QQFGLHILVDKESASILNGTTIDYKQSLMGGGFTIDNPNAIAACGCGSS 107


>gi|77464101|ref|YP_353605.1| hypothetical protein RSP_0532 [Rhodobacter sphaeroides 2.4.1]
 gi|126462945|ref|YP_001044059.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221639966|ref|YP_002526228.1| hypothetical protein RSKD131_1867 [Rhodobacter sphaeroides KD131]
 gi|267511|sp|Q01195|YNIU_RHOSH RecName: Full=Uncharacterized protein in nifU 5'region; AltName:
           Full=ORF1
 gi|151966|gb|AAA26135.1| ORF1 [Rhodobacter sphaeroides]
 gi|77388519|gb|ABA79704.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
 gi|126104609|gb|ABN77287.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221160747|gb|ACM01727.1| Hypothetical Protein RSKD131_1867 [Rhodobacter sphaeroides KD131]
          Length = 106

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 64/107 (59%), Gaps = 5/107 (4%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDL-VTDNPVDGDDLI-EK 61
           ++ +T AA   IK  +  +     G+R+ ++ GGCAGL+Y + L +T+ P   DDL+ E 
Sbjct: 1   MIQITPAAQAAIKGAIEGAGQPVAGLRLMVQSGGCAGLKYGMSLELTEAP---DDLVVEA 57

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +G++V ID  S  Y+ G  IDF T    +GFVF NPN    CGCG+S
Sbjct: 58  EGLRVLIDPQSGTYLNGVTIDFVTSLEGTGFVFDNPNAKGGCGCGKS 104


>gi|242052391|ref|XP_002455341.1| hypothetical protein SORBIDRAFT_03g008820 [Sorghum bicolor]
 gi|241927316|gb|EES00461.1| hypothetical protein SORBIDRAFT_03g008820 [Sorghum bicolor]
          Length = 130

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 66/104 (63%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+ A  RI++++  S  +   +R+ +K  GC GL Y ++   D     D+L+E+ GV
Sbjct: 19  LTLTDTAASRIRQLL--SLRQRPYLRLGVKARGCNGLSYTLNYA-DEKGKFDELVEEKGV 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV ID  +L++++GT++D+  + L S FVF NPN    CGCG+S
Sbjct: 76  KVLIDPKALMHVIGTKMDYVDDPLKSEFVFINPNSKGECGCGES 119


>gi|254517417|ref|ZP_05129474.1| HesB/YadR/YfhF [gamma proteobacterium NOR5-3]
 gi|219674255|gb|EED30624.1| HesB/YadR/YfhF [gamma proteobacterium NOR5-3]
          Length = 117

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 62/109 (56%), Gaps = 1/109 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           + +T+++ AV +++E+V   +  A  +R+ +  GGC+G +Y      D   D D  IE++
Sbjct: 10  NAITLSDRAVNKVRELVNEEENTALKLRVFITGGGCSGFQYGFSFDEDAAED-DTTIERE 68

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GV V +D  S  Y+ G+E+D+      S F+ +NPN  + CGCG S  +
Sbjct: 69  GVTVLVDPMSFPYLAGSEVDYSEGLEGSRFIVNNPNATTTCGCGASFSV 117


>gi|221633531|ref|YP_002522756.1| HesB/YadR/YfhF [Thermomicrobium roseum DSM 5159]
 gi|221156918|gb|ACM06045.1| HesB/YadR/YfhF [Thermomicrobium roseum DSM 5159]
          Length = 127

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 65/111 (58%), Gaps = 5/111 (4%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQG-IRISLKKGGCAGLEYMVDLVTDNPVDGDDL-I 59
           + ++TMT  AV R+K+ + + QG  +  +R+ +  GGC+GL+Y + L  +   + DD   
Sbjct: 4   TTLITMTPEAVRRLKQFM-DEQGMPEAYLRVFVAPGGCSGLQYGMAL--EESAEEDDFTF 60

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           E DGV+V +D  S  Y+ G EID+    +  GF  HNPN V+ C CG S +
Sbjct: 61  EIDGVRVIVDPFSATYLEGAEIDYVNSLMGGGFTVHNPNAVATCACGHSFD 111


>gi|297528904|ref|YP_003670179.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           C56-T3]
 gi|297252156|gb|ADI25602.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           C56-T3]
          Length = 121

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 64/106 (60%), Gaps = 3/106 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEKD 62
           ++T+TEAA ++IK+++   + +   +R+ +  GGC+GL Y +    D+    DD+  E+ 
Sbjct: 5   VITLTEAAAFQIKDMMKEQEEEGAYLRVGVHGGGCSGLSYGMGF--DHERRDDDIEFEQH 62

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           G+K+ +D  S   + GT ID+K   L  GF  +NPN ++ CGCG S
Sbjct: 63  GIKILVDRDSAPILRGTVIDYKQSLLGGGFTINNPNAIATCGCGSS 108


>gi|296535509|ref|ZP_06897695.1| iron-sulfur cluster insertion protein ErpA [Roseomonas cervicalis
           ATCC 49957]
 gi|296264164|gb|EFH10603.1| iron-sulfur cluster insertion protein ErpA [Roseomonas cervicalis
           ATCC 49957]
          Length = 139

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 64/119 (53%), Gaps = 10/119 (8%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNS-------QGKAQ-GIRISLKKGGCAGLEYMVDLVTDNP 52
           M D  T+  A  +R+    F         QG+ Q G+R+++  GGC+G +Y  +L  D P
Sbjct: 22  MPDGTTLP-APAFRVTPRAFAQVAEIAARQGRPQAGLRLAVLAGGCSGFQYSFEL-EDAP 79

Query: 53  VDGDDLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
              D +IE+DGV+V ID  SL  + G+E+D+  E + + F   NP   S CGCG S  +
Sbjct: 80  AGDDLVIEQDGVRVMIDPVSLELLAGSELDWADELIGAHFSVKNPQAASGCGCGASFSV 138


>gi|300772040|ref|ZP_07081910.1| type I restriction-modification system [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|300760343|gb|EFK57169.1| type I restriction-modification system [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 117

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 64/105 (60%), Gaps = 3/105 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +T+TE AV  +K++    +  +  G+R+ ++ GGC+G+ Y++    D   +GD   E +G
Sbjct: 12  LTLTEGAVKELKKLRDQQEISEDFGLRVGVEGGGCSGMSYILGF--DQKKEGDSEYEIEG 69

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++++ A  LY+ G E+DF+      GF F+NPN  S CGCG S
Sbjct: 70  IRIFMNKAHGLYLAGMEVDFRNGLDARGFTFNNPNATSTCGCGSS 114


>gi|295096076|emb|CBK85166.1| FeS assembly scaffold SufA [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 122

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (60%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I E+V  +     G+R+ +K+ GCAG  Y++D VT+ P   D + E DG 
Sbjct: 18  LTLTPAAAAHIHELVAKNP-DILGVRLGVKQTGCAGFGYVLDTVTE-PEKDDLVFETDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+++   ++ ++ GTE+D+  E L   F FHNP   + CGCG+S
Sbjct: 76  KLYVALQAMPFIDGTEVDYVREGLNQLFKFHNPKAQNECGCGES 119


>gi|312131421|ref|YP_003998761.1| iroN-sulfur cluster assembly accessory protein [Leadbetterella
           byssophila DSM 17132]
 gi|311907967|gb|ADQ18408.1| iron-sulfur cluster assembly accessory protein [Leadbetterella
           byssophila DSM 17132]
          Length = 108

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 65/111 (58%), Gaps = 6/111 (5%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKA--QGIRISLKKGGCAGLEYMVDL-VTDNPVDGDDLIE 60
           +VT+++ A  +I E+    +GK    GIR++++ GGC+GL Y +       P D   + E
Sbjct: 1   MVTVSDIAKEKIFELR-EKEGKNDNHGIRVAVEGGGCSGLMYNLAFDAEQQPTD--HIFE 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             G+K+++D  SLLY++GTE+DF       GF F NPN    CGCG+S  +
Sbjct: 58  DKGIKIFVDKKSLLYLMGTELDFSDGLNGKGFHFKNPNATRTCGCGESFSV 108


>gi|304408202|ref|ZP_07389851.1| iron-sulfur cluster assembly accessory protein [Paenibacillus
           curdlanolyticus YK9]
 gi|304342890|gb|EFM08735.1| iron-sulfur cluster assembly accessory protein [Paenibacillus
           curdlanolyticus YK9]
          Length = 119

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 62/105 (59%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +++ AV +IKE++   +     +R+ +K+GGC+G  Y +    D   +GD  +  +G
Sbjct: 1   MIKVSDTAVDKIKEMLAAEETPNMFLRVGVKEGGCSGFSYGMGF-DDEQHEGDQELSANG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +KV +D  S+ Y+ G EID+K   +  GF  HNPN  + CGCG S
Sbjct: 60  LKVVVDGDSVKYLNGLEIDWKDAAMGGGFTIHNPNATATCGCGSS 104


>gi|313229240|emb|CBY23826.1| unnamed protein product [Oikopleura dioica]
          Length = 132

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 1/108 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVT-DNPVDGDDLIEKDG 63
           +T T AA+ R+K +  +        RI L+  GC G+ Y ++    ++    ++ + +DG
Sbjct: 25  LTFTPAAIDRLKTLANDEPNNNPVFRIGLRTKGCNGMAYTLEHAEIESKKKFEETVSEDG 84

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V V ID  + + +LGTE+D+ + KL  GF+F NPN    CGCG+S  I
Sbjct: 85  VTVIIDMKAQMTLLGTEMDYSSNKLEEGFIFSNPNIKGTCGCGESFNI 132


>gi|254427650|ref|ZP_05041357.1| hypothetical protein ADG881_880 [Alcanivorax sp. DG881]
 gi|196193819|gb|EDX88778.1| hypothetical protein ADG881_880 [Alcanivorax sp. DG881]
          Length = 119

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 62/108 (57%), Gaps = 5/108 (4%)

Query: 5   VTMTEAAVYR-IKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           + +TEAA  + ++EI    +  A GIR+ L + GC+G  Y +D V + P DGD L E DG
Sbjct: 13  LNLTEAANQQALREI---QRANATGIRLDLDESGCSGFMYTLDFV-EEPKDGDKLFEIDG 68

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V +++    L  + G  ID+ TE + S F F NPN    CGCG+S  +
Sbjct: 69  VNLYVPEKWLPMLNGLVIDYVTEGVNSLFKFRNPNATGECGCGESFTV 116


>gi|114580804|ref|XP_001141878.1| PREDICTED: similar to GK004 isoform 2 [Pan troglodytes]
          Length = 129

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK++    + +  G+++ ++  GC GL Y ++  T    D D+ + +DGV
Sbjct: 25  LTLTPSAVNKIKQL-LKDKPEHVGVKVGVRTRGCNGLSYTLEY-TKTKGDSDEEVIQDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V I+  + L +LGTE+ +  +KL S FVF+NPN    CGCG+S  I
Sbjct: 83  RVLIEKKAQLTLLGTEMCYVEDKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|315043036|ref|XP_003170894.1| hypothetical protein MGYG_06884 [Arthroderma gypseum CBS 118893]
 gi|311344683|gb|EFR03886.1| hypothetical protein MGYG_06884 [Arthroderma gypseum CBS 118893]
          Length = 625

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 64/94 (68%), Gaps = 3/94 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T  A+ +++E++  SQ   + IRI +K  GC+GL Y ++ V + P   D+++E+DGV
Sbjct: 148 VSLTPTALSKLRELL--SQPDPKLIRIGVKNRGCSGLSYHLEYV-EKPAPFDEVVEQDGV 204

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPN 98
           KV IDS +L  ++G+E+D+  + L S FVF NPN
Sbjct: 205 KVLIDSKALFSIIGSEMDWHEDPLSSRFVFSNPN 238


>gi|254491634|ref|ZP_05104813.1| HesB-like domain, putative [Methylophaga thiooxidans DMS010]
 gi|224463112|gb|EEF79382.1| HesB-like domain, putative [Methylophaga thiooxydans DMS010]
          Length = 108

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 66/110 (60%), Gaps = 2/110 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE+A+ R+++++   +    G+RI + K GC+G  Y +D   D   +GD ++E+  
Sbjct: 1   MITLTESAINRVRDMMTKRE-SGIGLRIGVVKSGCSGYSYALDY-ADELGNGDVILEQSD 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
           VKV ++  ++  + G E+DF  E L   F F NPN  S CGCG+S  + +
Sbjct: 59  VKVVVNEEAMPLLEGMELDFVKEGLNQSFKFRNPNVTSECGCGESFSVTK 108


>gi|309366478|emb|CAP21424.4| hypothetical protein CBG_24933 [Caenorhabditis briggsae AF16]
          Length = 156

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 68/136 (50%), Gaps = 30/136 (22%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNP--------VDGD 56
           +T+T  AV RI+ ++   Q  A  ++I +++ GC GL Y ++   +          VD  
Sbjct: 22  LTLTNEAVSRIR-VLLAQQNNANALKIGVRQKGCNGLTYTLEYAREKQKFDEEVEQVDFS 80

Query: 57  DLIEK---------------------DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFH 95
             ++K                     DG+KVWI+  + L +LG+E+D+ T+KL S FVF 
Sbjct: 81  KFLKKNLKFFFFELKILKIQFFAKNRDGIKVWIEPKAQLSLLGSEMDYVTDKLSSEFVFR 140

Query: 96  NPNQVSACGCGQSVEI 111
           NPN    CGCG+S  I
Sbjct: 141 NPNIKGTCGCGESFSI 156


>gi|289613649|emb|CBI59397.1| unnamed protein product [Sordaria macrospora]
          Length = 250

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 64/102 (62%), Gaps = 3/102 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T AAV  ++ ++   Q   + I++ ++  GC+GL Y ++ V D     D+ +E+DGVKV
Sbjct: 149 LTPAAVEHLRAML--DQPDPKLIKVGVRNRGCSGLAYHLEYV-DKAGAFDETVEQDGVKV 205

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            IDS +L  ++G+E+D+  +KL   FVF NPN    CGCG+S
Sbjct: 206 LIDSKALFSIIGSEMDWVEDKLSQRFVFRNPNIKEQCGCGES 247


>gi|56421491|ref|YP_148809.1| hypothetical protein GK2956 [Geobacillus kaustophilus HTA426]
 gi|56381333|dbj|BAD77241.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
          Length = 121

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 64/106 (60%), Gaps = 3/106 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEKD 62
           ++T+TEAA ++IK+++   + +   +R+ +  GGC+GL Y +    D+    DD+  E+ 
Sbjct: 5   VITLTEAAAFQIKDMMKEQEEEGAYLRVGVHGGGCSGLSYGMGF--DHERREDDIEFEQH 62

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           G+K+ +D  S   + GT ID+K   L  GF  +NPN ++ CGCG S
Sbjct: 63  GIKILVDRDSAPILRGTVIDYKQSLLGGGFTINNPNAIATCGCGSS 108


>gi|16764719|ref|NP_460334.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|167994390|ref|ZP_02575482.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|197263592|ref|ZP_03163666.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198244881|ref|YP_002215758.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|200390749|ref|ZP_03217360.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205352911|ref|YP_002226712.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|207857125|ref|YP_002243776.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|16419889|gb|AAL20293.1| putative HesB-like domain protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|197241847|gb|EDY24467.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197939397|gb|ACH76730.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199603194|gb|EDZ01740.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205272692|emb|CAR37606.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205327758|gb|EDZ14522.1| FeS assembly scaffold SufA [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|206708928|emb|CAR33258.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261246577|emb|CBG24387.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267993256|gb|ACY88141.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301157904|emb|CBW17399.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312912354|dbj|BAJ36328.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|321223995|gb|EFX49058.1| Iron binding protein SufA for iron-sulfur cluster assembly
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|323129639|gb|ADX17069.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|326623504|gb|EGE29849.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|326627984|gb|EGE34327.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
 gi|332988256|gb|AEF07239.1| iron-sulfur cluster assembly scaffold protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 122

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 64/105 (60%), Gaps = 4/105 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDG 63
           +T+T AA   I+E+    Q    G+R+S+K+ GCAG  Y++D V +   D DDL+ E +G
Sbjct: 18  LTLTPAAAAHIRELA-EKQPGMLGVRLSVKQTGCAGFGYVLDTVREP--DKDDLVFEAEG 74

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            K++    ++ ++ GTE+D+  E L   F FHNP   + CGCG+S
Sbjct: 75  AKLFAPLQAMPFIDGTEVDYVQEGLNQLFKFHNPKAQNECGCGES 119


>gi|110680354|ref|YP_683361.1| FeS cluster assembly HesB family protein, putative [Roseobacter
           denitrificans OCh 114]
 gi|109456470|gb|ABG32675.1| FeS cluster assembly HesB family protein, putative [Roseobacter
           denitrificans OCh 114]
          Length = 107

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 64/105 (60%), Gaps = 4/105 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A  R+ EI  +  GKA  +R++++ GGC+G +Y +DL  D P + D ++E  G KV
Sbjct: 7   VTPRAFERLAEIGASDDGKA--LRVAVEGGGCSGFQYEIDL--DEPKEDDLVLEGAGQKV 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            ID+ SL ++    IDF  E + + FV +NPN  S+CGCG S  +
Sbjct: 63  VIDTVSLPFLADAVIDFTEELIGARFVINNPNASSSCGCGTSFSM 107


>gi|159044279|ref|YP_001533073.1| iron-sulfur cluster assembly accessory protein [Dinoroseobacter
           shibae DFL 12]
 gi|157912039|gb|ABV93472.1| iron-sulfur cluster assembly accessory protein [Dinoroseobacter
           shibae DFL 12]
          Length = 110

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 62/103 (60%), Gaps = 3/103 (2%)

Query: 6   TMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVK 65
           T+TE A  R+ EI   S   A+ +R++++ GGC+G +Y + L  D+P + D ++E  G K
Sbjct: 8   TVTERAFARLAEINAESDA-AKALRVAVEGGGCSGFQYEIKL--DDPAEDDLVLEGKGQK 64

Query: 66  VWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           V +D+ SL ++    IDF  E + + F   NPN  S+CGCG S
Sbjct: 65  VVVDAVSLPFLENAVIDFTEELIGARFTIENPNASSSCGCGTS 107


>gi|42522729|ref|NP_968109.1| scaffold protein for iron-sulfur cluster assembly [Bdellovibrio
           bacteriovorus HD100]
 gi|39573925|emb|CAE79102.1| Scaffold protein for iron-sulfur cluster assembly [Bdellovibrio
           bacteriovorus HD100]
          Length = 137

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 63/110 (57%), Gaps = 4/110 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGK--AQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           ++T++  A  ++  +    +GK  A  +R+ +KKGGC+GL Y +D  T    DGD   E 
Sbjct: 30  MITISPEAATKLASLK-KDEGKDDAAFLRVEVKKGGCSGLSYKMDFDTVT-RDGDKFFES 87

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            G KV +DS S+LY+LG  +++       GFVF+NPN    CGCG S  +
Sbjct: 88  QGQKVAVDSQSMLYLLGMTLEYSGGLNGKGFVFNNPNANKHCGCGSSFNV 137


>gi|113477391|ref|YP_723452.1| iron-sulfur cluster assembly accessory protein [Trichodesmium
           erythraeum IMS101]
 gi|110168439|gb|ABG52979.1| iron-sulfur cluster assembly accessory protein [Trichodesmium
           erythraeum IMS101]
          Length = 118

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 61/105 (58%), Gaps = 2/105 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKDG 63
           + M+E AV ++  +  + QGK   +R+ +++GGC+G+ YM+D    + +  DD + + DG
Sbjct: 12  IMMSETAVKQVLSLR-DKQGKDLCLRVGVRQGGCSGMSYMMDFADPSTIREDDEVFDYDG 70

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            KV  D  S+LY+ G  +D+    +  GF F NPN    CGCG S
Sbjct: 71  FKVVCDRKSILYLYGLMLDYSDALIGGGFQFTNPNATQTCGCGNS 115


>gi|260433436|ref|ZP_05787407.1| HesB/YadR/YfhF [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417264|gb|EEX10523.1| HesB/YadR/YfhF [Silicibacter lacuscaerulensis ITI-1157]
          Length = 107

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (60%), Gaps = 4/102 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +TE A  R+ EI    +GKA  +RI+++ GGC+G +Y + L  D P + D ++E  G KV
Sbjct: 7   VTERAFERLAEIGAAKEGKA--LRIAVEGGGCSGFQYEIAL--DEPKEDDLVLEGKGQKV 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            +D+ SL ++    IDF  E + + FV  NPN  S+CGCG S
Sbjct: 63  VVDAISLPFLENATIDFTEELIGARFVIDNPNATSSCGCGTS 104


>gi|85716515|ref|ZP_01047486.1| HesB/YadR/YfhF [Nitrobacter sp. Nb-311A]
 gi|85696704|gb|EAQ34591.1| HesB/YadR/YfhF [Nitrobacter sp. Nb-311A]
          Length = 110

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++E A  RI EI+  S+G    +RIS++ GGC+G +Y  D +     D D +I +D  
Sbjct: 6   ITVSERAARRIGEIL-KSEGDGAMLRISVEGGGCSGFQYKFD-IERAKADDDLVIARDSA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D AS+ ++ G+E+DF  + + + F   NPN  ++CGCG S  I
Sbjct: 64  VVLVDPASVPFLSGSEVDFVDDLIGASFRVVNPNATASCGCGTSFSI 110


>gi|30249399|ref|NP_841469.1| iron-sulfur cluster insertion protein ErpA [Nitrosomonas europaea
           ATCC 19718]
 gi|75540519|sp|Q82UQ4|ERPA_NITEU RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|30138762|emb|CAD85339.1| Hypothetical hesB/yadR/yfhF family [Nitrosomonas europaea ATCC
           19718]
          Length = 121

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDG 63
           +  T+ A  ++KE++     +A  +R+ +  GGC+G +Y      D  V+ DD + EK G
Sbjct: 16  LNFTDGAASKVKELIEEEDNQALKLRVFVSGGGCSGFQY--GFTFDEIVNEDDFVMEKQG 73

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VK+ +DS S  Y++G EID++     + FV  NP+  S CGCG S  +
Sbjct: 74  VKLLVDSMSFQYLVGAEIDYQESAQGAQFVIKNPSAASTCGCGSSFSV 121


>gi|251772935|gb|EES53494.1| probable iron-sulfur cluster assembly family protein
           [Leptospirillum ferrodiazotrophum]
          Length = 127

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 62/109 (56%), Gaps = 2/109 (1%)

Query: 5   VTMTE-AAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           VT+TE A V+  + I FN   +  GIR+ +K GGC+GL Y ++L    P+  D +    G
Sbjct: 3   VTVTEKAGVFLRRMIRFNGGDEGAGIRLIVKPGGCSGLSYDMELALQ-PLPTDRIFPGPG 61

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
             + I    L Y+ G+EIDF+   + +  VF NPN  S+CGCG S  ++
Sbjct: 62  FALHIPEECLGYVDGSEIDFEDNMMNTQLVFKNPNATSSCGCGTSFNVE 110


>gi|323488632|ref|ZP_08093874.1| iron-sulfur cluster assembly accessory protein [Planococcus
           donghaensis MPA1U2]
 gi|323397650|gb|EGA90454.1| iron-sulfur cluster assembly accessory protein [Planococcus
           donghaensis MPA1U2]
          Length = 120

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 68/115 (59%), Gaps = 1/115 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+++V +TEAA ++IKE++ +++ +   +R+++K GGC+GL Y +    +   + DD  E
Sbjct: 1   MTEVVEITEAASFQIKEMMRHNEEEGSYLRVAVKGGGCSGLTYGMGFEKEKTGE-DDRYE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           + G+ + I       + GT +D+K   +  GF   NPN +++CGCG S    + +
Sbjct: 60  QFGIPILIAKEDAPILQGTVVDYKQSLMGGGFTIENPNAIASCGCGTSFRTAKKE 114


>gi|296102716|ref|YP_003612862.1| Fe-S cluster assembly protein SufA [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295057175|gb|ADF61913.1| Fe-S cluster assembly protein SufA [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 122

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 64/104 (61%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA   I ++V   + +  G+R+ +K+ GCAG  Y++D VT+ P   D + E DG 
Sbjct: 18  LTLTPAAAAHIHQLV-AKKPEILGVRLGVKQTGCAGFGYVLDTVTE-PEKDDLVFETDGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+++   ++ ++ GTE+D+  E L   F FHNP   + CGCG+S
Sbjct: 76  KLYVALQAMPFIDGTEVDYVREGLNQLFKFHNPKAQNECGCGES 119


>gi|114331529|ref|YP_747751.1| iron-sulfur cluster insertion protein ErpA [Nitrosomonas eutropha
           C91]
 gi|122313675|sp|Q0AFU6|ERPA_NITEC RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|114308543|gb|ABI59786.1| iron-sulfur cluster assembly accessory protein [Nitrosomonas
           eutropha C91]
          Length = 121

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 61/106 (57%), Gaps = 3/106 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEKDGVK 65
            T++A  ++KE++     +A  +R+ +  GGC+G +Y      D  ++ DD  IEK GV+
Sbjct: 18  FTDSAASKVKELIEEEANQALKLRVFVSGGGCSGFQY--GFTFDEIINEDDFVIEKQGVR 75

Query: 66  VWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + +DS S+ Y+LG EID++     + FV  NP   S CGCG S  +
Sbjct: 76  LLVDSMSVQYLLGAEIDYQENAQGAQFVIKNPAAASTCGCGSSFSV 121


>gi|188992093|ref|YP_001904103.1| Putative iron-sulfur cluster assembly accessory protein
           [Xanthomonas campestris pv. campestris str. B100]
 gi|167733853|emb|CAP52059.1| Putative iron-sulfur cluster assembly accessory protein
           [Xanthomonas campestris pv. campestris]
          Length = 121

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T AA+ R++  V  + G A G+R  + K GC+G  ++ DL  +   D D + E+ GV
Sbjct: 12  ISLTPAALERVQRFVQQTPG-ALGLRFGVTKTGCSGWGHITDLAREK-RDDDAVFEQGGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++D  SL  + GT IDF    L   F F NPN  + CGCG+S
Sbjct: 70  RIFVDPTSLPLVDGTCIDFGKHGLSETFTFSNPNATAECGCGES 113


>gi|126729729|ref|ZP_01745542.1| Iron-sulfur cluster assembly family protein [Sagittula stellata
           E-37]
 gi|126709848|gb|EBA08901.1| Iron-sulfur cluster assembly family protein [Sagittula stellata
           E-37]
          Length = 107

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 60/105 (57%), Gaps = 4/105 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +TE A  R+ EI    QGKA  +R++++ GGC+G +Y  D+  D P   D +I +   KV
Sbjct: 7   VTERAFERLSEIGAADQGKA--LRVAVEGGGCSGFQY--DISLDAPATDDLVIAEGPEKV 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  SL ++ G  IDF  E + + F   NPN  S+CGCG S  I
Sbjct: 63  VVDPVSLPFLSGATIDFTDELIGARFTIDNPNATSSCGCGTSFSI 107


>gi|315425724|dbj|BAJ47380.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Caldiarchaeum subterraneum]
          Length = 117

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 67/109 (61%), Gaps = 2/109 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQ-GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +T+TE A  +I +++    G  +  +RI +  GGC+G  Y + L  +N  + D ++   G
Sbjct: 10  LTVTERAAKKIAQLIEQEGGSDKMALRIYITGGGCSGYRYGMAL-DENVYEDDVVVNAHG 68

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           VKV +DS S  ++ G+EID+  + + SGF  +NPN VS+CGCGQS  +K
Sbjct: 69  VKVVVDSFSAPFLEGSEIDYIEDVMGSGFAINNPNVVSSCGCGQSFNLK 117


>gi|289663135|ref|ZP_06484716.1| putative iron-sulfur cluster assembly accessory protein
           [Xanthomonas campestris pv. vasculorum NCPPB702]
 gi|289669571|ref|ZP_06490646.1| putative iron-sulfur cluster assembly accessory protein
           [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 112

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T AA+ R++  V  + G A G+R  + K GC+G  ++ DL  +   D D + E+ GV
Sbjct: 3   VSLTPAALERVQRFVQQTPG-ALGLRFGVTKTGCSGWGHVTDLAREA-RDDDAVFEQGGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++D  SL  + GT IDF    L   F F NPN  + CGCG+S
Sbjct: 61  RIFVDPTSLPLVDGTCIDFGKHGLSETFTFSNPNATAECGCGES 104


>gi|126739461|ref|ZP_01755154.1| Iron-sulfur cluster assembly family protein [Roseobacter sp.
           SK209-2-6]
 gi|126719561|gb|EBA16270.1| Iron-sulfur cluster assembly family protein [Roseobacter sp.
           SK209-2-6]
          Length = 107

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (60%), Gaps = 4/102 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +TE A  R+ EI   +QG+A  +RI+++ GGC+G +Y + L  D P + D ++E  G KV
Sbjct: 7   VTERAFARLNEIGAATQGQA--LRIAVEGGGCSGFQYEIAL--DAPKEDDLVLEGQGEKV 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            +DS SL ++    IDF  E + + F   NPN  S+CGCG S
Sbjct: 63  VVDSISLPFLENAVIDFTEELIGARFTIENPNASSSCGCGTS 104


>gi|70727012|ref|YP_253926.1| hypothetical protein SH2011 [Staphylococcus haemolyticus JCSC1435]
 gi|68447736|dbj|BAE05320.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 119

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 64/109 (58%), Gaps = 1/109 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TEAA Y +K+++ ++  +   ++I +  GGC GL Y +    + P + D+++E  G+
Sbjct: 4   VTLTEAAAYEVKDMLKSNDMEGGYLKIKVNGGGCTGLTYGMS-AEEQPGENDEVLEFYGL 62

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
           KV +D   +  + GT IDFK   +  GF   NPN +++CGCG S    +
Sbjct: 63  KVLVDKYDVPVLNGTTIDFKQSLMGGGFQIDNPNAIASCGCGSSFRTAK 111


>gi|325108418|ref|YP_004269486.1| iron-sulfur cluster assembly accessory protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324968686|gb|ADY59464.1| iron-sulfur cluster assembly accessory protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 110

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/110 (40%), Positives = 64/110 (58%), Gaps = 7/110 (6%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQG--IRISLKKGGCAGLEYMVDLVTDNPVDG--DDLIE 60
           VT+TE A   IK  V   Q K +   +RI ++ GGC+G +Y  +L  D+  D   D++ E
Sbjct: 3   VTVTEKAANEIKR-VLGEQAKPETTVLRIGVRAGGCSGFQY--NLALDDQFDAAKDEVSE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           + GVKV +D  S+LY+ GT +D+       GF F NPN V +CGCG S +
Sbjct: 60  QHGVKVAVDKKSMLYLDGTVVDYYDGLEKRGFSFENPNVVKSCGCGSSFQ 109


>gi|254469574|ref|ZP_05082979.1| iron-sulfur cluster assembly accessory protein [Pseudovibrio sp.
           JE062]
 gi|211961409|gb|EEA96604.1| iron-sulfur cluster assembly accessory protein [Pseudovibrio sp.
           JE062]
          Length = 113

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 62/109 (56%), Gaps = 2/109 (1%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           + V +T+ A  R+ +I+   +     +RIS++ GGC+G +Y  D+V +   D D ++ K 
Sbjct: 7   NTVGLTDKAAKRVAQIL-EKEADGSMLRISVEGGGCSGFQYKYDIVEEQE-DDDLVLAKL 64

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G  V IDS SL YM G+EIDF T+ +   F   NP   + CGCG S  I
Sbjct: 65  GATVLIDSISLQYMAGSEIDFVTDLMGQSFQITNPQAAAGCGCGTSFSI 113


>gi|75906428|ref|YP_320724.1| HesB/YadR/YfhF protein [Anabaena variabilis ATCC 29413]
 gi|75700153|gb|ABA19829.1| HesB/YadR/YfhF [Anabaena variabilis ATCC 29413]
          Length = 118

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV-DGDDLIEKDG 63
           + ++EAA+ ++K +    QG+   +R+ +++GGC+G+ YM+D   ++ +   D++ + DG
Sbjct: 12  ILLSEAALRQVKSLQ-EKQGQDLCLRVGVRQGGCSGMSYMMDFEQESKITPQDEVFDYDG 70

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            K+  D  S+LY+ G  +D+    +  GF F NPN    CGCG+S  +
Sbjct: 71  FKIVCDRKSILYLYGLMLDYSDAMIGGGFQFTNPNATQTCGCGKSFGV 118


>gi|254475864|ref|ZP_05089250.1| HesB/YadR/YfhF [Ruegeria sp. R11]
 gi|214030107|gb|EEB70942.1| HesB/YadR/YfhF [Ruegeria sp. R11]
          Length = 107

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 60/102 (58%), Gaps = 4/102 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +TE A  R+ EI    QGKA  +R++++ GGC+G +Y + L  D P   D ++E  G KV
Sbjct: 7   VTERAFARLAEIGAADQGKA--LRVAVEGGGCSGFQYEIAL--DAPQSDDLVLEGQGEKV 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            +D  SL ++    IDF  E + + FV  NPN  S+CGCG S
Sbjct: 63  VVDEVSLPFLENAVIDFTEELIGARFVIENPNATSSCGCGTS 104


>gi|163786780|ref|ZP_02181228.1| hypothetical protein FBALC1_16382 [Flavobacteriales bacterium
           ALC-1]
 gi|159878640|gb|EDP72696.1| hypothetical protein FBALC1_16382 [Flavobacteriales bacterium
           ALC-1]
          Length = 109

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 3/84 (3%)

Query: 29  IRISLKKGGCAGLEYMVDLVTDN-PVDGDDLIEKDGVKVWIDSASLLYMLGTEIDFKTEK 87
           +R+ +K GGC+GL Y  DL  DN  V+GD + E +GVK+ +D  S LY++GT +++    
Sbjct: 28  VRVGVKSGGCSGLSY--DLKFDNDQVEGDKVFEDNGVKIIVDKKSFLYLIGTTLEYSGGL 85

Query: 88  LYSGFVFHNPNQVSACGCGQSVEI 111
             +GFVF+NPN    CGCG+S  +
Sbjct: 86  NGTGFVFNNPNANRTCGCGESFSL 109


>gi|57335909|emb|CAH25356.1| hypothetical protein [Guillardia theta]
          Length = 211

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 64/106 (60%), Gaps = 1/106 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEKD 62
           I+ +T+ A+ +I+++  N   +   +R+ ++ GGC+G+ Y+++      VD  D  ++ +
Sbjct: 103 IIRLTQPAISQIQKLRTNRGEQEVVLRVGVRAGGCSGMSYVMEFEDAKNVDESDTELKFE 162

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           G +V +D  SL+++ G E+D+    +  GF F NPN  S CGCGQS
Sbjct: 163 GFRVVVDPKSLMFIFGMELDYSDALIGGGFKFSNPNAASTCGCGQS 208


>gi|88704557|ref|ZP_01102270.1| HesB/YadR/YfhF family protein [Congregibacter litoralis KT71]
 gi|88700878|gb|EAQ97984.1| HesB/YadR/YfhF family protein [Congregibacter litoralis KT71]
          Length = 117

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 62/109 (56%), Gaps = 1/109 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           + +T+++ AV +++E+V   +  A  +R+ +  GGC+G +Y      D   D D  IE++
Sbjct: 10  NAITLSDRAVNKVRELVSEEENTALKLRVFITGGGCSGFQYGFSFDEDAAED-DTTIERE 68

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GV V +D  S  Y+ G+E+D+      S F+ +NPN  + CGCG S  +
Sbjct: 69  GVTVLVDPMSFPYLAGSEVDYSEGLEGSRFIVNNPNASTTCGCGASFSV 117


>gi|284929183|ref|YP_003421705.1| Iron-sulfur cluster assembly accessory protein [cyanobacterium
           UCYN-A]
 gi|284809631|gb|ACJ53715.2| Iron-sulfur cluster assembly accessory protein [cyanobacterium
           UCYN-A]
          Length = 118

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 1/104 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE A  R++  +     K  GIR+ +K GGC G EY ++LV   P + D    ++ +
Sbjct: 3   VTLTEKATIRLQSFLKKQSNKVSGIRVGVKDGGCNGYEYTLNLV-GKPNEKDVCFNQNNI 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            +++D  ++  + G  IDF      SGF+F NPN    C CG+S
Sbjct: 62  SIYVDPNNISLLEGVVIDFVDSLTKSGFIFTNPNATGTCDCGKS 105


>gi|166711571|ref|ZP_02242778.1| hypothetical protein Xoryp_08945 [Xanthomonas oryzae pv. oryzicola
           BLS256]
 gi|188576347|ref|YP_001913276.1| HesB protein family [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188520799|gb|ACD58744.1| HesB protein family [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 112

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T AA+ R++  V  + G A G+R  + K GC+G  ++ DL  +   D D + E+ GV
Sbjct: 3   VSLTPAALERVQRFVQQTPG-ALGLRFGVTKTGCSGWGHITDLAREA-RDDDAVFEQGGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++D  SL  + GT IDF    L   F F NPN  + CGCG+S
Sbjct: 61  RIFVDPVSLPLVDGTCIDFGKHGLSETFTFSNPNATAECGCGES 104


>gi|119605300|gb|EAW84894.1| hCG2041197 [Homo sapiens]
          Length = 130

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV ++K+++ +S+ +  G+++ ++   C GL Y ++  T    D D+ + +DGV
Sbjct: 25  LTLTPSAVTKVKQLLKDSKPELVGVKVGVQTRVCNGLSYTLEY-TKTKGDSDEEVIQDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I   + L +LG E+D+  +KL S FVF+NPN    CGC +S  I
Sbjct: 84  RVFIKKKAKLTVLGAEMDYVEDKLSSEFVFNNPNIKGTCGCRESFNI 130


>gi|240140133|ref|YP_002964610.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           extorquens AM1]
 gi|240010107|gb|ACS41333.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           extorquens AM1]
          Length = 108

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 63/112 (56%), Gaps = 5/112 (4%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-I 59
           M+DI  +T  A  RI EI+ +++     +RIS+  GGC+G  Y  D+ +    +GDD+ I
Sbjct: 1   MADI-NLTARAAKRINEIM-SAEPPGSSLRISVNGGGCSGFSYAFDITSAR--EGDDVVI 56

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           E+DG  V +D  SL YM G  IDF  + +   F   NP   ++CGCG S  I
Sbjct: 57  ERDGATVLVDPVSLEYMGGATIDFVNDLIGQSFKIENPLATASCGCGTSFAI 108


>gi|17229877|ref|NP_486425.1| hypothetical protein alr2385 [Nostoc sp. PCC 7120]
 gi|17131477|dbj|BAB74084.1| alr2385 [Nostoc sp. PCC 7120]
          Length = 118

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV-DGDDLIEKDG 63
           + ++EAA+ ++K +    QG+   +R+ +++GGC+G+ YM+D   ++ +   D++ + DG
Sbjct: 12  ILLSEAALRQVKSLQ-EKQGQDLCLRVGVRQGGCSGMSYMMDFEQESQITPQDEVFDYDG 70

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            K+  D  S+LY+ G  +D+    +  GF F NPN    CGCG+S  +
Sbjct: 71  FKIVCDRKSILYLYGLMLDYSDAMIGGGFQFTNPNATQTCGCGKSFGV 118


>gi|83952170|ref|ZP_00960902.1| Iron-sulfur cluster assembly family protein [Roseovarius
           nubinhibens ISM]
 gi|83837176|gb|EAP76473.1| Iron-sulfur cluster assembly family protein [Roseovarius
           nubinhibens ISM]
          Length = 107

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (60%), Gaps = 4/105 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T+ A  R+ EI   +QG+A  +R++++ GGC+G +Y + L  D P   D ++E  G +V
Sbjct: 7   VTDRAFERLAEIGAGAQGQA--LRVAVEGGGCSGFQYEIKL--DAPEADDLVLEGQGERV 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D+ SL ++ G  IDF  E + + F+  NPN  S+CGCG S  +
Sbjct: 63  VVDAVSLPFLTGATIDFTEELIGARFIIDNPNASSSCGCGTSFSM 107


>gi|85059409|ref|YP_455111.1| iron-sulfur cluster assembly scaffold protein [Sodalis glossinidius
           str. 'morsitans']
 gi|84779929|dbj|BAE74706.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 124

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 65/104 (62%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T++A ++I  +V  S     G+R+S+K+ GCAG  Y+V+  T    D D + E DGV
Sbjct: 20  LTITDSAAHQILRLV-ESDPTMLGLRLSVKQSGCAGFGYVVEKATQTD-DSDRVYEHDGV 77

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+++   ++ ++ GTE+D+  E L   F F+NP    ACGCG+S
Sbjct: 78  KLYVPLKAMPFIDGTELDYVQEGLNHVFKFNNPKAQHACGCGES 121


>gi|330251436|gb|AEC06530.1| Iron-sulfur assembly protein IscA-like 1 [Arabidopsis thaliana]
          Length = 143

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 66/111 (59%), Gaps = 7/111 (6%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLV-----TDNPVDGDD 57
            ++T+T+ A  R+  ++   Q +   +R+ +K  GC GL Y ++        D     D+
Sbjct: 21  QVLTLTDEAASRVHHLL--QQRQKPFLRLGVKARGCNGLSYTLNYAGKTSGNDEKGKFDE 78

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           L+E+ GV++ ++  +L++++GT++DF  +KL S FVF NPN    CGCG+S
Sbjct: 79  LVEEKGVRILVEPKALMHVIGTKMDFVDDKLRSEFVFINPNSQGQCGCGES 129


>gi|186681025|ref|YP_001864221.1| iron-sulfur cluster assembly accessory protein [Nostoc punctiforme
           PCC 73102]
 gi|186463477|gb|ACC79278.1| iron-sulfur cluster assembly accessory protein [Nostoc punctiforme
           PCC 73102]
          Length = 118

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLV-TDNPVDGDDLIEKDG 63
           + ++EAA++++K +  + QG    +R+ +++GGC+G+ YM+D   T      D++ + DG
Sbjct: 12  ILLSEAALHQVKSLR-DKQGTDFCLRVGVRQGGCSGMSYMMDFEDTSKITPQDEVFDYDG 70

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            K+  D  SLLY+ G  +D+    +  GF F NPN    CGCG+S  +
Sbjct: 71  FKIVSDRKSLLYLYGLMLDYSDAMIGGGFQFTNPNANQTCGCGKSFGV 118


>gi|284006305|emb|CBA71541.1| iron-sulfur cluster assembly scaffold protein [Arsenophonus
           nasoniae]
          Length = 126

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT+ A  +I++++      +QG+ +++K+ GCAG  Y++ L+ DNP     L E +G 
Sbjct: 22  LTMTDKAAAQIRKLM-KKNPDSQGLSLNIKQSGCAGFGYVIALI-DNPTKEYLLFENNGA 79

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++   ++ ++ GTE+D+  E L   F F+NP    ACGCG+S  I
Sbjct: 80  KLFVPLKAMPFIDGTEVDYVREGLNQVFKFNNPKAQHACGCGESFGI 126


>gi|15839151|ref|NP_299839.1| hypothetical protein XF2562 [Xylella fastidiosa 9a5c]
 gi|28199813|ref|NP_780127.1| hypothetical protein PD1946 [Xylella fastidiosa Temecula1]
 gi|71275197|ref|ZP_00651484.1| HesB/YadR/YfhF [Xylella fastidiosa Dixon]
 gi|71898277|ref|ZP_00680451.1| HesB/YadR/YfhF [Xylella fastidiosa Ann-1]
 gi|71899835|ref|ZP_00681985.1| HesB/YadR/YfhF [Xylella fastidiosa Ann-1]
 gi|170731188|ref|YP_001776621.1| hypothetical protein Xfasm12_2134 [Xylella fastidiosa M12]
 gi|182682565|ref|YP_001830725.1| iron-sulfur cluster assembly accessory protein [Xylella fastidiosa
           M23]
 gi|9107776|gb|AAF85359.1|AE004064_1 conserved hypothetical protein [Xylella fastidiosa 9a5c]
 gi|28057934|gb|AAO29776.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|71164006|gb|EAO13721.1| HesB/YadR/YfhF [Xylella fastidiosa Dixon]
 gi|71730426|gb|EAO32507.1| HesB/YadR/YfhF [Xylella fastidiosa Ann-1]
 gi|71732016|gb|EAO34073.1| HesB/YadR/YfhF [Xylella fastidiosa Ann-1]
 gi|167965981|gb|ACA12991.1| conserved hypothetical protein [Xylella fastidiosa M12]
 gi|182632675|gb|ACB93451.1| iron-sulfur cluster assembly accessory protein [Xylella fastidiosa
           M23]
 gi|307578845|gb|ADN62814.1| iron-sulfur cluster assembly accessory protein [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 112

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 60/104 (57%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T  A+ R++  +  + G   G+R  + + GC+G  +  DL  +   +GD + E+DGV
Sbjct: 3   VTLTPVALDRVRRFIQQTPGTL-GLRFGVTRTGCSGWGHFTDLACEQR-EGDSVFEQDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++D+ SL  + GT IDF    L   F F NPN    CGCG+S
Sbjct: 61  RIFVDAHSLPLVDGTCIDFSKRGLSETFTFVNPNAAVECGCGES 104


>gi|90417482|ref|ZP_01225405.1| probable iron-binding protein IscA [marine gamma proteobacterium
           HTCC2207]
 gi|90330723|gb|EAS46002.1| probable iron-binding protein IscA [marine gamma proteobacterium
           HTCC2207]
          Length = 107

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 63/108 (58%), Gaps = 4/108 (3%)

Query: 5   VTMTEAA-VYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +TMT AA  + IK +   S+G   G+R+ ++  GC+GL Y+++ V     + D +     
Sbjct: 3   ITMTAAAEQHVIKHLAHRSKG--VGVRLGVRTTGCSGLSYVLEFVDSTEAE-DAVFTCGD 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VK+ ID  SLLY+ GTE+D+  E L  GF F NPN    CGCG+S  I
Sbjct: 60  VKLVIDPKSLLYLDGTELDYVKEGLNEGFEFKNPNVKDECGCGESFHI 107


>gi|116073905|ref|ZP_01471167.1| HesB/YadR/YfhF [Synechococcus sp. RS9916]
 gi|116069210|gb|EAU74962.1| HesB/YadR/YfhF [Synechococcus sp. RS9916]
          Length = 143

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 65/113 (57%), Gaps = 7/113 (6%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV-DGD---DLIE 60
           + +T+ A+ ++ ++    QG++Q +R+ ++ GGC+G+ Y +D V  + + DGD   D   
Sbjct: 32  IQITDPAMQQLAKLC-REQGESQVLRVGVRSGGCSGMSYTMDFVPSSEIEDGDEVYDYTA 90

Query: 61  KDGV--KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            DG   +V  D  SLLY+ G ++DF T  +  GF F NPN    CGCG S  +
Sbjct: 91  PDGADFQVVCDPKSLLYIYGMQLDFSTALIGGGFNFTNPNASQTCGCGSSFAV 143


>gi|34496547|ref|NP_900762.1| HesB-like protein [Chromobacterium violaceum ATCC 12472]
 gi|34102401|gb|AAQ58767.1| probable HesB-like protein [Chromobacterium violaceum ATCC 12472]
          Length = 107

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++E A   +   +   +GK  G+R+ +K  GC+G+ Y ++ V     D D   E  GV
Sbjct: 3   LTLSERAAQHVGAFL-AKRGKGLGVRLGVKTSGCSGMAYKLEFVDVESSD-DVRFESYGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            ++ D+ SL Y+ GTE+D+  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  AIYTDAKSLAYIDGTELDYVKEGLNEGFRFNNPNVKNECGCGESFNV 107


>gi|58582040|ref|YP_201056.1| hypothetical protein XOO2417 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58426634|gb|AAW75671.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 148

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T AA+ R++  V  + G A G+R  + K GC+G  ++ DL  +   D D + E+ GV
Sbjct: 39  VSLTPAALERVQRFVQQTPG-ALGLRFGVTKTGCSGWGHITDLAREA-RDDDAVFEQGGV 96

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++D  SL  + GT IDF    L   F F NPN  + CGCG+S
Sbjct: 97  RIFVDPVSLPLVDGTCIDFGKHGLSETFTFSNPNATAECGCGES 140


>gi|254450350|ref|ZP_05063787.1| HesB/YadR/YfhF [Octadecabacter antarcticus 238]
 gi|198264756|gb|EDY89026.1| HesB/YadR/YfhF [Octadecabacter antarcticus 238]
          Length = 108

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 63/105 (60%), Gaps = 4/105 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A  R+ EI  N+ GKA  +RI+++ GGC+G +Y ++L  D   D D ++E  G KV
Sbjct: 8   VTPRAFERLLEIGANADGKA--LRIAVEGGGCSGFQYEINL--DEAKDDDLVLEGSGQKV 63

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IDS SL ++    IDF  E + + FV  NPN  S+CGCG S  +
Sbjct: 64  VIDSISLPFLSDATIDFTEELIGARFVIENPNASSSCGCGVSFSM 108


>gi|124024903|ref|YP_001014019.1| hypothetical protein NATL1_01901 [Prochlorococcus marinus str.
           NATL1A]
 gi|123959971|gb|ABM74754.1| Uncharacterized conserved protein [Prochlorococcus marinus str.
           NATL1A]
          Length = 129

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 63/112 (56%), Gaps = 6/112 (5%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T  A+ ++  +    QG  + +R+ ++ GGC+G+ Y +D V+D+ +  DD + +  V
Sbjct: 19  VLITTPALDQLSRLC-KEQGSGKLLRVGVRSGGCSGMSYTMDFVSDDDIQKDDEVYEYSV 77

Query: 65  -----KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
                KV  D  SLLY+ G ++DF T+ +  GF F NPN    CGCG S  +
Sbjct: 78  GSSSFKVICDPKSLLYIYGMQLDFSTDLIGGGFNFTNPNASQTCGCGSSFAV 129


>gi|126665738|ref|ZP_01736719.1| hypothetical protein MELB17_04197 [Marinobacter sp. ELB17]
 gi|126629672|gb|EBA00289.1| hypothetical protein MELB17_04197 [Marinobacter sp. ELB17]
          Length = 117

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMT +A+  +++ + + + +A GIR+++KK GC+G +Y    V ++  D D +   DGV
Sbjct: 12  VTMTPSAIKHVRKQL-DKKPEALGIRLAIKKSGCSGFKYETQWVEESGSD-DRIFHIDGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +++    +  + G EIDF TE + S F F NPN  + CGCG+S  +
Sbjct: 70  DLFVKDEHMSLVNGIEIDFVTEGVNSTFEFRNPNATAECGCGESFTV 116


>gi|1170246|sp|P46053|HESB_PLEBO RecName: Full=Protein hesB
 gi|437897|emb|CAA50697.1| hesB [Leptolyngbya sp. PCC 73110]
          Length = 121

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 64/112 (57%), Gaps = 11/112 (9%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKA-----QGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           VT+TE A  R++  +   QG A     +GIR+ +  GGC+G +Y +D+   N    DD+I
Sbjct: 3   VTLTERAELRLRAFL---QGTANPTDTKGIRVGVSDGGCSGYQYTLDIA--NEPKPDDVI 57

Query: 60  EKDG-VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           E+ G VK++ID  +   + G  +DF    + SGF F NPN    CGCGQS +
Sbjct: 58  EQQGRVKIYIDPQAAALINGVVVDFVEGLMDSGFKFSNPNATDTCGCGQSFQ 109


>gi|254431225|ref|ZP_05044928.1| HesB/YadR/YfhF [Cyanobium sp. PCC 7001]
 gi|197625678|gb|EDY38237.1| HesB/YadR/YfhF [Cyanobium sp. PCC 7001]
          Length = 141

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 65/113 (57%), Gaps = 7/113 (6%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD---LIEK 61
           + +TE A+ ++  ++ + QG+ + +R+ ++ GGC+G+ Y +D ++ + +  DD     E 
Sbjct: 30  ILITEPAMKQLGALI-SQQGEGRVLRVGVRSGGCSGMSYTMDFISADAIRADDEQYTYEP 88

Query: 62  DGV---KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DG    +V  D  SLLY+ G ++DF +  +  GF F NPN    CGCG S  +
Sbjct: 89  DGAPSFRVVCDPKSLLYIYGMQLDFSSALIGGGFNFTNPNASQTCGCGSSFAV 141


>gi|332558976|ref|ZP_08413298.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides WS8N]
 gi|332276688|gb|EGJ22003.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides WS8N]
          Length = 106

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 64/107 (59%), Gaps = 5/107 (4%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDL-VTDNPVDGDDLIEK- 61
           ++ +T AA   IK  +  +     G+R+ ++ GGCAGL+Y + L +T+ P   DDL+ K 
Sbjct: 1   MIQITPAAQAAIKGAIEGAGQPVAGLRLMVQSGGCAGLKYGMSLELTEAP---DDLVVKA 57

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +G++V ID  S  Y+ G  IDF T    +GFVF NPN    CGCG+S
Sbjct: 58  EGLRVLIDPQSGTYLNGVTIDFVTSLEGTGFVFDNPNAKGGCGCGKS 104


>gi|72383321|ref|YP_292676.1| hypothetical protein PMN2A_1485 [Prochlorococcus marinus str.
           NATL2A]
 gi|72003171|gb|AAZ58973.1| HesB/YadR/YfhF [Prochlorococcus marinus str. NATL2A]
          Length = 129

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 63/112 (56%), Gaps = 6/112 (5%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T  A+ ++  +    QG  + +R+ ++ GGC+G+ Y +D V+D+ +  DD + +  V
Sbjct: 19  VLITTPALDQLSRLC-KEQGSGKLLRVGVRSGGCSGMSYTMDFVSDDDIQKDDEVYEYSV 77

Query: 65  -----KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
                KV  D  SLLY+ G ++DF T+ +  GF F NPN    CGCG S  +
Sbjct: 78  GTSSFKVICDPKSLLYIYGMQLDFSTDLIGGGFNFTNPNASQTCGCGSSFAV 129


>gi|220935574|ref|YP_002514473.1| iron-sulfur cluster insertion protein ErpA [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219996884|gb|ACL73486.1| iron-sulfur cluster insertion protein ErpA [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 120

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 61/112 (54%), Gaps = 3/112 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++K ++      A  +R+ +  GGC+G +Y      +N  DGD ++E
Sbjct: 11  MPSPLIFTDSAASKVKSLIEEENNNALKLRVFVSGGGCSGFQYGFTF-DENVNDGDTVVE 69

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSG-FVFHNPNQVSACGCGQSVEI 111
           K GV + ID  S  Y++G EID+ TE L    FV  NPN  + CGCG S  +
Sbjct: 70  KGGVTLLIDPMSFQYLMGAEIDY-TEGLEGAQFVIRNPNATTTCGCGSSFSV 120


>gi|163746498|ref|ZP_02153856.1| FeS cluster assembly HesB family protein, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161380383|gb|EDQ04794.1| FeS cluster assembly HesB family protein, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 113

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 60/102 (58%), Gaps = 4/102 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  A  R+ EI    +GKA  +RI+++ GGC+G +Y + L  D P + D ++E  G KV
Sbjct: 13  VTPRAFERLAEIGAAEEGKA--LRIAVEGGGCSGFQYEIAL--DAPAEDDLVLEGSGQKV 68

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            +DS SL ++    IDF  E + + F   NPN  +ACGCG S
Sbjct: 69  VVDSVSLPFLADAVIDFTEELIGARFTIENPNATAACGCGTS 110


>gi|256422371|ref|YP_003123024.1| iron-sulfur cluster assembly accessory protein [Chitinophaga
           pinensis DSM 2588]
 gi|256037279|gb|ACU60823.1| iron-sulfur cluster assembly accessory protein [Chitinophaga
           pinensis DSM 2588]
          Length = 109

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 61/109 (55%), Gaps = 1/109 (0%)

Query: 4   IVTMTEAAVYRIKEI-VFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++T++E A   IK++ V  +      +R+ +K GGC+GLEY++   +    +GD   E  
Sbjct: 1   MITVSEKAGEYIKDLMVKENHAPGTFVRVGVKGGGCSGLEYVLKFESSEHEEGDQTFEDK 60

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVK+ +   SLLY+ GTE+D+       G  F+NPN    C CG+S  +
Sbjct: 61  GVKIVVQMKSLLYLYGTELDYSDGLNGKGLYFNNPNATRTCSCGESFAV 109


>gi|310814722|ref|YP_003962686.1| Iron-sulfur cluster assembly family protein [Ketogulonicigenium
           vulgare Y25]
 gi|308753457|gb|ADO41386.1| Iron-sulfur cluster assembly family protein [Ketogulonicigenium
           vulgare Y25]
          Length = 108

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 63/107 (58%), Gaps = 6/107 (5%)

Query: 6   TMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKDGV 64
           T+T  A  R+ +I    QGKA  +R++++ GGC+G +Y + L  D P  GDDL+ E  G 
Sbjct: 7   TVTPRAFERLAQIGAAKQGKA--LRVAVEGGGCSGFQYQITL--DAP-QGDDLVLEGAGE 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL ++   +IDF    + + FV  NPN  ++CGCG S  I
Sbjct: 62  KVVVDQVSLPFLASAQIDFSDALIGARFVIENPNASTSCGCGTSFSI 108


>gi|163852806|ref|YP_001640849.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           extorquens PA1]
 gi|218531632|ref|YP_002422448.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           chloromethanicum CM4]
 gi|254562571|ref|YP_003069666.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           extorquens DM4]
 gi|163664411|gb|ABY31778.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           extorquens PA1]
 gi|218523935|gb|ACK84520.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           chloromethanicum CM4]
 gi|254269849|emb|CAX25827.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           extorquens DM4]
          Length = 108

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 62/112 (55%), Gaps = 5/112 (4%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-I 59
           M+DI  +T  A  RI EI+  ++     +RIS+  GGC+G  Y  D+ +    +GDD+ I
Sbjct: 1   MADI-NLTARAAKRINEIM-GAEPPGSSLRISVNGGGCSGFSYAFDITSAR--EGDDVVI 56

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           E+DG  V +D  SL YM G  IDF  + +   F   NP   ++CGCG S  I
Sbjct: 57  ERDGATVLVDPVSLEYMGGATIDFVNDLIGQSFKIENPLATASCGCGTSFAI 108


>gi|332286789|ref|YP_004418700.1| iron-sulfur cluster insertion protein ErpA [Pusillimonas sp. T7-7]
 gi|330430742|gb|AEC22076.1| iron-sulfur cluster insertion protein ErpA [Pusillimonas sp. T7-7]
          Length = 122

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 62/103 (60%), Gaps = 3/103 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEKDGVK 65
            T+AA +++KE++ +       +R+ ++ GGC+G +Y      D  ++ DD  I+K+GV+
Sbjct: 19  FTDAAAHKVKELLADEDNPELKLRVFVQGGGCSGFQY--GFTFDETINDDDTTIDKEGVQ 76

Query: 66  VWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           + +D  S  Y++G EID+K +   + FV  NPN  S CGCG S
Sbjct: 77  LLVDPMSFQYLVGAEIDYKDDLEGAQFVIRNPNANSTCGCGSS 119


>gi|119509122|ref|ZP_01628273.1| HesB/YadR/YfhF-like protein [Nodularia spumigena CCY9414]
 gi|119466288|gb|EAW47174.1| HesB/YadR/YfhF-like protein [Nodularia spumigena CCY9414]
          Length = 118

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 62/108 (57%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLV-TDNPVDGDDLIEKDG 63
           + ++E+A+ ++K +    QG    +R+ +++GGC+G+ YM+D   T      D++ + DG
Sbjct: 12  ILLSESALLQVKSLQ-QKQGNELCLRVGVRQGGCSGMSYMMDFEDTSKITPQDEVFDYDG 70

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            K+  D  SLLY+ G  +D+    +  GF F NPN    CGCG+S  +
Sbjct: 71  FKIVCDGKSLLYLYGLMLDYSDAMIGGGFQFTNPNAAQTCGCGKSFGV 118


>gi|148555821|ref|YP_001263403.1| iron-sulfur cluster assembly accessory protein [Sphingomonas
           wittichii RW1]
 gi|148501011|gb|ABQ69265.1| iron-sulfur cluster assembly accessory protein [Sphingomonas
           wittichii RW1]
          Length = 124

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 56/87 (64%), Gaps = 3/87 (3%)

Query: 26  AQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDGVKVWIDSASLLYMLGTEIDFK 84
           A G+++S  + GC+GL Y VD VT+ +P D  + IE  G   ++D  SLLY++G+ +D+ 
Sbjct: 40  AIGVKLSTPRRGCSGLAYSVDYVTEADPFD--ERIETPGGTFYVDGGSLLYLIGSTMDWV 97

Query: 85  TEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +   +GFVF NPN   +CGCG+S  +
Sbjct: 98  EDDFTAGFVFANPNAKGSCGCGESFTV 124


>gi|296536715|ref|ZP_06898775.1| iron-sulfur cluster assembly protein IscA [Roseomonas cervicalis
           ATCC 49957]
 gi|296262946|gb|EFH09511.1| iron-sulfur cluster assembly protein IscA [Roseomonas cervicalis
           ATCC 49957]
          Length = 121

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 65/106 (61%), Gaps = 4/106 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLV-TDNPVDGDDLIEKDGVK 65
           ++EAA  R++ +    Q + + +R+++   GC+G+ Y  DL   D P  GD+++   GV 
Sbjct: 19  LSEAAAERLRGLYAKGQ-EGKLLRVAVSTKGCSGMAY--DLTWADAPGPGDEVVTDKGVT 75

Query: 66  VWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V +D  + L+++GT +D++ + + +GF F NPN+   CGCG+S  +
Sbjct: 76  VLVDRKATLFLIGTTMDYEVKAMSAGFTFTNPNEKGRCGCGESFHV 121


>gi|83858690|ref|ZP_00952212.1| hypothetical protein OA2633_04286 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853513|gb|EAP91365.1| hypothetical protein OA2633_04286 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 113

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 9/110 (8%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQG---IRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           ++++ +A  +I EI      KAQG   +R+S++ GGC+G  Y  DL TD   + D  IE+
Sbjct: 10  ISLSPSAAAQINEIT-----KAQGSRYLRLSVEGGGCSGFSYKYDL-TDEAREDDLRIER 63

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DG  V ID  S+ ++ G+ ID+  E + + F   NPN  +ACGCG S  I
Sbjct: 64  DGATVLIDPMSVEFLSGSVIDYVDELIGASFQIKNPNATAACGCGTSFSI 113


>gi|126725253|ref|ZP_01741095.1| HesB/YadR/YfhF-like protein [Rhodobacterales bacterium HTCC2150]
 gi|126704457|gb|EBA03548.1| HesB/YadR/YfhF-like protein [Rhodobacterales bacterium HTCC2150]
          Length = 109

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (61%), Gaps = 7/104 (6%)

Query: 7   MTEAAVYRIKEIVFNSQG--KAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+AA  R+ EI   ++G    Q +R++++ GGC+G +Y + L  D+  + D ++ KDG 
Sbjct: 8   VTDAAFARLAEI---NEGVDAVQVLRVAVEGGGCSGFQYEIKL--DDAAEDDLILSKDGQ 62

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            V +DS SL ++    IDFK E + + FV  NPN  S+CGCG S
Sbjct: 63  SVAVDSVSLPFLANAVIDFKEELIGARFVIENPNATSSCGCGTS 106


>gi|148240561|ref|YP_001225948.1| hypothetical protein SynWH7803_2225 [Synechococcus sp. WH 7803]
 gi|147849100|emb|CAK24651.1| Conserved hypothetical protein [Synechococcus sp. WH 7803]
          Length = 130

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 62/113 (54%), Gaps = 7/113 (6%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD----LIE 60
           + +TE A+ ++ ++  + QG  Q +R+ ++ GGC+G+ Y +D V  +    DD     + 
Sbjct: 19  ILITEPAMQQLAKLC-SEQGDNQVLRVGVRSGGCSGMSYTMDFVPASDTQSDDESYEYVA 77

Query: 61  KDG--VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            DG   +V  D  SLLY+ G ++DF T  +  GF F NPN    CGCG S  +
Sbjct: 78  SDGQSFRVICDPKSLLYIYGMQLDFSTALIGGGFNFTNPNATQTCGCGSSFAV 130


>gi|37521674|ref|NP_925051.1| hypothetical protein gvip289 [Gloeobacter violaceus PCC 7421]
 gi|35212672|dbj|BAC90046.1| ycf57 [Gloeobacter violaceus PCC 7421]
          Length = 116

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 61/105 (58%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A+  ++ +   S    Q +R+ +   GC+G+ Y +   T++  D D L ++DG
Sbjct: 1   MINLTETALQEVRRLQKKSGNDRQFLRLGVVNAGCSGMSYTMKFDTESRAD-DHLFDQDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           V+V +D+ASL Y+    +D+  + +  GF FHNP+    CGCG S
Sbjct: 60  VRVAVDAASLPYLGELTLDWSGDLMGGGFRFHNPSATHTCGCGSS 104


>gi|150396375|ref|YP_001326842.1| iron-sulfur cluster assembly accessory protein [Sinorhizobium
           medicae WSM419]
 gi|150027890|gb|ABR60007.1| iron-sulfur cluster assembly accessory protein [Sinorhizobium
           medicae WSM419]
          Length = 109

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 69/112 (61%), Gaps = 4/112 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI- 59
           M + VT+++AA  RI  I+   + K+  +R+S++ GGC+G  Y  DLV  +  + DDLI 
Sbjct: 1   MHETVTLSDAAARRIAAILQAEKDKS-AMRVSVEGGGCSGFSYKFDLV--DAENADDLIL 57

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           EK   KV IDS SL+YM G+EIDF    L   F   NPN V++CGCG S  +
Sbjct: 58  EKHDAKVLIDSLSLVYMGGSEIDFVDNLLGQSFQIKNPNAVASCGCGTSFSV 109


>gi|75910455|ref|YP_324751.1| HesB/YadR/YfhF protein [Anabaena variabilis ATCC 29413]
 gi|1170198|sp|P46052|HESB2_ANAVT RecName: Full=Protein hesB, vegetative
 gi|599650|emb|CAA86990.1| unknown [Anabaena variabilis ATCC 29413]
 gi|75704180|gb|ABA23856.1| HesB/YadR/YfhF [Anabaena variabilis ATCC 29413]
          Length = 123

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 66/111 (59%), Gaps = 7/111 (6%)

Query: 5   VTMTEAAVYRIKEIVF----NSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           +T+TEAA +R++  +     +     +GIR++++ GGC+G +Y + ++  N    DD++ 
Sbjct: 3   LTLTEAAEFRLRTFLLSFSKDENSTQRGIRVAVEDGGCSGYQYSIKII--NAPQADDMVL 60

Query: 61  KDG-VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           + G +++++DS S   + G  +DF    L SGF F NPN    CGCG+S +
Sbjct: 61  QQGKLRIYVDSQSAPLLEGVVVDFVDGLLESGFKFSNPNATDTCGCGKSFQ 111


>gi|71274648|ref|ZP_00650936.1| HesB/YadR/YfhF [Xylella fastidiosa Dixon]
 gi|71899639|ref|ZP_00681793.1| HesB/YadR/YfhF [Xylella fastidiosa Ann-1]
 gi|170730915|ref|YP_001776348.1| iron-sulfur cluster insertion protein ErpA [Xylella fastidiosa M12]
 gi|226694587|sp|B0U4D9|ERPA_XYLFM RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|71164380|gb|EAO14094.1| HesB/YadR/YfhF [Xylella fastidiosa Dixon]
 gi|71730591|gb|EAO32668.1| HesB/YadR/YfhF [Xylella fastidiosa Ann-1]
 gi|167965708|gb|ACA12718.1| HesB-like protein [Xylella fastidiosa M12]
          Length = 128

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T AA  +++E++         +R+ ++ GGC+G +Y  +   +N  D D ++E DGV
Sbjct: 23  LNFTMAAAAKVRELIQEENSADLALRVYIQGGGCSGFQYGFEF-DENRADDDLVLETDGV 81

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y+LG E+D+      + FV  NPN  + CGCG S  I
Sbjct: 82  VLLVDPLSLQYLLGAEVDYTESLTGAKFVIRNPNAKTTCGCGSSFSI 128


>gi|313206621|ref|YP_004045798.1| iron-sulfur cluster assembly accessory protein [Riemerella
           anatipestifer DSM 15868]
 gi|312445937|gb|ADQ82292.1| iron-sulfur cluster assembly accessory protein [Riemerella
           anatipestifer DSM 15868]
 gi|315022115|gb|EFT35144.1| probable iron binding protein from the HesB_IscA_SufA family
           [Riemerella anatipestifer RA-YM]
 gi|325335938|gb|ADZ12212.1| Fe-S cluster assembly scaffold protein [Riemerella anatipestifer
           RA-GD]
          Length = 109

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 53/84 (63%), Gaps = 3/84 (3%)

Query: 29  IRISLKKGGCAGLEYMVDLVTDNPVDG-DDLIEKDGVKVWIDSASLLYMLGTEIDFKTEK 87
           IR+ +K GGC+GLEY++    DN   G D + E +G+K+ ID  S+LY+ GT +++    
Sbjct: 28  IRVGVKSGGCSGLEYVLKF--DNQTTGTDQIFEDNGIKIVIDKKSILYLAGTTLEYSGGL 85

Query: 88  LYSGFVFHNPNQVSACGCGQSVEI 111
              GFVF+NPN    CGCG+S  +
Sbjct: 86  NGKGFVFNNPNAARTCGCGESFSL 109


>gi|67523035|ref|XP_659578.1| hypothetical protein AN1974.2 [Aspergillus nidulans FGSC A4]
 gi|40745983|gb|EAA65139.1| hypothetical protein AN1974.2 [Aspergillus nidulans FGSC A4]
          Length = 566

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 66/94 (70%), Gaps = 3/94 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T  AV ++++++  SQ + + IR+ +K  GC+GL Y ++ V D P   D+++E+DGV
Sbjct: 139 MKLTPIAVEQLRKLL--SQPEPRLIRVGVKNRGCSGLAYHLEYV-DKPGTFDEVVEQDGV 195

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPN 98
           KV IDS +L  ++G+E+D++ +KL + FVF NPN
Sbjct: 196 KVLIDSKALFSIIGSEMDWQEDKLSARFVFRNPN 229


>gi|332026999|gb|EGI67095.1| Iron-sulfur cluster assembly 1-like protein, mitochondrial
           [Acromyrmex echinatior]
          Length = 102

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 65/104 (62%), Gaps = 2/104 (1%)

Query: 8   TEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVW 67
           T  AV +IKEI+   + +  G+++ +++ GC GL Y +D   +     +++I+ D V+++
Sbjct: 1   TPNAVKKIKEIL-KDKSEYIGLKVGVRQRGCNGLSYTLDYAKEKSKLDEEVIQ-DDVRIF 58

Query: 68  IDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ID  + L +LGTE+D+   KL S F+F+NPN    CGCG+S  +
Sbjct: 59  IDRKAQLSLLGTEMDYTENKLSSEFIFNNPNIKGTCGCGESFSV 102


>gi|254786624|ref|YP_003074053.1| iron-sulfur cluster assembly accessory family protein
           [Teredinibacter turnerae T7901]
 gi|237683663|gb|ACR10927.1| iron-sulfur cluster assembly accessory family protein
           [Teredinibacter turnerae T7901]
          Length = 116

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 66/113 (58%), Gaps = 6/113 (5%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           ++D V++T AA      +     GK  GIRISLK+ GC G +Y++D V  N  DG DL  
Sbjct: 8   IADTVSVTPAAAEHF-HMRLQKSGKT-GIRISLKEAGCTGFKYVIDEV--NEGDGSDLRV 63

Query: 61  K--DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +  +GV ++ID + L  + GT+ID+  E L    V +NPN   ACGCG+S  +
Sbjct: 64  QLSNGVSLFIDGSHLSGIQGTQIDYVKEGLNRNLVLNNPNVKDACGCGESFSV 116


>gi|168012150|ref|XP_001758765.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162689902|gb|EDQ76271.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 109

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 64/105 (60%), Gaps = 2/105 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKDG 63
           + +TE A+  + ++   SQ K   +R+ +++GGC+G+ Y++D    + +  DD +I+ DG
Sbjct: 3   IMLTEKALSHLMKLK-ASQDKELCLRVGVRQGGCSGMSYVMDFEESSNLRPDDSIIDYDG 61

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            K+  D  SLL++ G ++D+    +  GF F NPN  S CGCG+S
Sbjct: 62  FKMVCDPKSLLFLFGMQLDYSDALIGGGFSFSNPNASSTCGCGKS 106


>gi|319941832|ref|ZP_08016154.1| iron-sulfur cluster assembly accessory protein [Sutterella
           wadsworthensis 3_1_45B]
 gi|319804765|gb|EFW01632.1| iron-sulfur cluster assembly accessory protein [Sutterella
           wadsworthensis 3_1_45B]
          Length = 130

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 63/112 (56%), Gaps = 3/112 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDL-VTDNPVDGDDLI 59
           M D +T T+AAV ++K ++         +R+ ++ GGCAG +Y      T N  D D ++
Sbjct: 21  MPDPITFTDAAVAKVKSLMDEEGNPDLKLRVFVQGGGCAGFQYGFTFDETQN--DDDAVM 78

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +K GV + IDS S  Y++G +ID+K       FV  NPN V+ CGCG S  +
Sbjct: 79  QKGGVTLLIDSMSYQYLVGAKIDYKEGLSGEQFVIDNPNAVTTCGCGSSFSV 130


>gi|212634531|ref|YP_002311056.1| HesB/YadR/YfhF family protein [Shewanella piezotolerans WP3]
 gi|212556015|gb|ACJ28469.1| HesB/YadR/YfhF family protein [Shewanella piezotolerans WP3]
          Length = 107

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T AA  R+K  +  S+GK  G+R+ L+  GC+G+ Y+++ V D+  D D+L + DGV
Sbjct: 3   ISITPAAAERVKSFL-ESRGKGLGLRLGLRTSGCSGMAYVLEFV-DDLNDDDELYDIDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID+ S +Y+ G E+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIIDAKSFIYLQGIELDFVKEGLNEGFQFNNPNAKGECGCGESFTV 107


>gi|92114966|ref|YP_574894.1| HesB/YadR/YfhF [Chromohalobacter salexigens DSM 3043]
 gi|91798056|gb|ABE60195.1| HesB/YadR/YfhF [Chromohalobacter salexigens DSM 3043]
          Length = 108

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + ++ AA  +I+  V   +G   G+R+++K  GC+G  Y++D + D   D D   E  GV
Sbjct: 4   IRISPAAADQIQH-VLAERGNGLGLRVAVKPSGCSGYSYVLD-IADEIGDNDVPFEDHGV 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  +L  + GTE+D+ +E L   F F+NPN    CGCG+S  +
Sbjct: 62  KVLVDKEALTILDGTEVDYVSEGLNRYFRFNNPNATDQCGCGESFNV 108


>gi|228474311|ref|ZP_04059046.1| HesB domain protein [Staphylococcus hominis SK119]
 gi|314936840|ref|ZP_07844187.1| type I restriction-modification system, R subunit [Staphylococcus
           hominis subsp. hominis C80]
 gi|228271670|gb|EEK13017.1| HesB domain protein [Staphylococcus hominis SK119]
 gi|313655459|gb|EFS19204.1| type I restriction-modification system, R subunit [Staphylococcus
           hominis subsp. hominis C80]
          Length = 119

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 63/109 (57%), Gaps = 1/109 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TEAA Y +K+++ ++  +   ++I +  GGC GL Y +    + P   D+++E  G+
Sbjct: 4   VTLTEAAAYEVKDMLKSNHMENGYLKIKVNGGGCTGLTYGMS-AEEAPGSNDEVLEYYGL 62

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
           KV +D      + GT+IDFK   +  GF   NPN +++CGCG S    +
Sbjct: 63  KVLVDKDDAPVLNGTKIDFKQSLMGGGFQIDNPNAIASCGCGSSFRTAK 111


>gi|168044859|ref|XP_001774897.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162673791|gb|EDQ60309.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 112

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 64/105 (60%), Gaps = 2/105 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKDG 63
           +T+TE A+  + ++   SQ     +R+ +++GGC+G+ Y++D    + V  DD +IE +G
Sbjct: 6   ITLTEKALSHLTKLR-ASQDNKLCLRVGVRQGGCSGMSYIMDFEEISNVRSDDSVIEYEG 64

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            K+  D  SLL++ G ++D+    +  GF F NPN  S CGCG+S
Sbjct: 65  FKMVCDPKSLLFLYGMQLDYSDALIGGGFSFSNPNASSTCGCGKS 109


>gi|21231016|ref|NP_636933.1| hypothetical protein XCC1562 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66768979|ref|YP_243741.1| hypothetical protein XC_2672 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21112640|gb|AAM40857.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66574311|gb|AAY49721.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 121

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 60/104 (57%), Gaps = 2/104 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T AA+ R++  V  + G A G+R  + K GC+G  ++ DL  +   D D + E+ GV
Sbjct: 12  ISLTPAALERVQRFVQQTPG-ALGLRFGVTKTGCSGWGHITDLAREK-RDDDAVFEQGGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            +++D  SL  + GT IDF    L   F F NPN  + CGCG+S
Sbjct: 70  SIFVDPTSLPLVDGTCIDFGKHGLSETFTFSNPNATAECGCGES 113


>gi|226942326|ref|YP_002797399.1| nitrogen fixation Fe-S cluster assembly protein IscAnif
           [Azotobacter vinelandii DJ]
 gi|2495212|sp|Q44540|YNIU_AZOVI RecName: Full=Uncharacterized protein in nifU 5'region; AltName:
           Full=ORF6
 gi|142359|gb|AAA64724.1| ORF 6 [Azotobacter vinelandii]
 gi|226717253|gb|ACO76424.1| Nitrogen fixation Fe-S cluster assembly protein IscAnif
           [Azotobacter vinelandii DJ]
          Length = 107

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 62/105 (59%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE+A   +   + ++     G+RI ++ GGC+GL+Y + L      D D L++ DG
Sbjct: 1   MITLTESAKSAVTRFISSTGKPIAGLRIRVEGGGCSGLKYSLKLEEAGAED-DQLVDCDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           + + IDSAS   + G  +DF      SGF F NPN  ++CGCG+S
Sbjct: 60  ITLLIDSASAPLLDGVTMDFVESMEGSGFTFVNPNATNSCGCGKS 104


>gi|227536069|ref|ZP_03966118.1| HesB protein [Sphingobacterium spiritivorum ATCC 33300]
 gi|227243966|gb|EEI93981.1| HesB protein [Sphingobacterium spiritivorum ATCC 33300]
          Length = 117

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 64/105 (60%), Gaps = 3/105 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +T+TE AV  +K++    +  +  G+R+ ++ GGC+G+ Y++    D   +GD   E +G
Sbjct: 12  LTLTEGAVKELKKLRDQQEISEDFGLRVGVEGGGCSGMSYILGF--DQKKEGDIEYEIEG 69

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           ++++++ A  LY+ G E+DF+      GF F+NPN  S CGCG S
Sbjct: 70  IRIFMNKAHGLYLAGMEVDFRNGLDARGFTFNNPNATSTCGCGSS 114


>gi|163739599|ref|ZP_02147008.1| HesB/YadR/YfhF [Phaeobacter gallaeciensis BS107]
 gi|163741415|ref|ZP_02148806.1| Iron-sulfur cluster assembly family protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161385149|gb|EDQ09527.1| Iron-sulfur cluster assembly family protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161387058|gb|EDQ11418.1| HesB/YadR/YfhF [Phaeobacter gallaeciensis BS107]
          Length = 107

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 61/102 (59%), Gaps = 4/102 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +TE A  R+ EI    QG+A  +R++++ GGC+G +Y + L  D P   D ++E  G KV
Sbjct: 7   VTERAFARLAEIGAADQGQA--LRVAVEGGGCSGFQYEIAL--DAPQADDLILEGQGQKV 62

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            +D  SL ++    IDF  E + + FV +NPN  S+CGCG S
Sbjct: 63  VVDEVSLPFLENAVIDFTEELIGARFVINNPNATSSCGCGTS 104


>gi|108763866|ref|YP_630808.1| HesB/YadR/YfhF family protein [Myxococcus xanthus DK 1622]
 gi|108467746|gb|ABF92931.1| HesB/YadR/YfhF family protein [Myxococcus xanthus DK 1622]
          Length = 108

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 63/104 (60%), Gaps = 1/104 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T+AA+ ++K ++     +     I +   GC+GL Y ++LV ++   GD + E+DGV
Sbjct: 3   VRLTDAAIQQVKSVITAQGFEGYFFSIRVVPAGCSGLGYDLNLVKESKA-GDTVWEQDGV 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K+  D  S  Y+ GTEID+ +    SGF F+NPN  S+CGCG S
Sbjct: 62  KIASDPMSSQYLGGTEIDYVSAITGSGFKFNNPNAKSSCGCGTS 105


>gi|171058047|ref|YP_001790396.1| iron-sulfur cluster assembly accessory protein [Leptothrix
           cholodnii SP-6]
 gi|170775492|gb|ACB33631.1| iron-sulfur cluster assembly accessory protein [Leptothrix
           cholodnii SP-6]
          Length = 107

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T  A  +I++   + +G   G+R+++K  GC+G  Y ++   D P   D   E +GV
Sbjct: 3   VTVTPKAARQIRK-ALDQRGSGYGLRVAVKTSGCSGYAYALEFA-DAPAPEDLSFESEGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D+ SL  + GT++D+  + L  GF F+NPN  + CGCG+S  +
Sbjct: 61  FVLVDAKSLPMVDGTQLDWVRDGLNEGFQFNNPNASATCGCGESFTV 107


>gi|270159569|ref|ZP_06188225.1| Iron-binding protein IscA [Legionella longbeachae D-4968]
 gi|289165635|ref|YP_003455773.1| Fe-S cluster assembly protein [Legionella longbeachae NSW150]
 gi|269987908|gb|EEZ94163.1| Iron-binding protein IscA [Legionella longbeachae D-4968]
 gi|288858808|emb|CBJ12722.1| Fe-S cluster assembly protein [Legionella longbeachae NSW150]
          Length = 121

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 65/108 (60%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE-KDG 63
           ++ T+AA+  +   +    G A GIR+S+KK GC+GL Y+VD V   P++GD ++   + 
Sbjct: 15  ISFTDAALKHVVSYLQKKPGHA-GIRLSVKKTGCSGLSYVVDYVLA-PLEGDLILPLTEE 72

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             V +D AS  ++   E+D+  + L   FVF+NPNQ   CGCG+S  +
Sbjct: 73  YVVCVDKASYPFLKKMEVDYVKQGLNHKFVFNNPNQTGQCGCGESFTV 120


>gi|312797274|ref|YP_004030196.1| HesB protein family [Burkholderia rhizoxinica HKI 454]
 gi|312169049|emb|CBW76052.1| HesB protein family [Burkholderia rhizoxinica HKI 454]
          Length = 129

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 65/112 (58%), Gaps = 3/112 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LI 59
           M   +  T+AA  ++K+++         +R+ ++ GGC+G +Y      D  V+ DD ++
Sbjct: 20  MPAPLVFTDAAADKVKQLIDEEGNPELKLRVFVQGGGCSGFQY--GFTFDEEVNEDDTVM 77

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +K+GV++ IDS S  Y+LG EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 78  DKNGVRLLIDSMSYQYLLGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV 129


>gi|326385391|ref|ZP_08207035.1| iron-sulfur cluster assembly accessory protein [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326210108|gb|EGD60881.1| iron-sulfur cluster assembly accessory protein [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 108

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 62/107 (57%), Gaps = 3/107 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQ--GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           ++ +T++A+  ++  +  SQ  A   G+RI ++ GGCAG +YM+ LV + P   D ++  
Sbjct: 1   MIALTDSALEAVRTAMARSQAAATPAGLRIQVETGGCAGYKYMMGLVAE-PQPDDAIVTN 59

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
             V V+ID  S   + GT +DF      SGF F NPN  ++C CG+S
Sbjct: 60  GDVSVFIDPVSQPLLAGTTVDFVVALEGSGFTFTNPNASNSCSCGKS 106


>gi|310800418|gb|EFQ35311.1| iron-sulfur cluster assembly accessory protein [Glomerella
           graminicola M1.001]
          Length = 247

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 66/102 (64%), Gaps = 3/102 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           ++ +AV +++ ++   Q + + I++ ++  GC+GL Y ++ V D P   D+ + +DGVKV
Sbjct: 146 LSPSAVEQLRALL--DQPEPKLIKVGVRNRGCSGLAYHLEYV-DKPGSFDEEVVQDGVKV 202

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            IDS +L  ++G+E+D+  +KL   FVF NPN    CGCG+S
Sbjct: 203 LIDSKALFSIIGSEMDWVEDKLSQRFVFKNPNIKEQCGCGES 244


>gi|303279456|ref|XP_003059021.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226460181|gb|EEH57476.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 128

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 67/108 (62%), Gaps = 5/108 (4%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI---EKDG 63
           +T AA  RI+E++  ++ + Q ++I ++  GC G+ Y ++   ++     D +   E+ G
Sbjct: 23  LTAAAASRIRELL--TKREKQYLKIGVRTRGCNGMTYTMNYADESDKGKFDEVVTHEESG 80

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV ID  +L++++GT++DF  ++L S FVF NPN    CGCG+S  +
Sbjct: 81  VKVIIDPGALMHVIGTKMDFVEDRLRSEFVFENPNAKGECGCGESFNV 128


>gi|149925672|ref|ZP_01913936.1| HesB/YadR/YfhF family protein [Limnobacter sp. MED105]
 gi|149825789|gb|EDM84997.1| HesB/YadR/YfhF family protein [Limnobacter sp. MED105]
          Length = 118

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 64/110 (58%), Gaps = 5/110 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK--D 62
           + +T+AA  RI ++  N    A  IR+ ++ GGC+G EY +DL  +   D DD++ +   
Sbjct: 12  IALTDAAQERILDLRDNMHKPAM-IRLYVQGGGCSGFEYKIDLAKE--TDEDDILVQINP 68

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
            + +++D  S  Y+ GT ID++   L S FVF+NP   S CGCG S  ++
Sbjct: 69  YIHIYVDQVSAPYLEGTTIDYEAHTLASRFVFNNPQAKSTCGCGSSFSVE 118


>gi|146340984|ref|YP_001206032.1| hypothetical protein BRADO4055 [Bradyrhizobium sp. ORS278]
 gi|146193790|emb|CAL77807.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 113

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 64/108 (59%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEKDG 63
           VT++E A  RI EI+      A  +RIS++ GGC+G +Y  D+  D     DDL I +D 
Sbjct: 9   VTISERAARRIGEILGKESAGAM-LRISVEGGGCSGFQYKFDI--DRAKAEDDLVIARDK 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             V +D AS+ ++ G+E+DF  + + + F  +NPN  ++CGCG S  +
Sbjct: 66  AVVLVDPASVPFLAGSEVDFVDDLMGASFRINNPNATASCGCGTSFSV 113


>gi|115376939|ref|ZP_01464159.1| IscA protein [Stigmatella aurantiaca DW4/3-1]
 gi|310820583|ref|YP_003952941.1| HesB/YadR/YfhF family protein [Stigmatella aurantiaca DW4/3-1]
 gi|115366050|gb|EAU65065.1| IscA protein [Stigmatella aurantiaca DW4/3-1]
 gi|309393655|gb|ADO71114.1| HesB/YadR/YfhF family protein [Stigmatella aurantiaca DW4/3-1]
          Length = 127

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 66/111 (59%), Gaps = 11/111 (9%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIR-----ISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           + V ++ AAV ++KE++     KAQG       I +   GC+GL Y ++LV +   + D 
Sbjct: 20  NPVRLSNAAVTQVKEVI-----KAQGFEGYFFSIRVVPAGCSGLGYDLNLVKEAKPN-DH 73

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           + E+DGVK+  D+ S  Y+LGT +DF +    +GF F NPN  S+CGCG S
Sbjct: 74  VWEQDGVKITTDALSSKYLLGTVVDFVSSVTGAGFKFENPNAKSSCGCGTS 124


>gi|251792354|ref|YP_003007079.1| iron-sulfur cluster insertion protein ErpA [Aggregatibacter
           aphrophilus NJ8700]
 gi|247533746|gb|ACS96992.1| conserved hypothetical protein, putative [Aggregatibacter
           aphrophilus NJ8700]
          Length = 113

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 64/115 (55%), Gaps = 6/115 (5%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV-DGD 56
           M+DI   +T T+AA  ++K ++   +  A  +R+ +  GGC+G +Y      D  V DGD
Sbjct: 1   MTDISVPLTFTDAAAQKVKSLISEEENPALKLRVYITGGGCSGFQY--GFTFDEKVNDGD 58

Query: 57  DLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             +E  GV++ ID  SL Y++G  +D+      S FV +NPN  S CGCG S  I
Sbjct: 59  LTVENSGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFVVNNPNASSTCGCGSSFSI 113


>gi|294054397|ref|YP_003548055.1| iron-sulfur cluster assembly accessory protein [Coraliomargarita
           akajimensis DSM 45221]
 gi|293613730|gb|ADE53885.1| iron-sulfur cluster assembly accessory protein [Coraliomargarita
           akajimensis DSM 45221]
          Length = 125

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A  +++ ++   Q K   +R+ +  GGC GL Y +  V      GD L+   G
Sbjct: 20  LIAVTEPAGVKLQSLIEREQ-KGDYLRVKITGGGCNGLSYKMKFVA-TAKRGDILVRSSG 77

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +V +DS S LY+ GTE+D+  + +  GF F NPN  ++C CG+S  I
Sbjct: 78  AQVVVDSKSALYLRGTELDYSDKMVGGGFKFSNPNAKASCSCGESFSI 125


>gi|307203222|gb|EFN82377.1| Iron-sulfur cluster assembly 2-like protein, mitochondrial
           [Harpegnathos saltator]
          Length = 158

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 68/112 (60%), Gaps = 8/112 (7%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EK 61
           D + ++++ + R+KEI  +      G+R++++ GGC+G +Y  +L  D+ V  DD I +K
Sbjct: 51  DSLIISDSCIKRLKEIAVD----GAGLRVTVEGGGCSGFQYKFNL--DSNVHEDDRIFQK 104

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGF-VFHNPNQVSACGCGQSVEIK 112
           DG KV IDS SL Y+ G+ I+F TE + S F + +NP     C CG S  IK
Sbjct: 105 DGTKVIIDSTSLEYVKGSTIEFHTELIRSAFRITNNPLAEQGCSCGASFAIK 156


>gi|30249422|ref|NP_841492.1| hesB/yadR/yfhF family protein [Nitrosomonas europaea ATCC 19718]
 gi|30138785|emb|CAD85362.1| Hypothetical hesB/yadR/yfhF family [Nitrosomonas europaea ATCC
           19718]
          Length = 109

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 60/108 (55%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  +I++ +   +GK   +R+ +KK GC+G  Y  D   D   + D L E    
Sbjct: 3   ITLTERAARQIRQQL-ERRGKGVALRLGVKKSGCSGFAYSFDYA-DEVQEDDQLFESHDA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           +V +    L ++ G+EIDF  E L S F F NPN  + CGCG+S  +K
Sbjct: 61  QVVVQRDQLSFIDGSEIDFIQEGLNSSFKFRNPNIDNTCGCGESFSLK 108


>gi|157370419|ref|YP_001478408.1| iron-sulfur cluster assembly scaffold protein [Serratia
           proteamaculans 568]
 gi|157322183|gb|ABV41280.1| FeS assembly scaffold SufA [Serratia proteamaculans 568]
          Length = 123

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +++ AV +I +++     + +G+++ +K+ GCAG  Y++DL T  P D D L E+DG 
Sbjct: 19  ILLSDNAVQQITKLM-QQDSQVKGLQLGVKQSGCAGFAYVLDL-TRAPADDDLLFERDGA 76

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++++   ++ ++ GT +DF  E L   F F+NP    ACGCG+S  +
Sbjct: 77  RLYVPLKAMPFIDGTTVDFVREGLNQIFKFNNPKAQHACGCGESFGV 123


>gi|146277302|ref|YP_001167461.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145555543|gb|ABP70156.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 106

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 60/105 (57%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T AA   I+  +  S     G+R+ ++ GGCAGL+Y + L      D D ++E +G
Sbjct: 1   MIQITPAAQAAIRGAIEGSGQPVIGLRLMVQSGGCAGLKYGMSLELKEAED-DLVVEAEG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           V+V ID  S  Y+ G  IDF T    +GFVF NPN    CGCG+S
Sbjct: 60  VRVLIDPQSGEYLKGATIDFVTSIEGTGFVFDNPNAQGGCGCGKS 104


>gi|218438275|ref|YP_002376604.1| iron-sulfur cluster assembly accessory protein [Cyanothece sp. PCC
           7424]
 gi|218171003|gb|ACK69736.1| iron-sulfur cluster assembly accessory protein [Cyanothece sp. PCC
           7424]
          Length = 116

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV-DGDDLIEKDG 63
           + ++E A+  ++ ++ + QGK   +R+ +++GGC+G+ YM+D    + + + D + + DG
Sbjct: 10  ILLSETALNHVR-MLRDQQGKDLCLRVGVRQGGCSGMSYMMDFEDPSQIGEQDQVFDYDG 68

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            K+  D  SLLY+ G  +D+    +  GF F NPN    CGCG+S  +
Sbjct: 69  FKIVCDKKSLLYLYGLMLDYSNAMIGGGFQFTNPNASQTCGCGKSFGV 116


>gi|149177048|ref|ZP_01855656.1| hypothetical protein PM8797T_11941 [Planctomyces maris DSM 8797]
 gi|148844113|gb|EDL58468.1| hypothetical protein PM8797T_11941 [Planctomyces maris DSM 8797]
          Length = 110

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 59/106 (55%), Gaps = 3/106 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQG--IRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           VT+TE A   +K  +   Q  A+G  +RI +  GGC+G +Y    V D   + D+  E+ 
Sbjct: 3   VTITENASKELKRYM-EDQNVAEGSHLRIGIVSGGCSGFQYDFRFVDDVDTEKDNTSEQH 61

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           G+KV +D  S LY+ GT +D+       GF F NPN V +CGCG S
Sbjct: 62  GIKVVVDKKSDLYLDGTTLDYYESLEKRGFTFDNPNAVKSCGCGSS 107


>gi|284040656|ref|YP_003390586.1| iron-sulfur cluster assembly accessory protein [Spirosoma linguale
           DSM 74]
 gi|283819949|gb|ADB41787.1| iron-sulfur cluster assembly accessory protein [Spirosoma linguale
           DSM 74]
          Length = 108

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 64/111 (57%), Gaps = 6/111 (5%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQ--GIRISLKKGGCAGLEYMVDL-VTDNPVDGDDLIE 60
           +VT+++ A  +I E+     G A+   IR++++ GGC+GL Y +    T  P D   L+E
Sbjct: 1   MVTVSDIAKNKIVELR-QKDGLAEDTAIRVAVEGGGCSGLMYDLQFDATQQPTD--HLVE 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             G+K+ +D  SLLY+ GTE+DF       GF F NPN    CGCG+S  +
Sbjct: 58  DKGIKILVDRKSLLYLAGTELDFSDGLNGKGFQFKNPNATRTCGCGESFAV 108


>gi|157145964|ref|YP_001453283.1| iron-sulfur cluster assembly scaffold protein [Citrobacter koseri
           ATCC BAA-895]
 gi|157083169|gb|ABV12847.1| hypothetical protein CKO_01717 [Citrobacter koseri ATCC BAA-895]
          Length = 122

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  A   I+++V    G   G+R+ +K+ GCAG  Y++D V++ P   D L E +G 
Sbjct: 18  LTLTPEAAAHIRDLVAKQPGML-GVRLGVKQTGCAGFGYVLDTVSE-PEKDDLLFETEGA 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++++   ++ ++ GTE+D+  E L   F FHNP   + CGCG+S  +
Sbjct: 76  RLYVPLQAMPFIDGTEVDYVREGLNQLFKFHNPKAQNECGCGESFGV 122


>gi|87301793|ref|ZP_01084627.1| Uncharacterized HesB family conserved protein [Synechococcus sp. WH
           5701]
 gi|87283361|gb|EAQ75316.1| Uncharacterized HesB family conserved protein [Synechococcus sp. WH
           5701]
          Length = 147

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 63/113 (55%), Gaps = 7/113 (6%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD---LIEK 61
           + +TE A+ ++  ++   QG  + +R+ ++ GGC+G+ Y +D +    + GDD   + E 
Sbjct: 36  IRITEPAMKQLAALM-QQQGNDKLLRVGVRSGGCSGMSYTMDFIDSAAIRGDDELYVYEP 94

Query: 62  DGV---KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DG    +V  D  SLLY+ G ++DF +  +  GF F NPN    CGCG S  +
Sbjct: 95  DGASSFRVVSDPKSLLYIYGMQLDFSSALIGGGFNFTNPNASQTCGCGSSFAV 147


>gi|108805561|ref|YP_645498.1| HesB/YadR/YfhF [Rubrobacter xylanophilus DSM 9941]
 gi|108766804|gb|ABG05686.1| HesB/YadR/YfhF [Rubrobacter xylanophilus DSM 9941]
          Length = 141

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 65/105 (61%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           IV++T+ A  +++ ++     +   +RI ++ GGC+G +Y +    D   + D++ E  G
Sbjct: 35  IVSITDKAAEKVRALMEQEGEEDLALRIGVRPGGCSGFQYSI-YFDDEVAEDDEVFETKG 93

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VK+ +D+ S+ Y++G+E D++   + +GFV +NPN   +CGCG S
Sbjct: 94  VKILVDAMSVPYLMGSEFDWQESLMGAGFVVNNPNVQGSCGCGGS 138


>gi|310643818|ref|YP_003948576.1| iron-sulfur cluster assembly accessory protein [Paenibacillus
           polymyxa SC2]
 gi|309248768|gb|ADO58335.1| Iron-sulfur cluster assembly accessory protein [Paenibacillus
           polymyxa SC2]
          Length = 119

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 58/105 (55%), Gaps = 1/105 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T++A  R+KE++   +     +R+ +  GGC G  Y +    DN  D D  +    
Sbjct: 1   MINITDSAAERLKEMLEQQETPNMFLRLGVTPGGCTGFSYAMGF-DDNETDQDIYMNVQD 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +KV ++  S+ Y+ G EIDF+   +  GF  HNPN V+ CGCG S
Sbjct: 60  MKVVVEKDSIRYLDGLEIDFEESGMSGGFTIHNPNAVATCGCGSS 104


>gi|242373107|ref|ZP_04818681.1| iron sulfur assembly protein [Staphylococcus epidermidis M23864:W1]
 gi|242349261|gb|EES40862.1| iron sulfur assembly protein [Staphylococcus epidermidis M23864:W1]
          Length = 126

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 62/109 (56%), Gaps = 1/109 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +TEAA Y +K+++ ++      ++I +  GGC GL Y +    + P D D+++E  G+
Sbjct: 11  VILTEAAAYEVKDMLASNDMSDGYLKIKVNGGGCTGLTYGMS-AEETPGDNDEVLEYYGL 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
           KV +D      + GT IDFK   +  GF   NPN +++CGCG S +  +
Sbjct: 70  KVLVDKYDAPVLNGTTIDFKQSLMGGGFQIDNPNAIASCGCGSSFKTAK 118


>gi|92117301|ref|YP_577030.1| HesB/YadR/YfhF [Nitrobacter hamburgensis X14]
 gi|91800195|gb|ABE62570.1| HesB/YadR/YfhF [Nitrobacter hamburgensis X14]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++E A  RI EI+  S+G    +RIS++ GGC+G +Y  D+      D D +I +D  
Sbjct: 6   ITVSERAARRIGEIL-KSEGDGAMLRISVEGGGCSGFQYKFDIERAKAED-DLVIARDTA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D AS+ ++ G+E+DF  + + + F   NPN  ++CGCG S  I
Sbjct: 64  VVLVDPASVPFLSGSEVDFVDDLIGASFRVVNPNATASCGCGTSFSI 110


>gi|254490373|ref|ZP_05103562.1| HesB-like domain, putative [Methylophaga thiooxidans DMS010]
 gi|224464506|gb|EEF80766.1| HesB-like domain, putative [Methylophaga thiooxydans DMS010]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 57/108 (52%), Gaps = 1/108 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   V  TEAA  ++ +++      A  +R+ +  GGC+G +Y      +   +GD  +E
Sbjct: 1   MPSPVIFTEAAATKVSDLIAEEGNDALKLRVFITGGGCSGFQYGFTF-EEEVGEGDTEVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           K GV + ID AS  Y++G EIDF      S FV  NPN  + CGCG S
Sbjct: 60  KGGVTLLIDPASYQYLVGAEIDFTDGVEGSQFVIRNPNATTTCGCGSS 107


>gi|120553628|ref|YP_957979.1| iron-sulfur cluster assembly accessory protein [Marinobacter
           aquaeolei VT8]
 gi|160385711|sp|A1TYH3|ERPA_MARAV RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|120323477|gb|ABM17792.1| iron-sulfur cluster assembly accessory protein [Marinobacter
           aquaeolei VT8]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 61/111 (54%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +  T+ AV +++E++   +     +R+ +  GGC+G +Y          D D +IE
Sbjct: 1   MATPLFFTDNAVAKVRELIEEEENPDLKLRVFVTGGGCSGFQYGFSFDESQEED-DTVIE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +DGVK+ +DS S  Y++G  ID++     S FV  NPN  S CGCG S  I
Sbjct: 60  RDGVKLLVDSMSYQYLVGATIDYQEGLQGSQFVVQNPNASSTCGCGSSFSI 110


>gi|326797448|ref|YP_004315267.1| iron-sulfur cluster assembly accessory protein [Sphingobacterium
           sp. 21]
 gi|326548212|gb|ADZ76597.1| iron-sulfur cluster assembly accessory protein [Sphingobacterium
           sp. 21]
          Length = 117

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 3/105 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +T+TE AV  +K++    +     G+R+ ++ GGCAG+ Y++    D   +GD      G
Sbjct: 12  LTLTEGAVKELKKLREQQEIADDFGLRVGVEGGGCAGMNYILGF--DQRKEGDTEYLISG 69

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +KV+++ A  LY+ G EIDF+      GF F+NPN  S CGCG S
Sbjct: 70  IKVFMNKAHGLYLAGMEIDFQNGLNARGFTFNNPNATSTCGCGTS 114


>gi|322709855|gb|EFZ01430.1| iron sulfur assembly protein 1 [Metarhizium anisopliae ARSEF 23]
          Length = 282

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 62/92 (67%), Gaps = 3/92 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T AAV +++ ++   Q + + I++ ++  GC+GL Y ++ V D P   D+++E+DGVKV
Sbjct: 185 LTPAAVEQLRSML--DQPEPKIIKVGVRNRGCSGLAYHLEYV-DKPGTFDEMVEQDGVKV 241

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPN 98
            IDS +L  ++GTE+D+  +KL   FVF NPN
Sbjct: 242 LIDSKALFSIIGTEMDWAEDKLNQRFVFKNPN 273


>gi|322692279|gb|EFY84208.1| iron sulfur assembly protein 1 [Metarhizium acridum CQMa 102]
          Length = 217

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 62/92 (67%), Gaps = 3/92 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T AAV +++ ++   Q + + I++ ++  GC+GL Y ++ V D P   D+++E+DGVKV
Sbjct: 124 LTPAAVEQLRSML--DQPEPKLIKVGVRNRGCSGLAYHLEYV-DKPGTFDEMVEQDGVKV 180

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPN 98
            IDS +L  ++GTE+D+  +KL   FVF NPN
Sbjct: 181 LIDSKALFSIIGTEMDWAEDKLNQRFVFKNPN 212


>gi|125995245|dbj|BAF47160.1| HesB [Gloeothece sp. KO68DGA]
          Length = 119

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 56/104 (53%), Gaps = 1/104 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE A  +++  +        GIR+ +  GGC G EY ++LV+  P   D   ++D V
Sbjct: 3   VTLTEKAALKLRTFLQGESTTITGIRVGVTDGGCNGYEYALNLVS-QPNTADMRFDQDDV 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            +++D  S+  + G  IDF      SGF F NPN    CGCG+S
Sbjct: 62  PIYVDPNSVSLLDGVIIDFIDSLTQSGFTFTNPNATETCGCGKS 105


>gi|261868216|ref|YP_003256138.1| iron-sulfur cluster insertion protein ErpA [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|293390268|ref|ZP_06634602.1| iron-sulfur cluster insertion protein ErpA [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|261413548|gb|ACX82919.1| iron-sulfur cluster insertion protein ErpA [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|290950802|gb|EFE00921.1| iron-sulfur cluster insertion protein ErpA [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 113

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 60/108 (55%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV-DGDDLIEKDG 63
           +T T+AA  ++K ++   +  A  +R+ +  GGC+G +Y      D  V DGD  +E  G
Sbjct: 8   LTFTDAAAQKVKTLITEEENPALKLRVYITGGGCSGFQY--GFTFDEKVNDGDLTVENSG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V++ ID  SL Y++G  +D+      S FV +NPN  S CGCG S  I
Sbjct: 66  VQLVIDPMSLQYLIGGTVDYTEGLEGSRFVVNNPNATSTCGCGSSFSI 113


>gi|256821635|ref|YP_003145598.1| iron-sulfur cluster assembly accessory protein [Kangiella koreensis
           DSM 16069]
 gi|256795174|gb|ACV25830.1| iron-sulfur cluster assembly accessory protein [Kangiella koreensis
           DSM 16069]
          Length = 108

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 61/107 (57%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA  ++K+++   Q     +R+ +  GGC+G +Y      +   D D  IE+DGV
Sbjct: 3   ITVTEAASRKVKQLIDEEQNDQLKLRVFVTGGGCSGFQYGFTF-DEKQNDNDMAIEQDGV 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D+ S  Y++G+E+D+      S F+  NP   + CGCG S  +
Sbjct: 62  KILVDALSFQYLMGSEVDYTEGLQGSRFLISNPQAKTTCGCGSSFSL 108


>gi|332968737|gb|EGK07789.1| type I restriction-modification system [Desmospora sp. 8437]
          Length = 118

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 63/106 (59%), Gaps = 2/106 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQG-KAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++ ++E A ++IKE++   +  + Q +R+ +K GGC+G  Y +    +N  D D  ++ +
Sbjct: 1   MIELSERACHKIKEMLKEEENPEEQFLRVGVKGGGCSGFTYSMGF-DENKSDKDTELDLN 59

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           G++V ID  S   + G +ID+K   +  GF  HNPN ++ CGCG S
Sbjct: 60  GIRVLIDRESEPLIRGLQIDYKESMMGGGFTIHNPNAIATCGCGTS 105


>gi|58040182|ref|YP_192146.1| HesB family protein [Gluconobacter oxydans 621H]
 gi|58002596|gb|AAW61490.1| HesB family protein [Gluconobacter oxydans 621H]
          Length = 114

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 68/115 (59%), Gaps = 6/115 (5%)

Query: 1   MSDIV--TMTEAAVYRIKEIVFNSQGKAQGI--RISLKKGGCAGLEYMVDLVTDNPVDGD 56
           MSD V  +++ +A  RI EI+  +Q + +G+  R+++  GGC G +Y   L  D   D D
Sbjct: 1   MSDTVPFSISASAAARINEII-AAQPEPEGLALRVAVLAGGCNGFQYQFRLERDQAAD-D 58

Query: 57  DLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +IE+DG KV++D+ SL  +   E++F  + + + F   NPN  S+CGCG S  +
Sbjct: 59  VVIERDGAKVFVDTTSLDLLENAELEFVDKLMGAHFTVTNPNAASSCGCGTSFSL 113


>gi|78484963|ref|YP_390888.1| HesB/YadR/YfhF [Thiomicrospira crunogena XCL-2]
 gi|78363249|gb|ABB41214.1| iron-sulfur cluster assembly accessory protein [Thiomicrospira
           crunogena XCL-2]
          Length = 108

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 63/108 (58%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+AA  R+  ++   +G   G+R+  K  GCAG  Y+VD   D   D D++ E  GV
Sbjct: 3   VTLTQAAADRVNSML-EKRGHGIGLRVGTKVSGCAGFSYVVDY-ADEITDNDEVFESFGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYS-GFVFHNPNQVSACGCGQSVEI 111
           KV ++  SL  + G E+D+  E L + GF F+NP    +CGCG+S  +
Sbjct: 61  KVVVNQKSLEQIDGMELDYVKESLLNEGFEFNNPRVKDSCGCGESFTV 108


>gi|304391803|ref|ZP_07373745.1| iron-sulfur cluster insertion protein ErpA 2 [Ahrensia sp. R2A130]
 gi|303296032|gb|EFL90390.1| iron-sulfur cluster insertion protein ErpA 2 [Ahrensia sp. R2A130]
          Length = 123

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 61/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V ++EAA  R+  I+ +++     +R+S++ GGC+G  Y  DL TD   D D ++  +G 
Sbjct: 19  VVVSEAAAKRVARIL-STEPDMNALRVSVEGGGCSGFSYKFDL-TDAKSDDDIVLASEGA 76

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V ID  SL YM G+ IDF  + +   F   NPN  ++CGCG S  +
Sbjct: 77  TVLIDPISLQYMDGSIIDFVDDLMGQSFQIRNPNATASCGCGTSFSM 123


>gi|261420392|ref|YP_003254074.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           Y412MC61]
 gi|319768059|ref|YP_004133560.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           Y412MC52]
 gi|261376849|gb|ACX79592.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           Y412MC61]
 gi|317112925|gb|ADU95417.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           Y412MC52]
          Length = 121

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 63/106 (59%), Gaps = 3/106 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEKD 62
           ++ +TEAA ++IK+++   + +   +R+ +  GGC+GL Y +    D+    DD+  E+ 
Sbjct: 5   VIMLTEAAAFQIKDMMKEQEEEGAYLRVGVHGGGCSGLSYGMGF--DHERRDDDIEFEQH 62

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           G+K+ +D  S   + GT ID+K   L  GF  +NPN ++ CGCG S
Sbjct: 63  GIKILVDRDSAPILRGTVIDYKQSLLGGGFTINNPNAIATCGCGSS 108


>gi|124009809|ref|ZP_01694478.1| scaffold protein for iron-sulfur cluster assembly [Microscilla
           marina ATCC 23134]
 gi|123984217|gb|EAY24573.1| scaffold protein for iron-sulfur cluster assembly [Microscilla
           marina ATCC 23134]
          Length = 108

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 63/110 (57%), Gaps = 4/110 (3%)

Query: 4   IVTMTEAAVYRIKEIV-FNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV-DGDDLIEK 61
           +V +TE A  +I E+   +    A  IR+S+K GGC+GL Y  DL  D  V D D++ E 
Sbjct: 1   MVQITERAKDKIVELRQKDGLDTAHNIRVSVKGGGCSGLMY--DLNFDAEVKDKDEIFED 58

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             VK+ +D  SLLY+LGT +DF       GF F NPN    CGCG+S  +
Sbjct: 59  KEVKILVDKKSLLYLLGTTLDFTDGLNGKGFHFVNPNASRTCGCGESFAV 108


>gi|332667931|ref|YP_004450719.1| iron-sulfur cluster assembly accessory protein [Haliscomenobacter
           hydrossis DSM 1100]
 gi|332336745|gb|AEE53846.1| iron-sulfur cluster assembly accessory protein [Haliscomenobacter
           hydrossis DSM 1100]
          Length = 116

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +T+T  AV +++ I       +  G+RI +K GGC+G  YM+    D+  D D   E +G
Sbjct: 11  ITLTHGAVKQLQRIKAEQNIPEHYGLRIGVKGGGCSGFSYMLGF--DDSKDNDSTYEIEG 68

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           +KV++  +  +Y+LG EID+       GF F+NPN    CGCG S
Sbjct: 69  IKVYMQKSHAIYLLGMEIDWLDGLQNRGFAFNNPNAKETCGCGTS 113


>gi|162455613|ref|YP_001617980.1| hypothetical protein sce7331 [Sorangium cellulosum 'So ce 56']
 gi|161166195|emb|CAN97500.1| hypothetical protein sce7331 [Sorangium cellulosum 'So ce 56']
          Length = 158

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 64/113 (56%), Gaps = 5/113 (4%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE--- 60
            +++++AAV  I+  +         IR+ ++ GGC+G  Y+++     P  GD ++E   
Sbjct: 45  TLSVSDAAVQAIRAQLAKRGTPEGAIRVGIRGGGCSGFSYVIEFEDKPPRSGDLVLEFAE 104

Query: 61  --KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             K  V+V+ D  S+LY+ G+ +D++   +Y GF F NP++ + CGCG S  +
Sbjct: 105 PDKATVRVFCDKKSILYLGGSVLDWEKTLMYQGFKFKNPHEATRCGCGHSFTV 157


>gi|172058325|ref|YP_001814785.1| iron-sulfur cluster assembly accessory protein [Exiguobacterium
           sibiricum 255-15]
 gi|171990846|gb|ACB61768.1| iron-sulfur cluster assembly accessory protein [Exiguobacterium
           sibiricum 255-15]
          Length = 116

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 2/105 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TEAA  ++KE++  +    Q +R+ ++ GGC+GL Y +    D+  + D   E+ G
Sbjct: 1   MIHLTEAAALQVKEMMLQAPDDEQNLRMLVQGGGCSGLSYGMGF--DSEKETDLTFEQHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           VKV +D      + G E+D+K   L  GF   NPN ++ CGCG S
Sbjct: 59  VKVIVDQKDYPVVKGLEVDYKQSMLGGGFTITNPNAIATCGCGTS 103


>gi|114327983|ref|YP_745140.1| hesB protein family protein [Granulibacter bethesdensis CGDNIH1]
 gi|114316157|gb|ABI62217.1| hesB protein family [Granulibacter bethesdensis CGDNIH1]
          Length = 130

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 70/111 (63%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           +  ++++T+AA  R++++    Q + + +RI++   GC+G  Y +  V +   +GD+++ 
Sbjct: 22  LPPLMSLTDAAAERLQQLYTTGQ-QGRLLRIAVSTKGCSGKSYDMSWVEEKG-EGDEVVI 79

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GV V ID  + L+++GT +D++ ++L +GF F NPN+   CGCG+S  +
Sbjct: 80  DKGVTVLIDRKATLFLIGTVMDYQVKQLEAGFTFINPNEKGRCGCGESFHV 130


>gi|94676493|ref|YP_588904.1| iron-sulfur cluster assembly accessory protein [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
 gi|94219643|gb|ABF13802.1| iron-sulfur cluster assembly accessory protein [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
          Length = 119

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT+AA  +IK++V  S  +  G+R+S+   GCAG  Y++DL+T+ P   D + E  G 
Sbjct: 15  LTMTDAAARQIKKLV-TSDPRMFGLRLSINHSGCAGFSYILDLITE-PNKSDLVYEHLGA 72

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++    +  + GT ID+    L   F F+NP    ACGCG+S  I
Sbjct: 73  KLFVPLQVMPLIDGTRIDYIKIGLNYEFKFYNPKAQHACGCGESFSI 119


>gi|254468221|ref|ZP_05081627.1| HesB/YadR/YfhF [beta proteobacterium KB13]
 gi|207087031|gb|EDZ64314.1| HesB/YadR/YfhF [beta proteobacterium KB13]
          Length = 116

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 61/112 (54%), Gaps = 3/112 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-I 59
           M D +  T+ AV ++KE++   +     +R+ +  GGC+G +Y      +  V+ DD  +
Sbjct: 7   MPDPLIFTDNAVKKVKELIAEEETPDLKLRVFVSGGGCSGFQY--GFTFEEAVNEDDTQV 64

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            KD V + ID  SL Y+ G+EID++     S FV  NPN  + CGCG S  +
Sbjct: 65  TKDNVTLLIDPMSLQYLTGSEIDYQDNVQGSQFVIRNPNATTTCGCGSSFSV 116


>gi|291614711|ref|YP_003524868.1| iron-sulfur cluster assembly protein IscA [Sideroxydans
           lithotrophicus ES-1]
 gi|291584823|gb|ADE12481.1| iron-sulfur cluster assembly protein IscA [Sideroxydans
           lithotrophicus ES-1]
          Length = 107

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 64/108 (59%), Gaps = 4/108 (3%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-IEKDG 63
           +++TE A   ++  +   +GK  G+R+ ++  GC+G+ Y ++    + VD +DL    +G
Sbjct: 3   ISLTENAAKHVQNFL-AKRGKGVGLRLGVRTSGCSGMAYKLEFA--DAVDSEDLQFVSNG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V V +D  SL Y+ G E+D+  E L  GF F+NPN    CGCG+S ++
Sbjct: 60  VTVLVDQHSLPYIDGMELDYTREGLNEGFKFNNPNVKDQCGCGESFKV 107


>gi|124268337|ref|YP_001022341.1| putative HesB-like protein [Methylibium petroleiphilum PM1]
 gi|160385712|sp|A2SKL7|ERPA_METPP RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|124261112|gb|ABM96106.1| putative HesB-like protein [Methylibium petroleiphilum PM1]
          Length = 121

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 63/109 (57%), Gaps = 3/109 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-I 59
           M   +  T++A  ++KE+V         +R+ ++ GGC+G +Y      D  V+ DD  +
Sbjct: 12  MPAPIVFTDSAAGKVKELVEEEGNPELKLRVFVQGGGCSGFQY--GFTFDEIVNDDDTKM 69

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           EK+GV + ID+ SL Y++G EID+K +   + FV  NPN  + CGCG S
Sbjct: 70  EKNGVMLLIDAMSLQYLVGAEIDYKEDLEGAQFVIKNPNATTTCGCGSS 118


>gi|148241373|ref|YP_001226530.1| hypothetical protein SynRCC307_0274 [Synechococcus sp. RCC307]
 gi|147849683|emb|CAK27177.1| Conserved hypothetical protein [Synechococcus sp. RCC307]
          Length = 127

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 60/113 (53%), Gaps = 7/113 (6%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD------L 58
           + +TE A+ ++  ++   QG    +R+ ++ GGC+G+ Y +D +    + GDD       
Sbjct: 16  ILITEPAMKQLANLM-QQQGSGSVLRVGVRSGGCSGMSYTMDFIDAAQIQGDDERYSYEP 74

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +    +V  D  SLLY+ G ++DF TE +  GF F NPN    CGCG S  +
Sbjct: 75  ADAPSFEVVCDPKSLLYIYGMQLDFSTELIGGGFNFTNPNASQTCGCGSSFAV 127


>gi|209885396|ref|YP_002289253.1| HesB/YadR/YfhF [Oligotropha carboxidovorans OM5]
 gi|209873592|gb|ACI93388.1| HesB/YadR/YfhF [Oligotropha carboxidovorans OM5]
          Length = 109

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 67/112 (59%), Gaps = 4/112 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL-I 59
           M+  VT++E A  RI EI+  S+G+   +RIS++ GGC+G +Y  D+  D     DDL I
Sbjct: 1   MTANVTISERAARRIGEIL-KSEGEGAKLRISVEGGGCSGFQYKFDI--DKTQAEDDLVI 57

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D   V +DS+S  ++  +E+DF  + + + F   NPN  ++CGCG S  I
Sbjct: 58  VRDNAVVLVDSSSAPFLADSELDFVDDLIGASFRVVNPNATASCGCGTSFSI 109


>gi|302803678|ref|XP_002983592.1| hypothetical protein SELMODRAFT_118247 [Selaginella moellendorffii]
 gi|300148835|gb|EFJ15493.1| hypothetical protein SELMODRAFT_118247 [Selaginella moellendorffii]
          Length = 111

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 65/105 (61%), Gaps = 2/105 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKDG 63
           +T+++ A+  ++++  + Q K   +R+ +++GGC+G+ Y++D      V  DD ++E++G
Sbjct: 5   ITLSDKALSHLQKLRAD-QKKDLCLRVGVRQGGCSGMSYIMDFEDRGNVRSDDSVMEQEG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
             +  D  SLLY+ G ++D+    +  GF F NPN  S CGCG+S
Sbjct: 64  FTMVCDPKSLLYLFGMQLDYSDALIGGGFSFKNPNATSTCGCGKS 108


>gi|325104094|ref|YP_004273748.1| iron-sulfur cluster assembly accessory protein [Pedobacter saltans
           DSM 12145]
 gi|324972942|gb|ADY51926.1| iron-sulfur cluster assembly accessory protein [Pedobacter saltans
           DSM 12145]
          Length = 108

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 65/110 (59%), Gaps = 4/110 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPV-DGDDLIEK 61
           +VT+T+ A  +++E++  +    +  +R+S+K GGC+GL Y +D   DN    GD   E 
Sbjct: 1   MVTITDKAKQKVQELMEGAGLDNSYFLRVSVKGGGCSGLSYNMDF--DNEAHSGDQNFED 58

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +G+K+ +D  S LY+ GTE+D+       GF F NPN    CGCG+S  +
Sbjct: 59  NGLKIVLDMKSFLYLAGTELDYSDGLNGKGFNFVNPNASRTCGCGESFSV 108


>gi|254424833|ref|ZP_05038551.1| hypothetical protein S7335_4994 [Synechococcus sp. PCC 7335]
 gi|196192322|gb|EDX87286.1| hypothetical protein S7335_4994 [Synechococcus sp. PCC 7335]
          Length = 121

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 62/108 (57%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKA--QGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           VT+TE A  R++  V ++ G A  +G+R ++K GGC G EY +  + + P   D++ E  
Sbjct: 3   VTLTELAELRLRTFVRSTAGSASTRGVRFAVKDGGCNGYEYDIK-IANAPNPEDEITEVG 61

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            +KV++D  S   + G  +D+    L SGF F NPN    CGCG+S +
Sbjct: 62  SLKVFVDPKSSPLLDGVVVDYIDSLLESGFKFTNPNATDTCGCGKSFQ 109


>gi|119500384|ref|XP_001266949.1| iron-sulfur assembly protein [Neosartorya fischeri NRRL 181]
 gi|119415114|gb|EAW25052.1| iron-sulfur assembly protein [Neosartorya fischeri NRRL 181]
          Length = 249

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 63/92 (68%), Gaps = 3/92 (3%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  AV ++++++  SQ   + IR+ +K  GC+GL Y ++ V + P   D+++E+DGVKV
Sbjct: 144 LTPLAVEQLRKLL--SQPDPKFIRVGVKNRGCSGLAYHLEYV-EKPGAFDEVVEQDGVKV 200

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPN 98
            IDS +L  ++G+E+D++ +KL   FVF NPN
Sbjct: 201 LIDSKALFSIIGSEMDWQEDKLSRKFVFRNPN 232


>gi|297719515|ref|NP_001172119.1| Os01g0105800 [Oryza sativa Japonica Group]
 gi|52076222|dbj|BAD44876.1| IscA -like [Oryza sativa Japonica Group]
 gi|215694888|dbj|BAG90079.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222617581|gb|EEE53713.1| hypothetical protein OsJ_00044 [Oryza sativa Japonica Group]
 gi|255672766|dbj|BAH90849.1| Os01g0105800 [Oryza sativa Japonica Group]
          Length = 138

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 64/104 (61%), Gaps = 3/104 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AA  RI++++  S      +R+ +K  GC GL Y ++   D     D+++E  GV
Sbjct: 27  LALTDAAASRIRQLL--SLRHRPYLRLGVKARGCNGLSYTLNYA-DEKGKFDEVVEDKGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           KV ID  +L++++GT++D+  + L S FVF NPN    CGCG+S
Sbjct: 84  KVLIDPKALMHVIGTKMDYVDDPLRSEFVFINPNSKGECGCGES 127


>gi|121997670|ref|YP_001002457.1| iron-sulfur cluster insertion protein ErpA [Halorhodospira
           halophila SL1]
 gi|160380677|sp|A1WVE3|ERPA_HALHL RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|121589075|gb|ABM61655.1| iron-sulfur cluster assembly accessory protein [Halorhodospira
           halophila SL1]
          Length = 123

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 62/109 (56%), Gaps = 3/109 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVD-GDDLIEKD 62
           ++  T+AA  +++E++   +G    +R+ +  GGC+G +Y      D  V+ GD +IEK 
Sbjct: 17  LLIFTDAAADKVRELLDGEEGGDVKLRVFITGGGCSGFQY--GFTFDETVEEGDTIIEKR 74

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVK+ +D  S +Y+ G E+DF +      F+  NPN  + CGCG S  I
Sbjct: 75  GVKIVVDPVSGIYLQGAEVDFSSGLEGEQFIIRNPNATTTCGCGSSFAI 123


>gi|294941860|ref|XP_002783276.1| iron-sulfur cluster assembly protein, putative [Perkinsus marinus
           ATCC 50983]
 gi|239895691|gb|EER15072.1| iron-sulfur cluster assembly protein, putative [Perkinsus marinus
           ATCC 50983]
          Length = 95

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 55/84 (65%), Gaps = 1/84 (1%)

Query: 28  GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEIDFKTEK 87
           G+R+ + K GC  + Y ++   D     D+++E +GVKV +D  +L+Y++GTE+D+    
Sbjct: 13  GLRVGVGKKGCENMSYTMNYARDIG-KLDEVVETEGVKVVVDPNALMYLIGTEMDYVDND 71

Query: 88  LYSGFVFHNPNQVSACGCGQSVEI 111
           L S FVF NPNQ S+CGCG+S  +
Sbjct: 72  LASEFVFTNPNQKSSCGCGKSFSV 95


>gi|226497192|ref|NP_001149228.1| iron-sulfur assembly protein IscA [Zea mays]
 gi|195625618|gb|ACG34639.1| iron-sulfur assembly protein IscA [Zea mays]
          Length = 192

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 62/109 (56%), Gaps = 2/109 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVT-DNPVDGDDLI 59
           ++  +++TE A+  + ++    + +   +RI +K+GGC+G+ Y ++    +N    D ++
Sbjct: 69  IAPAISLTEKALKHLNQMR-AERNEVLCLRIGVKQGGCSGMSYTMEFENRENASPDDSVV 127

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
           E DG  +  D  SLL+M G E+D+    +  GF F NPN    CGCG+S
Sbjct: 128 EYDGFAIVCDPKSLLFMFGMELDYSDALIGGGFSFQNPNATKTCGCGKS 176