PSIBLAST alignment of GI: 254781064 and protein with PDB id: 2k4z

>gi|194368480|pdb|2K4Z|A Chain A, Solution Nmr Structure Of Allochromatium Vinosum Dsrr: Northeast Structural Genomics Consortium Target Op5 Length = 125
 Score = 49.0 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/95 (15%), Positives = 39/95 (41%), Gaps = 3/95 (3%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +  +T AA  ++ +       +   +R++  +     ++Y +        + D  +  +G
Sbjct: 22  MFKLTPAAAEQVLKAAKQGGTEGMCLRLAAGRNPDGSIDYRMGFDDL--TEDDIRLTSEG 79

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYS-GFVFHNP 97
           V++ I    +  +  T +D+   +     F+F NP
Sbjct: 80  VEIVIAPDYVSLLDQTTLDYVELEPGQFHFIFLNP 114