BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781064|ref|YP_003065477.1| FeS assembly scaffold SufA
[Candidatus Liberibacter asiaticus str. psy62]
         (116 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|332527118|ref|ZP_08403197.1| iron-sulfur cluster insertion protein ErpA [Rubrivivax
           benzoatilyticus JA2]
 gi|332111548|gb|EGJ11530.1| iron-sulfur cluster insertion protein ErpA [Rubrivivax
           benzoatilyticus JA2]
          Length = 124

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++KE+V         +R+ ++ GGC+G +Y      +   D   +  
Sbjct: 15  MPAPLIFTDSAAAKVKELVDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTQMT- 73

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV + ID+ SL Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 74  KNGVTLLIDAMSLQYLVGAEIDYKDDLQGAQFVIRNPNATTTCGCGSSFSV 124


>gi|121593055|ref|YP_984951.1| iron-sulfur cluster insertion protein ErpA [Acidovorax sp. JS42]
 gi|222109824|ref|YP_002552088.1| iron-sulfur cluster insertion protein erpa [Acidovorax ebreus TPSY]
 gi|160380678|sp|A1W3Q0|ERPA_ACISJ RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|120605135|gb|ABM40875.1| iron-sulfur cluster assembly accessory protein [Acidovorax sp.
           JS42]
 gi|221729268|gb|ACM32088.1| iron-sulfur cluster assembly accessory protein [Acidovorax ebreus
           TPSY]
          Length = 124

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 58/113 (51%), Gaps = 1/113 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++ E++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 12  MPAPILFTDSAAAKVAELIAEEGNPDLKLRVFVQGGGCSGFQYGFTFDEITNEDDTTMT- 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
           K+GV + ID+ S  Y++G EID+K +   + FV  NPN  S CGCG S  ++ 
Sbjct: 71  KNGVSLLIDAMSYQYLVGAEIDYKEDLQGAQFVIKNPNAASTCGCGSSFSVED 123


>gi|319761429|ref|YP_004125366.1| iron-sulfur cluster assembly accessory protein [Alicycliphilus
           denitrificans BC]
 gi|330823294|ref|YP_004386597.1| iron-sulfur cluster assembly accessory protein [Alicycliphilus
           denitrificans K601]
 gi|317115990|gb|ADU98478.1| iron-sulfur cluster assembly accessory protein [Alicycliphilus
           denitrificans BC]
 gi|329308666|gb|AEB83081.1| iron-sulfur cluster assembly accessory protein [Alicycliphilus
           denitrificans K601]
          Length = 124

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 58/113 (51%), Gaps = 1/113 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++ E++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 12  MPAPILFTDSAAAKVAELIAEEGNPDLKLRVFVQGGGCSGFQYGFTFDEITNEDDTTMT- 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
           K+GV + ID+ S  Y++G EID+K +   + FV  NPN  + CGCG S  ++ 
Sbjct: 71  KNGVSLLIDAMSYQYLVGAEIDYKEDLQGAQFVIKNPNAETTCGCGSSFSVQD 123


>gi|255292550|dbj|BAH89663.1| HesB/YadR/YfhF family protein [uncultured bacterium]
          Length = 124

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 34/114 (29%), Positives = 59/114 (51%), Gaps = 1/114 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M D +  T++A  ++ E++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 12  MPDPIIFTDSAANKVAELIAEEGNADLKLRVFVQGGGCSGFQYGFTFDEVANEDDTTMT- 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           K+GV + ID+ S  Y++G EID+K +   + FV  NPN  ++CGCG S  +   
Sbjct: 71  KNGVSLLIDAMSYQYLVGAEIDYKEDLQGAQFVIKNPNAETSCGCGSSFSVSDE 124


>gi|253997776|ref|YP_003049839.1| iron-sulfur cluster assembly accessory protein [Methylovorus sp.
           SIP3-4]
 gi|313199840|ref|YP_004038498.1| iron-sulfur cluster assembly accessory protein [Methylovorus sp.
           MP688]
 gi|253984455|gb|ACT49312.1| iron-sulfur cluster assembly accessory protein [Methylovorus sp.
           SIP3-4]
 gi|312439156|gb|ADQ83262.1| iron-sulfur cluster assembly accessory protein [Methylovorus sp.
           MP688]
          Length = 116

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 53/111 (47%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T+ A  ++KE++         +R+ +  GGC+G +Y          D   +  
Sbjct: 7   MPSPLVFTDNAAKKVKELIEEEGSPDLKLRVFVSGGGCSGFQYGFTFEDTVNEDDTQVQ- 65

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KD V + ID  SL Y+ G EID++     S FV  NPN  + CGCG S  +
Sbjct: 66  KDTVTLLIDPMSLQYLTGAEIDYQDSLQGSQFVIRNPNATTTCGCGSSFSV 116


>gi|319941832|ref|ZP_08016154.1| iron-sulfur cluster assembly accessory protein [Sutterella
           wadsworthensis 3_1_45B]
 gi|319804765|gb|EFW01632.1| iron-sulfur cluster assembly accessory protein [Sutterella
           wadsworthensis 3_1_45B]
          Length = 130

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 62/111 (55%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M D +T T+AAV ++K ++         +R+ ++ GGCAG +Y      +   D D +++
Sbjct: 21  MPDPITFTDAAVAKVKSLMDEEGNPDLKLRVFVQGGGCAGFQYGFTFD-ETQNDDDAVMQ 79

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV + IDS S  Y++G +ID+K       FV  NPN V+ CGCG S  +
Sbjct: 80  KGGVTLLIDSMSYQYLVGAKIDYKEGLSGEQFVIDNPNAVTTCGCGSSFSV 130


>gi|254468221|ref|ZP_05081627.1| HesB/YadR/YfhF [beta proteobacterium KB13]
 gi|207087031|gb|EDZ64314.1| HesB/YadR/YfhF [beta proteobacterium KB13]
          Length = 116

 Score =  139 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 57/111 (51%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M D +  T+ AV ++KE++   +     +R+ +  GGC+G +Y          D   +  
Sbjct: 7   MPDPLIFTDNAVKKVKELIAEEETPDLKLRVFVSGGGCSGFQYGFTFEEAVNEDDTQVT- 65

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KD V + ID  SL Y+ G+EID++     S FV  NPN  + CGCG S  +
Sbjct: 66  KDNVTLLIDPMSLQYLTGSEIDYQDNVQGSQFVIRNPNATTTCGCGSSFSV 116


>gi|187479436|ref|YP_787461.1| iron-sulfur cluster insertion protein ErpA [Bordetella avium 197N]
 gi|123513814|sp|Q2KV08|ERPA_BORA1 RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|115424023|emb|CAJ50576.1| conserved hypothetical protein [Bordetella avium 197N]
          Length = 123

 Score =  139 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 56/105 (53%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T++A  ++K+++         +R+ ++ GGC+G +Y          D   L  K+GV++
Sbjct: 20  FTDSAAAKVKDLLAEEGNPELKLRVFVQGGGCSGFQYGFTFDEVVNEDDTVLD-KEGVQL 78

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 79  LVDPMSFQYLVGAEIDYKEDLEGAQFVIRNPNATTTCGCGSSFSV 123


>gi|300313139|ref|YP_003777231.1| hypothetical protein Hsero_3845 [Herbaspirillum seropedicae SmR1]
 gi|300075924|gb|ADJ65323.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 121

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 32/111 (28%), Positives = 58/111 (52%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  +++A  ++ +++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 12  MPAPINFSDSAAAKVAQLIEEEGNPDLKLRVFVQGGGCSGFQYGFTFDEIVNEDDTTMS- 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 71  KNGVQLLIDSMSYQYLVGAEIDYKDDLEGAQFVIKNPNATTTCGCGSSFSV 121


>gi|312797274|ref|YP_004030196.1| HesB protein family [Burkholderia rhizoxinica HKI 454]
 gi|312169049|emb|CBW76052.1| HesB protein family [Burkholderia rhizoxinica HKI 454]
          Length = 129

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T+AA  ++K+++         +R+ ++ GGC+G +Y      +   D   +  
Sbjct: 20  MPAPLVFTDAAADKVKQLIDEEGNPELKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMD- 78

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV++ IDS S  Y+LG EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 79  KNGVRLLIDSMSYQYLLGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV 129


>gi|167586141|ref|ZP_02378529.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           ubonensis Bu]
          Length = 122

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y      +   D   +  
Sbjct: 13  MPAPFVFTDAAAEKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMN- 71

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 72  KNGVQLLIDSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV 122


>gi|120612686|ref|YP_972364.1| iron-sulfur cluster insertion protein ErpA [Acidovorax citrulli
           AAC00-1]
 gi|326318750|ref|YP_004236422.1| Iron--sulfur cluster insertion protein erpA [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|160380662|sp|A1TUF2|ERPA_ACIAC RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|120591150|gb|ABM34590.1| iron-sulfur cluster assembly accessory protein [Acidovorax citrulli
           AAC00-1]
 gi|323375586|gb|ADX47855.1| Iron--sulfur cluster insertion protein erpA [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 121

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 32/111 (28%), Positives = 57/111 (51%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++ +++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 12  MPAPIVFTDSAAAKVADLIAEEGNPDLKLRVFVQGGGCSGFQYGFTFDEITNEDDTTMT- 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV + ID+ S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 71  KNGVSLLIDAMSYQYLVGAEIDYKEDLQGAQFVIKNPNATTTCGCGSSFSV 121


>gi|221069200|ref|ZP_03545305.1| iron-sulfur cluster assembly accessory protein [Comamonas
           testosteroni KF-1]
 gi|264676678|ref|YP_003276584.1| iron-sulfur cluster assembly accessory protein [Comamonas
           testosteroni CNB-2]
 gi|299529494|ref|ZP_07042931.1| iron-sulfur cluster insertion protein ErpA [Comamonas testosteroni
           S44]
 gi|220714223|gb|EED69591.1| iron-sulfur cluster assembly accessory protein [Comamonas
           testosteroni KF-1]
 gi|262207190|gb|ACY31288.1| iron-sulfur cluster assembly accessory protein [Comamonas
           testosteroni CNB-2]
 gi|298722357|gb|EFI63277.1| iron-sulfur cluster insertion protein ErpA [Comamonas testosteroni
           S44]
          Length = 121

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++ +++         +R+ ++ GGC+G +Y      +   D D  + 
Sbjct: 12  MPSPIVFTDSAAAKVADLIAEEGNPDLKLRVFVQGGGCSGFQYGFTFD-EITNDDDTTMT 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV + IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 71  KNGVSLLIDSMSYQYLVGAEIDYKEDLQGAQFVIKNPNASTTCGCGSSFSV 121


>gi|239817637|ref|YP_002946547.1| iron-sulfur cluster insertion protein ErpA [Variovorax paradoxus
           S110]
 gi|239804214|gb|ACS21281.1| iron-sulfur cluster assembly accessory protein [Variovorax
           paradoxus S110]
          Length = 121

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M + +  T++A  ++ +++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 12  MPEPIVFTDSAAAKVADLIAEEGNPDLKLRVFVQGGGCSGFQYGFTFDEITNEDDTTMT- 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV + ID+ S  Y++G EID+K +   + FV  NPN  S CGCG S  
Sbjct: 71  KNGVSLLIDAMSYQYLVGAEIDYKEDLQGAQFVIKNPNATSTCGCGSSFS 120


>gi|239828209|ref|YP_002950833.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           WCH70]
 gi|239808502|gb|ACS25567.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           WCH70]
          Length = 120

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 65/109 (59%), Gaps = 1/109 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+DI+T+TEAA ++IK+++   + +   +RI +K GGC+GL Y +    +   D  +   
Sbjct: 1   MADIITLTEAAAFQIKDMMKEHEEEGAYLRIGVKGGGCSGLSYGMGFDHERHEDDHEFE- 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           + G+K+ +D  S   + GT ID+K   +  GF  +NPN ++ CGCG S 
Sbjct: 60  QHGIKILVDKESAPILQGTVIDYKQSLMGGGFTINNPNAIATCGCGSSF 108


>gi|254253231|ref|ZP_04946549.1| HesB/YadR/YfhF family protein [Burkholderia dolosa AUO158]
 gi|124895840|gb|EAY69720.1| HesB/YadR/YfhF family protein [Burkholderia dolosa AUO158]
          Length = 123

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y      +   D   +  
Sbjct: 14  MPAPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMN- 72

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 73  KNGVQLLIDSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV 123


>gi|254207951|ref|ZP_04914301.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           JHU]
 gi|147751845|gb|EDK58912.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           JHU]
          Length = 129

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 58/111 (52%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y      +   D   L  
Sbjct: 20  MPAPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVLN- 78

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV + +D+ S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 79  KNGVVLLVDAMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV 129


>gi|255590276|ref|XP_002535223.1| Iron-binding protein iscA, putative [Ricinus communis]
 gi|223523712|gb|EEF27159.1| Iron-binding protein iscA, putative [Ricinus communis]
          Length = 116

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 58/111 (52%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++ +++         +R+ ++ GGC+G +Y          D   ++ 
Sbjct: 7   MPAPIIFTDSAAEKVAQLIEEEGNPDLKLRVFVQGGGCSGFQYGFTFDEIVNEDDTTMV- 65

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV++ IDS S  Y++G EID+K +   + FV  NP   S CGCG S  +
Sbjct: 66  KNGVQLLIDSMSYQYLVGAEIDYKDDLEGAQFVIKNPQATSTCGCGSSFSV 116


>gi|163854902|ref|YP_001629200.1| iron-sulfur cluster insertion protein ErpA [Bordetella petrii DSM
           12804]
 gi|226694525|sp|A9I246|ERPA_BORPD RecName: Full=Putative iron--sulfur cluster insertion protein erpA
 gi|163258630|emb|CAP40929.1| conserved hypothetical protein [Bordetella petrii]
          Length = 122

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              +  T++A  ++K+++         +R+ ++ GGC+G +Y          D   L  K
Sbjct: 14  PSPLIFTDSAAAKVKDLLAEEGNPELKLRVFVQGGGCSGFQYGFTFDEAVNEDDTVLD-K 72

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +GV++ +D  S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 73  NGVQLLVDPMSFQYLVGAEIDYKEDLEGAQFVIRNPNASTTCGCGSSFSV 122


>gi|161525871|ref|YP_001580883.1| iron-sulfur cluster insertion protein ErpA [Burkholderia
           multivorans ATCC 17616]
 gi|189349408|ref|YP_001945036.1| iron-sulfur cluster insertion protein ErpA [Burkholderia
           multivorans ATCC 17616]
 gi|221202303|ref|ZP_03575337.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           multivorans CGD2M]
 gi|221209117|ref|ZP_03582111.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           multivorans CGD2]
 gi|221214509|ref|ZP_03587480.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           multivorans CGD1]
 gi|226694529|sp|A9AH79|ERPA_BURM1 RecName: Full=Putative iron--sulfur cluster insertion protein erpA
 gi|160343300|gb|ABX16386.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           multivorans ATCC 17616]
 gi|189333430|dbj|BAG42500.1| HesB-like protein [Burkholderia multivorans ATCC 17616]
 gi|221165766|gb|EED98241.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           multivorans CGD1]
 gi|221171021|gb|EEE03474.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           multivorans CGD2]
 gi|221177877|gb|EEE10290.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           multivorans CGD2M]
 gi|325528767|gb|EGD05828.1| iron-sulfur cluster insertion protein ErpA [Burkholderia sp. TJI49]
          Length = 123

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y      +   D   +  
Sbjct: 14  MPAPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMN- 72

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 73  KNGVQLLIDSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV 123


>gi|297537293|ref|YP_003673062.1| iron-sulfur cluster assembly accessory protein [Methylotenera sp.
           301]
 gi|297256640|gb|ADI28485.1| iron-sulfur cluster assembly accessory protein [Methylotenera sp.
           301]
          Length = 124

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 56/111 (50%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T+ A  ++KE++         +R+ +  GGC+G +Y      +   D D  ++
Sbjct: 15  MPAPLVFTDNAAKKVKELIEEEGSPDLKLRVFVSGGGCSGFQYGFTFE-EEVNDDDTQVQ 73

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KD V + ID  SL Y++G EID++     S FV  NP   + CGCG S  +
Sbjct: 74  KDTVTLLIDPMSLQYLMGAEIDYQDSLQGSQFVIRNPQATTTCGCGSSFSV 124


>gi|226939864|ref|YP_002794937.1| iron-binding protein erpA [Laribacter hongkongensis HLHK9]
 gi|226714790|gb|ACO73928.1| Putative iron-binding protein erpA [Laribacter hongkongensis HLHK9]
          Length = 116

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 54/111 (48%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++AV ++ E++         +R+ +  GGC+G +Y          D   +  
Sbjct: 7   MPLPLNFTDSAVAKVSELIAEEGNPDLKLRVFVTGGGCSGFQYGFTFDEITNEDDAVME- 65

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV + ID  S  Y++G EID++     S FV  NPN  S CGCG S  +
Sbjct: 66  KGGVTLLIDPMSYQYLVGAEIDYQESLEGSQFVIKNPNATSTCGCGSSFSV 116


>gi|171060122|ref|YP_001792471.1| iron-sulfur cluster assembly accessory protein [Leptothrix
           cholodnii SP-6]
 gi|170777567|gb|ACB35706.1| iron-sulfur cluster assembly accessory protein [Leptothrix
           cholodnii SP-6]
          Length = 121

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 58/110 (52%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++ ++V         +R+ ++ GGC+G +Y      +   D D  + 
Sbjct: 12  MPSPIIFTDSAASKVADLVAEEGNPDLKLRVFVQGGGCSGFQYGFTFD-EIVNDDDTQMS 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV + ID+ SL Y+ G EID+K +   + FV  NPN  + CGCG S  
Sbjct: 71  KNGVTLLIDAMSLQYLAGAEIDYKEDLQGAQFVIKNPNATTTCGCGSSFS 120


>gi|167837847|ref|ZP_02464730.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           thailandensis MSMB43]
          Length = 122

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 58/111 (52%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y      +   D   L  
Sbjct: 13  MPAPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVLN- 71

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV + +D+ S  Y++G EID+K +   + FV  NPN  S CGCG S  +
Sbjct: 72  KNGVVLLVDAMSYQYLVGAEIDYKDDLNGAQFVIKNPNATSTCGCGSSFSV 122


>gi|217969656|ref|YP_002354890.1| iron-sulfur cluster insertion protein ErpA [Thauera sp. MZ1T]
 gi|217506983|gb|ACK53994.1| iron-sulfur cluster assembly accessory protein [Thauera sp. MZ1T]
          Length = 116

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 55/110 (50%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            +I+  T++A  +++E++         +R+ +  GGC+G +Y      +   D      K
Sbjct: 8   PEIMVFTDSAANKVRELIEEEGNPDLKLRVFVSGGGCSGFQYGFTFDEEVNEDDTTFE-K 66

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +GV + +D  S  Y++G EID+      S FV  NPN  S CGCG S  +
Sbjct: 67  NGVLLLVDPMSYQYLVGAEIDYTEGLEGSQFVIRNPNATSTCGCGSSFTV 116


>gi|171319632|ref|ZP_02908726.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           ambifaria MEX-5]
 gi|171095123|gb|EDT40129.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           ambifaria MEX-5]
          Length = 123

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y      +   D   +  
Sbjct: 14  MPLPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMN- 72

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 73  KNGVQLLIDSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV 123


>gi|115350629|ref|YP_772468.1| iron-sulfur cluster insertion protein ErpA [Burkholderia ambifaria
           AMMD]
 gi|170699599|ref|ZP_02890638.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           ambifaria IOP40-10]
 gi|172059662|ref|YP_001807314.1| iron-sulfur cluster insertion protein ErpA [Burkholderia ambifaria
           MC40-6]
 gi|122324011|sp|Q0BI89|ERPA_BURCM RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|226694526|sp|B1YTD3|ERPA_BURA4 RecName: Full=Putative iron--sulfur cluster insertion protein erpA
 gi|115280617|gb|ABI86134.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           ambifaria AMMD]
 gi|170135481|gb|EDT03770.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           ambifaria IOP40-10]
 gi|171992179|gb|ACB63098.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           ambifaria MC40-6]
          Length = 123

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y      +   D   +  
Sbjct: 14  MPVPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMN- 72

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 73  KNGVQLLIDSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV 123


>gi|319795931|ref|YP_004157571.1| iron-sulfur cluster assembly accessory protein [Variovorax
           paradoxus EPS]
 gi|315598394|gb|ADU39460.1| iron-sulfur cluster assembly accessory protein [Variovorax
           paradoxus EPS]
          Length = 121

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M + +  T++A  ++ +++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 12  MPEPIVFTDSAAAKVADLIAEEGNPELKLRVFVQGGGCSGFQYGFTFDEITNEDDTTMT- 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV + ID+ S  Y++G EID+K +   + FV  NPN  S CGCG S  
Sbjct: 71  KNGVSLLIDAMSYQYLVGAEIDYKEDLQGAQFVIKNPNATSTCGCGSSFS 120


>gi|124268337|ref|YP_001022341.1| putative HesB-like protein [Methylibium petroleiphilum PM1]
 gi|160385712|sp|A2SKL7|ERPA_METPP RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|124261112|gb|ABM96106.1| putative HesB-like protein [Methylibium petroleiphilum PM1]
          Length = 121

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 61/110 (55%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++KE+V         +R+ ++ GGC+G +Y      +   D D  +E
Sbjct: 12  MPAPIVFTDSAAGKVKELVEEEGNPELKLRVFVQGGGCSGFQYGFTFD-EIVNDDDTKME 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV + ID+ SL Y++G EID+K +   + FV  NPN  + CGCG S  
Sbjct: 71  KNGVMLLIDAMSLQYLVGAEIDYKEDLEGAQFVIKNPNATTTCGCGSSFS 120


>gi|238026238|ref|YP_002910469.1| iron-sulfur cluster insertion protein ErpA [Burkholderia glumae
           BGR1]
 gi|237875432|gb|ACR27765.1| Iron-sulfur cluster assembly accessory protein [Burkholderia glumae
           BGR1]
          Length = 124

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 58/111 (52%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y      +   D   +  
Sbjct: 15  MPAPFVFTDAAADKVKQLIEEEGNPELKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMN- 73

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 74  KSGVQLLIDSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV 124


>gi|332530280|ref|ZP_08406226.1| iron-sulfur cluster insertion protein ErpA [Hylemonella gracilis
           ATCC 19624]
 gi|332040266|gb|EGI76646.1| iron-sulfur cluster insertion protein ErpA [Hylemonella gracilis
           ATCC 19624]
          Length = 125

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 56/110 (50%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++ +++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 16  MPAPILFTDSAAAKVADLIAEEGNPDLKLRVFVQGGGCSGFQYGFTFDEVANEDDTTMT- 74

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV + ID+ S  Y++G EID+K +   + FV  NPN  + CGCG S  
Sbjct: 75  KNGVSLLIDAMSYQYLVGAEIDYKEDLQGAQFVIKNPNATTTCGCGSSFS 124


>gi|53720517|ref|YP_109503.1| iron-sulfur cluster insertion protein ErpA [Burkholderia
           pseudomallei K96243]
 gi|53726209|ref|YP_103902.1| iron-sulfur cluster insertion protein ErpA [Burkholderia mallei
           ATCC 23344]
 gi|76810187|ref|YP_334790.1| iron-sulfur cluster insertion protein ErpA [Burkholderia
           pseudomallei 1710b]
 gi|83718509|ref|YP_441782.1| iron-sulfur cluster insertion protein ErpA [Burkholderia
           thailandensis E264]
 gi|121599685|ref|YP_991606.1| iron-sulfur cluster insertion protein ErpA [Burkholderia mallei
           SAVP1]
 gi|124384812|ref|YP_001027102.1| iron-sulfur cluster insertion protein ErpA [Burkholderia mallei
           NCTC 10229]
 gi|126439703|ref|YP_001060387.1| iron-sulfur cluster insertion protein ErpA [Burkholderia
           pseudomallei 668]
 gi|126451422|ref|YP_001082047.1| iron-sulfur cluster insertion protein ErpA [Burkholderia mallei
           NCTC 10247]
 gi|126452098|ref|YP_001067649.1| iron-sulfur cluster insertion protein ErpA [Burkholderia
           pseudomallei 1106a]
 gi|134280487|ref|ZP_01767198.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 305]
 gi|167000492|ref|ZP_02266304.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           PRL-20]
 gi|167580601|ref|ZP_02373475.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           thailandensis TXDOH]
 gi|167618709|ref|ZP_02387340.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           thailandensis Bt4]
 gi|167721188|ref|ZP_02404424.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei DM98]
 gi|167740162|ref|ZP_02412936.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 14]
 gi|167817376|ref|ZP_02449056.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 91]
 gi|167825783|ref|ZP_02457254.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 9]
 gi|167847266|ref|ZP_02472774.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei B7210]
 gi|167895853|ref|ZP_02483255.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 7894]
 gi|167904243|ref|ZP_02491448.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei NCTC 13177]
 gi|167912504|ref|ZP_02499595.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 112]
 gi|167920455|ref|ZP_02507546.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei BCC215]
 gi|217420420|ref|ZP_03451925.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 576]
 gi|226198375|ref|ZP_03793944.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei Pakistan 9]
 gi|237813776|ref|YP_002898227.1| putative conserved hypothetical protein [Burkholderia pseudomallei
           MSHR346]
 gi|238561984|ref|ZP_00441063.2| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           GB8 horse 4]
 gi|242315224|ref|ZP_04814240.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 1106b]
 gi|254178893|ref|ZP_04885547.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           ATCC 10399]
 gi|254180678|ref|ZP_04887276.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 1655]
 gi|254191505|ref|ZP_04898008.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254194830|ref|ZP_04901260.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei S13]
 gi|254202612|ref|ZP_04908975.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           FMH]
 gi|254261342|ref|ZP_04952396.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 1710a]
 gi|254299238|ref|ZP_04966688.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 406e]
 gi|254355909|ref|ZP_04972187.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           2002721280]
 gi|257137950|ref|ZP_05586212.1| iron-sulfur cluster insertion protein ErpA [Burkholderia
           thailandensis E264]
 gi|81379097|sp|Q63QW5|ERPA_BURPS RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|81604350|sp|Q62HB8|ERPA_BURMA RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|123537520|sp|Q2SZ67|ERPA_BURTA RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|123598017|sp|Q3JNR3|ERPA_BURP1 RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|160380666|sp|A3MP61|ERPA_BURM7 RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|160380667|sp|A2S583|ERPA_BURM9 RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|160380668|sp|A1V053|ERPA_BURMS RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|160380669|sp|A3NZ78|ERPA_BURP0 RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|160380670|sp|A3NDG6|ERPA_BURP6 RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|52210931|emb|CAH36919.1| putative HesB-like protein [Burkholderia pseudomallei K96243]
 gi|52429632|gb|AAU50225.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           ATCC 23344]
 gi|76579640|gb|ABA49115.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 1710b]
 gi|83652334|gb|ABC36397.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           thailandensis E264]
 gi|121228495|gb|ABM51013.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           SAVP1]
 gi|124292832|gb|ABN02101.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           NCTC 10229]
 gi|126219196|gb|ABN82702.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 668]
 gi|126225740|gb|ABN89280.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 1106a]
 gi|126244292|gb|ABO07385.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           NCTC 10247]
 gi|134248494|gb|EBA48577.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 305]
 gi|147746859|gb|EDK53936.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           FMH]
 gi|148024884|gb|EDK83062.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           2002721280]
 gi|157808754|gb|EDO85924.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 406e]
 gi|157939176|gb|EDO94846.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160694807|gb|EDP84815.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           ATCC 10399]
 gi|169651579|gb|EDS84272.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei S13]
 gi|184211217|gb|EDU08260.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 1655]
 gi|217395832|gb|EEC35849.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 576]
 gi|225929558|gb|EEH25576.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei Pakistan 9]
 gi|237504262|gb|ACQ96580.1| putative conserved hypothetical protein [Burkholderia pseudomallei
           MSHR346]
 gi|238523432|gb|EEP86870.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           GB8 horse 4]
 gi|242138463|gb|EES24865.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 1106b]
 gi|243063547|gb|EES45733.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           PRL-20]
 gi|254220031|gb|EET09415.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           pseudomallei 1710a]
          Length = 122

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 58/111 (52%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y      +   D   L  
Sbjct: 13  MPAPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVLN- 71

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV + +D+ S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 72  KNGVVLLVDAMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV 122


>gi|295401374|ref|ZP_06811345.1| iron-sulfur cluster assembly accessory protein [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312109666|ref|YP_003987982.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           Y4.1MC1]
 gi|294976589|gb|EFG52196.1| iron-sulfur cluster assembly accessory protein [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311214767|gb|ADP73371.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           Y4.1MC1]
          Length = 120

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 65/109 (59%), Gaps = 1/109 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+DIVT+TEAA ++IK+++   + +   +RI ++ GGC+GL Y +    +   D  +   
Sbjct: 1   MTDIVTLTEAAAFQIKDMMKEHEEEGAYLRIGVRGGGCSGLSYGMGFDHERHEDDHEFE- 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           + G+K+ +D  S   + GT ID+K   +  GF  +NPN ++ CGCG S 
Sbjct: 60  QHGIKILVDKDSAPILQGTVIDYKQSLMGGGFTINNPNAIATCGCGSSF 108


>gi|89899535|ref|YP_522006.1| iron-sulfur cluster insertion protein ErpA [Rhodoferax
           ferrireducens T118]
 gi|122479956|sp|Q220S8|ERPA_RHOFD RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|89344272|gb|ABD68475.1| HesB/YadR/YfhF [Rhodoferax ferrireducens T118]
          Length = 120

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 56/110 (50%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++ +++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 12  MPSPILFTDSAAAKVADLIAEEGNPDLKLRVFVQGGGCSGFQYGFTFDEITNEDDTTMT- 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV + ID+ S  Y++G EID+K +   + FV  NPN  + CGCG S  
Sbjct: 71  KNGVSLLIDAMSYQYLVGAEIDYKEDLEGAQFVIKNPNATTTCGCGSSFS 120


>gi|119899048|ref|YP_934261.1| iron-sulfur cluster insertion protein ErpA [Azoarcus sp. BH72]
 gi|160380663|sp|A1K969|ERPA_AZOSB RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|119671461|emb|CAL95374.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 116

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 54/109 (49%), Gaps = 1/109 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            +I+  T+ A  +++E++      A  +R+ +  GGC+G +Y      +   D      K
Sbjct: 8   PEILVFTDNAANKVRELIDEEGNPALKLRVFVTGGGCSGFQYGFTFDEEVNEDDTAFE-K 66

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +GV + ID  S  Y++G EID+      S FV  NPN  S CGCG S  
Sbjct: 67  NGVTLLIDPMSYQYLVGAEIDYTEGLEGSQFVIRNPNATSTCGCGSSFS 115


>gi|293603316|ref|ZP_06685744.1| iron-sulfur cluster insertion protein ErpA [Achromobacter
           piechaudii ATCC 43553]
 gi|292818226|gb|EFF77279.1| iron-sulfur cluster insertion protein ErpA [Achromobacter
           piechaudii ATCC 43553]
          Length = 123

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T++A  ++K+++         +R+ ++ GGC+G +Y          D   L  K GV++
Sbjct: 20  FTDSAAAKVKDLLAEEGNPDLKLRVFVQGGGCSGFQYGFTFDEVVNEDDTVLD-KAGVQL 78

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 79  LVDPMSFQYLVGAEIDYKEDLEGAQFVIRNPNASTTCGCGSSFSV 123


>gi|330815552|ref|YP_004359257.1| Iron-sulfur cluster assembly accessory protein [Burkholderia
           gladioli BSR3]
 gi|327367945|gb|AEA59301.1| Iron-sulfur cluster assembly accessory protein [Burkholderia
           gladioli BSR3]
          Length = 124

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y      +   D   ++ 
Sbjct: 15  MPLPFVFTDAAADKVKQLIDEEGNPELKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMV- 73

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 74  KNGVQLLIDSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV 124


>gi|134294759|ref|YP_001118494.1| iron-sulfur cluster insertion protein ErpA [Burkholderia
           vietnamiensis G4]
 gi|160380658|sp|A4JBK6|ERPA1_BURVG RecName: Full=Putative iron-sulfur cluster insertion protein erpA 1
 gi|134137916|gb|ABO53659.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           vietnamiensis G4]
          Length = 123

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y      +   D   +  
Sbjct: 14  MPVPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMD- 72

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 73  KNGVQLLIDSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV 123


>gi|319778568|ref|YP_004129481.1| iron binding like-protein [Taylorella equigenitalis MCE9]
 gi|317108592|gb|ADU91338.1| iron binding like-protein [Taylorella equigenitalis MCE9]
          Length = 120

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 59/110 (53%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++  T+AA  ++KE++ +       +R+ ++ GGC+G +Y      +   + D  +  
Sbjct: 12  PSMLVFTDAAAAKVKELIEDEGNPDLKLRVFIQGGGCSGFQYGFIFD-ETMAEDDTTVTN 70

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +GV + +D  S  Y++G EID+K +   S FV  NPN  + CGCG S  +
Sbjct: 71  NGVSLLVDPMSFQYLVGAEIDYKDDIEGSQFVIRNPNATTTCGCGSSFSV 120


>gi|297181281|gb|ADI17473.1| uncharacterized conserved protein [uncultured beta proteobacterium
           HF0130_04F21]
          Length = 127

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T++A  ++K ++         +R+ ++ GGC+G +Y      +   D D  ++
Sbjct: 18  MPAPFVFTDSAANKVKSLIEEEGNPDLKLRVFVQGGGCSGFQYGFTFD-EVVGDDDTQMK 76

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV + IDS S  Y++G+EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 77  KNGVTLLIDSMSYQYLVGSEIDYKEDLEGAQFVIRNPNAQTTCGCGSSFSV 127


>gi|34499149|ref|NP_903364.1| hypothetical protein CV_3694 [Chromobacterium violaceum ATCC 12472]
 gi|81654561|sp|Q7NRT6|ERPA_CHRVO RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|34105000|gb|AAQ61356.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 117

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 31/111 (27%), Positives = 53/111 (47%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  TE+A  ++++++         +R+ +  GGC+G +Y          D   +  
Sbjct: 8   MPSPINFTESACAKVQDLIAEEGNPDLKLRVFVTGGGCSGFQYGFTFDEIANEDDTAIER 67

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV   +D  S  Y++G EID++     S FV  NPN  + CGCG S  +
Sbjct: 68  Q-GVTFLVDPMSYQYLVGAEIDYQESLEGSQFVIRNPNATTTCGCGSSFSV 117


>gi|254781064|ref|YP_003065477.1| FeS assembly scaffold SufA [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040741|gb|ACT57537.1| FeS assembly scaffold SufA [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 116

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 116/116 (100%), Positives = 116/116 (100%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE
Sbjct: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL
Sbjct: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116


>gi|253995569|ref|YP_003047633.1| iron-sulfur cluster assembly accessory protein [Methylotenera
           mobilis JLW8]
 gi|253982248|gb|ACT47106.1| iron-sulfur cluster assembly accessory protein [Methylotenera
           mobilis JLW8]
          Length = 121

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              +  T+ A  ++KE++         +R+ +  GGC+G +Y      +   D D  ++K
Sbjct: 13  PSPLVFTDNAAKKVKELIEEEGSPDLKLRVFVSGGGCSGFQYGFTFE-EEVNDDDTQVQK 71

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           D V + ID  SL Y++G EID++     S FV  NPN  + CGCG S  +
Sbjct: 72  DTVTLLIDPMSLQYLMGAEIDYQDSLQGSQFVIRNPNAQTTCGCGSSFSV 121


>gi|257094592|ref|YP_003168233.1| iron-sulfur cluster insertion protein ErpA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257047116|gb|ACV36304.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 116

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 55/111 (49%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T++A  ++KE++         +R+ +  GGC+G +Y          D D  ++
Sbjct: 7   MPLPFVFTDSAAGKVKELIEEEGNPDLKLRVFVTGGGCSGFQYGFTFDEVA-NDDDTALQ 65

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV + +D  S  Y++G EID+      S FV  NPN  S CGCG S  +
Sbjct: 66  KNGVTLLVDPMSYQYLVGAEIDYTEGLEGSQFVIKNPNASSTCGCGSSFSV 116


>gi|167564072|ref|ZP_02356988.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           oklahomensis EO147]
 gi|167571216|ref|ZP_02364090.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           oklahomensis C6786]
          Length = 122

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 58/111 (52%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y      D   D   L  
Sbjct: 13  MPAPFVFTDAAADKVKQLIDEEGNPELKLRVFVQGGGCSGFQYGFTFDEDVNEDDTVLN- 71

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV + +D+ S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 72  KNGVVLLVDAMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV 122


>gi|33593893|ref|NP_881537.1| iron-sulfur cluster insertion protein ErpA [Bordetella pertussis
           Tohama I]
 gi|33598389|ref|NP_886032.1| iron-sulfur cluster insertion protein ErpA [Bordetella
           parapertussis 12822]
 gi|33603327|ref|NP_890887.1| iron-sulfur cluster insertion protein ErpA [Bordetella
           bronchiseptica RB50]
 gi|81424577|sp|Q7VUW2|ERPA_BORPE RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|81426165|sp|Q7W3Z5|ERPA_BORPA RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|81430196|sp|Q7WFC7|ERPA_BORBR RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|33563967|emb|CAE43230.1| conserved hypothetical protein [Bordetella pertussis Tohama I]
 gi|33574518|emb|CAE39163.1| conserved hypothetical protein [Bordetella parapertussis]
 gi|33577451|emb|CAE34716.1| conserved hypothetical protein [Bordetella bronchiseptica RB50]
 gi|332383312|gb|AEE68159.1| iron-sulfur cluster insertion protein ErpA [Bordetella pertussis
           CS]
          Length = 123

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T++A  ++K+++         +R+ ++ GGC+G +Y      +   D D +++K GV++
Sbjct: 20  FTDSAAAKVKDLLAEEGNPELKLRVFVQGGGCSGFQYGFTFD-EVVNDDDTVLDKAGVQL 78

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 79  LVDPMSFQYLVGAEIDYKEDLEGAQFVIRNPNASTTCGCGSSFSV 123


>gi|301628961|ref|XP_002943601.1| PREDICTED: putative iron-sulfur cluster insertion protein erpA-like
           [Xenopus (Silurana) tropicalis]
          Length = 121

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 58/111 (52%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++ +++         +R+ +  GGC+G +Y      +   D D  + 
Sbjct: 12  MPAPIHFTDSAAAKVADLIAEEGNPDLKLRVFVHGGGCSGFQYGFTFD-EITNDDDTTMT 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV + ID+ S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 71  KNGVSLLIDAMSYQYLVGAEIDYKEDLQGAQFVIKNPNAETTCGCGSSFSV 121


>gi|121609596|ref|YP_997403.1| iron-sulfur cluster insertion protein ErpA [Verminephrobacter
           eiseniae EF01-2]
 gi|160385723|sp|A1WL78|ERPA_VEREI RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|121554236|gb|ABM58385.1| iron-sulfur cluster assembly accessory protein [Verminephrobacter
           eiseniae EF01-2]
          Length = 121

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 56/110 (50%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++ +++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 12  MPAPILFTDSAAAKVAQLIAEEGNPELKLRVFVQGGGCSGFQYGFTFDEITNEDDTTMT- 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV + ID+ S  Y++G EID+K +   + FV  NPN  + CGCG S  
Sbjct: 71  KNGVSLLIDAMSYQYLVGAEIDYKEDLQGAQFVIKNPNATTTCGCGSSFS 120


>gi|317402593|gb|EFV83155.1| iron-sulfur cluster insertion protein erpA [Achromobacter
           xylosoxidans C54]
          Length = 123

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T++A  ++K+++         +R+ ++ GGC+G +Y          D   L  K GV++
Sbjct: 20  FTDSAAAKVKDLLAEEGNPELKLRVFVQGGGCSGFQYGFTFDEVVNEDDTVLD-KAGVQL 78

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 79  LVDPMSFQYLVGAEIDYKEDLEGAQFVIRNPNASTTCGCGSSFSV 123


>gi|311103885|ref|YP_003976738.1| iron-sulfur cluster insertion protein ErpA [Achromobacter
           xylosoxidans A8]
 gi|310758574|gb|ADP14023.1| iron-sulfur cluster insertion protein ErpA [Achromobacter
           xylosoxidans A8]
          Length = 123

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T++A  ++K+++         +R+ ++ GGC+G +Y      +   D D +++K GV++
Sbjct: 20  FTDSAAAKVKDLLAEEGNPELKLRVFVQGGGCSGFQYGFTFD-EVVNDDDTVLDKAGVQL 78

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 79  LVDPMSFQYLVGAEIDYKEDLEGAQFVIRNPNASTTCGCGSSFSV 123


>gi|296134580|ref|YP_003641822.1| iron-sulfur cluster assembly accessory protein [Thiomonas
           intermedia K12]
 gi|294338525|emb|CAZ86854.1| Iron-sulfur cluster insertion protein erpA [Thiomonas sp. 3As]
 gi|295794702|gb|ADG29492.1| iron-sulfur cluster assembly accessory protein [Thiomonas
           intermedia K12]
          Length = 125

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 57/105 (54%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T++A  ++KE++         +R+ ++ GGC+G +Y          D   ++ K+GV +
Sbjct: 22  FTDSAAAKVKELIDEEGNNDLKLRVFVQGGGCSGFQYGFTFDEAVNEDDTQMV-KNGVTL 80

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            ID+ SL Y++G EID+K     + FV  NPN  + CGCG S  +
Sbjct: 81  LIDAMSLQYLVGAEIDYKDGLEGAQFVIKNPNATTTCGCGSSFSV 125


>gi|78065243|ref|YP_368012.1| iron-sulfur cluster insertion protein ErpA [Burkholderia sp. 383]
 gi|123569308|sp|Q39JJ8|ERPA_BURS3 RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|77965988|gb|ABB07368.1| HesB/YadR/YfhF family protein [Burkholderia sp. 383]
          Length = 123

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y      +   D   +  
Sbjct: 14  MPVPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMN- 72

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 73  KNGVQLLIDSMSYQYLVGAEIDYKDDLNGAQFVIKNPNASTTCGCGSSFSV 123


>gi|107021758|ref|YP_620085.1| iron-sulfur cluster insertion protein ErpA [Burkholderia
           cenocepacia AU 1054]
 gi|116688704|ref|YP_834327.1| iron-sulfur cluster insertion protein ErpA [Burkholderia
           cenocepacia HI2424]
 gi|170732001|ref|YP_001763948.1| iron-sulfur cluster insertion protein ErpA [Burkholderia
           cenocepacia MC0-3]
 gi|206561684|ref|YP_002232449.1| iron-sulfur cluster insertion protein ErpA [Burkholderia
           cenocepacia J2315]
 gi|254246316|ref|ZP_04939637.1| HesB/YadR/YfhF [Burkholderia cenocepacia PC184]
 gi|123072406|sp|Q1BZ43|ERPA_BURCA RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|160380665|sp|A0K4K7|ERPA_BURCH RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|226694527|sp|B1JVU6|ERPA_BURCC RecName: Full=Putative iron--sulfur cluster insertion protein erpA
 gi|226694528|sp|B4EET4|ERPA_BURCJ RecName: Full=Putative iron--sulfur cluster insertion protein erpA
 gi|105891947|gb|ABF75112.1| HesB/YadR/YfhF [Burkholderia cenocepacia AU 1054]
 gi|116646793|gb|ABK07434.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           cenocepacia HI2424]
 gi|124871092|gb|EAY62808.1| HesB/YadR/YfhF [Burkholderia cenocepacia PC184]
 gi|169815243|gb|ACA89826.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           cenocepacia MC0-3]
 gi|198037726|emb|CAR53669.1| putative HesB-like protein [Burkholderia cenocepacia J2315]
          Length = 123

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y      +   D   +  
Sbjct: 14  MPLPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMN- 72

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 73  KNGVQLLIDSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV 123


>gi|302877601|ref|YP_003846165.1| iron-sulfur cluster assembly accessory protein [Gallionella
           capsiferriformans ES-2]
 gi|302580390|gb|ADL54401.1| iron-sulfur cluster assembly accessory protein [Gallionella
           capsiferriformans ES-2]
          Length = 119

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 1/109 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           D++  T+ A  ++K+++         +R+ +  GGC+G +Y          D   L  K+
Sbjct: 12  DLLVFTDNAAAKVKQLIEEEGNSELKLRVFVSGGGCSGFQYGFTFDEITNEDDTVLD-KN 70

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GV++ ID  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 71  GVQLLIDPMSYQYLVGAEIDYTEGLEGSQFVIKNPNATTTCGCGSSFSV 119


>gi|241766106|ref|ZP_04764017.1| iron-sulfur cluster assembly accessory protein [Acidovorax
           delafieldii 2AN]
 gi|241363859|gb|EER59179.1| iron-sulfur cluster assembly accessory protein [Acidovorax
           delafieldii 2AN]
          Length = 121

 Score =  136 bits (343), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 56/110 (50%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++ +++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 12  MPAPILFTDSAAAKVADLIAEEGNPDLKLRVFVQGGGCSGFQYGFTFDEITNEDDTTMT- 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV + ID+ S  Y++G EID+K +   + FV  NPN  S CGCG S  
Sbjct: 71  KNGVSLLIDAMSYQYLVGAEIDYKEDLQGAQFVIKNPNAASTCGCGSSFS 120


>gi|91774416|ref|YP_544172.1| HesB/YadR/YfhF [Methylobacillus flagellatus KT]
 gi|122399237|sp|Q1GXC7|ERPA_METFK RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|91708403|gb|ABE48331.1| HesB/YadR/YfhF [Methylobacillus flagellatus KT]
          Length = 117

 Score =  136 bits (343), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 1/109 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              +  T+ A  ++KE++         +R+ +  GGC+G +Y      +   + D  ++K
Sbjct: 9   PSPLIFTDNAARKVKELIDEEGSPDLKLRVFVSGGGCSGFQYGFTFE-ETINEDDTTVDK 67

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           DGV + ID  SL Y++G EID++     S FV  NPN  + CGCG S  
Sbjct: 68  DGVTLLIDPMSLQYLVGAEIDYQDSLQGSQFVIRNPNATTTCGCGSSFS 116


>gi|186477310|ref|YP_001858780.1| iron-sulfur cluster insertion protein ErpA [Burkholderia phymatum
           STM815]
 gi|226694530|sp|B2JGV0|ERPA_BURP8 RecName: Full=Putative iron--sulfur cluster insertion protein erpA
 gi|184193769|gb|ACC71734.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           phymatum STM815]
          Length = 121

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++KE++         +R+ ++ GGC+G +Y      +   + D ++ 
Sbjct: 12  MPAPFVFTDAAADKVKELIEEEGNPELKLRVFVQGGGCSGFQYGFTFD-EAINEDDTVMN 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 71  KSGVQLLIDSMSYQYLVGAEIDYKDDINGAQFVIKNPNATTTCGCGSSFSV 121


>gi|296156154|ref|ZP_06838993.1| iron-sulfur cluster assembly accessory protein [Burkholderia sp.
           Ch1-1]
 gi|295893660|gb|EFG73439.1| iron-sulfur cluster assembly accessory protein [Burkholderia sp.
           Ch1-1]
          Length = 124

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 52/108 (48%), Gaps = 1/108 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++  T  A  ++  ++         +R+ +  GGC+G +Y      D   D D     DG
Sbjct: 18  LLEFTPQAAAKVASLIEEEGNPNLKLRLYVSGGGCSGFQYGFAFD-DQVADDDMQTVTDG 76

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V + +DS SL Y+ G  +D++     S FV HNPN  S CGCG S  +
Sbjct: 77  VTLLVDSMSLQYLPGARVDYEDGLEGSRFVIHNPNAQSTCGCGSSFSV 124


>gi|260222313|emb|CBA31752.1| Putative iron-sulfur cluster insertion protein erpA [Curvibacter
           putative symbiont of Hydra magnipapillata]
          Length = 128

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 56/110 (50%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++ +++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 19  MPAPILFTDSAAAKVADLIAEEGNPDLKLRVFVQGGGCSGFQYGFTFDEITNEDDTTMT- 77

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV + ID+ S  Y++G EID+K +   + FV  NPN  + CGCG S  
Sbjct: 78  KNGVSLLIDAMSYQYLVGAEIDYKEDLQGAQFVIKNPNATTTCGCGSSFS 127


>gi|134093528|ref|YP_001098603.1| iron-sulfur cluster insertion protein ErpA [Herminiimonas
           arsenicoxydans]
 gi|160380709|sp|A4G1T7|ERPA_HERAR RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|133737431|emb|CAL60474.1| Iron-binding protein ErpA (Iron-sulfur cluster insertion protein)
           [Herminiimonas arsenicoxydans]
          Length = 116

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 58/110 (52%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  +++A  ++ E++ +       +R+ ++ GGC+G +Y          D   +  
Sbjct: 7   MPSPILFSDSAAAKVAELIEDEGNPDLKLRVFVQGGGCSGFQYGFTFDEIVNEDDTTMT- 65

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  
Sbjct: 66  KNGVQLLIDSMSYQYLVGAEIDYKDDLEGAQFVIKNPNATTTCGCGSSFT 115


>gi|91789948|ref|YP_550900.1| iron-sulfur cluster insertion protein ErpA [Polaromonas sp. JS666]
 gi|123355257|sp|Q124P0|ERPA_POLSJ RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|91699173|gb|ABE46002.1| HesB/YadR/YfhF [Polaromonas sp. JS666]
          Length = 121

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T++A  ++ E++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 12  MPAPFVFTDSAAAKVAELIAEEGNPDLKLRVFVQGGGCSGFQYGFTFDEITNEDDTTMT- 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV + ID+ S  Y++G EID+K +   + FV  NPN  S CGCG S  
Sbjct: 71  KNGVSLLIDAMSYQYLVGAEIDYKDDLEGAQFVIKNPNATSTCGCGSSFS 120


>gi|118594134|ref|ZP_01551481.1| hypothetical protein MB2181_00660 [Methylophilales bacterium
           HTCC2181]
 gi|118439912|gb|EAV46539.1| hypothetical protein MB2181_00660 [Methylophilales bacterium
           HTCC2181]
          Length = 117

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   V  T+ AV ++K ++         +R+ +  GGC+G +Y      ++  D D  + 
Sbjct: 8   MPTPVNFTDNAVNKVKTLIEEEGTPDLKLRVFVSGGGCSGFQYGFTFE-ESVNDDDTQVT 66

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KD V + ID  SL Y+ G EID++     S FV  NPN  + CGCG S  +
Sbjct: 67  KDTVTLLIDPMSLQYLTGAEIDYQDNVQGSQFVIKNPNAETTCGCGSSFSV 117


>gi|255022235|ref|ZP_05294230.1| probable iron binding protein from the HesB_IscA_SufA family
           [Acidithiobacillus caldus ATCC 51756]
 gi|254968326|gb|EET25893.1| probable iron binding protein from the HesB_IscA_SufA family
           [Acidithiobacillus caldus ATCC 51756]
          Length = 123

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 1/109 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T+T  A  +IK ++         +R+ +  GGC+G +Y      +N  DGD  +E+
Sbjct: 15  PPVMTLTTNAAEKIKSLIEEEGSADLKLRVFVTGGGCSGFQYGFTFD-ENVNDGDTEVEQ 73

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            GV + +D  S  Y++G EID+      + FV  NPN  + CGCG S  
Sbjct: 74  HGVTLLVDPMSYQYLVGAEIDYSEGLEGAQFVIKNPNATTTCGCGSSFS 122


>gi|52425362|ref|YP_088499.1| IscA protein [Mannheimia succiniciproducens MBEL55E]
 gi|81387009|sp|Q65SZ6|ERPA_MANSM RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|52307414|gb|AAU37914.1| IscA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 113

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/114 (36%), Positives = 64/114 (56%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           M+D+   +T T+AA  ++K ++   + +   +R+ +  GGC+G +Y      +   DGD 
Sbjct: 1   MTDMTIPLTFTDAAAKKVKNLIIEEENQDLKLRVYITGGGCSGFQYGFTFD-EKVNDGDL 59

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IE DGVK+ ID  SL Y++G  +D+      S FV HNPN  + CGCG S  I
Sbjct: 60  TIENDGVKLVIDPMSLQYLIGGTVDYTEGLEGSRFVVHNPNATTTCGCGSSFSI 113


>gi|209517520|ref|ZP_03266360.1| iron-sulfur cluster assembly accessory protein [Burkholderia sp.
           H160]
 gi|209502053|gb|EEA02069.1| iron-sulfur cluster assembly accessory protein [Burkholderia sp.
           H160]
          Length = 121

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y      +   + D ++ 
Sbjct: 12  MPAPFVFTDAAADKVKQLIDEEGNPELKLRVFVQGGGCSGFQYGFTFD-EAINEDDTVMN 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV++ IDS S  Y++G EID+K +   + FV  NPN  S CGCG S  +
Sbjct: 71  KSGVQLLIDSMSYQYLVGAEIDYKDDINGAQFVIKNPNATSTCGCGSSFSV 121


>gi|120553628|ref|YP_957979.1| iron-sulfur cluster assembly accessory protein [Marinobacter
           aquaeolei VT8]
 gi|160385711|sp|A1TYH3|ERPA_MARAV RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|120323477|gb|ABM17792.1| iron-sulfur cluster assembly accessory protein [Marinobacter
           aquaeolei VT8]
          Length = 110

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 63/111 (56%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +  T+ AV +++E++   +     +R+ +  GGC+G +Y      ++  + D +IE
Sbjct: 1   MATPLFFTDNAVAKVRELIEEEENPDLKLRVFVTGGGCSGFQYGFSFD-ESQEEDDTVIE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +DGVK+ +DS S  Y++G  ID++     S FV  NPN  S CGCG S  I
Sbjct: 60  RDGVKLLVDSMSYQYLVGATIDYQEGLQGSQFVVQNPNASSTCGCGSSFSI 110


>gi|220935574|ref|YP_002514473.1| iron-sulfur cluster insertion protein ErpA [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219996884|gb|ACL73486.1| iron-sulfur cluster insertion protein ErpA [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 120

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++K ++      A  +R+ +  GGC+G +Y      +N  DGD ++E
Sbjct: 11  MPSPLIFTDSAASKVKSLIEEENNNALKLRVFVSGGGCSGFQYGFTFD-ENVNDGDTVVE 69

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV + ID  S  Y++G EID+      + FV  NPN  + CGCG S  +
Sbjct: 70  KGGVTLLIDPMSFQYLMGAEIDYTEGLEGAQFVIRNPNATTTCGCGSSFSV 120


>gi|261868216|ref|YP_003256138.1| iron-sulfur cluster insertion protein ErpA [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|293390268|ref|ZP_06634602.1| iron-sulfur cluster insertion protein ErpA [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|261413548|gb|ACX82919.1| iron-sulfur cluster insertion protein ErpA [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|290950802|gb|EFE00921.1| iron-sulfur cluster insertion protein ErpA [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 113

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/114 (35%), Positives = 63/114 (55%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           M++I   +T T+AA  ++K ++   +  A  +R+ +  GGC+G +Y      +   DGD 
Sbjct: 1   MTEISVPLTFTDAAAQKVKTLITEEENPALKLRVYITGGGCSGFQYGFTFD-EKVNDGDL 59

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +E  GV++ ID  SL Y++G  +D+      S FV +NPN  S CGCG S  I
Sbjct: 60  TVENSGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFVVNNPNATSTCGCGSSFSI 113


>gi|190576115|ref|YP_001973960.1| iron-sulfur cluster insertion protein ErpA [Stenotrophomonas
           maltophilia K279a]
 gi|254524686|ref|ZP_05136741.1| HesB/YadR/YfhF [Stenotrophomonas sp. SKA14]
 gi|226694574|sp|B2FJT4|ERPA_STRMK RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|190014037|emb|CAQ47677.1| putative iron-sulphur biosynthesis protein [Stenotrophomonas
           maltophilia K279a]
 gi|219722277|gb|EED40802.1| HesB/YadR/YfhF [Stenotrophomonas sp. SKA14]
          Length = 130

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 31/106 (29%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TE+A  ++K ++         +R+ ++ GGC+G +Y  +   +N  + D  ++  GV
Sbjct: 25  LNFTESAAAKVKSLIQEEGNPDLALRVYIEGGGCSGFQYGFEFD-ENRAEDDLAVQTSGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            + +D  SL Y++G E+D+      + FV  NPN  + CGCG S  
Sbjct: 84  TLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFS 129


>gi|224824787|ref|ZP_03697894.1| iron-sulfur cluster assembly accessory protein [Lutiella
           nitroferrum 2002]
 gi|224603280|gb|EEG09456.1| iron-sulfur cluster assembly accessory protein [Lutiella
           nitroferrum 2002]
          Length = 116

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 31/111 (27%), Positives = 53/111 (47%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  +++++V         +R+ +  GGC+G +Y          D   +  
Sbjct: 7   MPSPIAFTDSACSKVRDLVAEEGNPDLKLRVFVTGGGCSGFQYGFTFDEIVNEDDTAIER 66

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +GV   +D  S  Y++G EID++     S FV  NPN  + CGCG S  +
Sbjct: 67  -EGVTFLVDPMSYQYLVGAEIDYQESLEGSQFVIRNPNAETTCGCGSSFSV 116


>gi|307730953|ref|YP_003908177.1| iron-sulfur cluster assembly accessory protein [Burkholderia sp.
           CCGE1003]
 gi|307585488|gb|ADN58886.1| iron-sulfur cluster assembly accessory protein [Burkholderia sp.
           CCGE1003]
          Length = 121

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 57/111 (51%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 12  MPAPFVFTDAAADKVKQLIEEEGNADLKLRVFVQGGGCSGFQYGFTFDEAVNEDDTVMN- 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 71  KSGVQLLIDSMSYQYLVGAEIDYKDDINGAQFVIKNPNATTTCGCGSSFSV 121


>gi|91785171|ref|YP_560377.1| iron-sulfur cluster insertion protein ErpA [Burkholderia xenovorans
           LB400]
 gi|187925325|ref|YP_001896967.1| iron-sulfur cluster insertion protein ErpA [Burkholderia
           phytofirmans PsJN]
 gi|296162972|ref|ZP_06845749.1| iron-sulfur cluster assembly accessory protein [Burkholderia sp.
           Ch1-1]
 gi|323527317|ref|YP_004229470.1| iron-sulfur cluster assembly accessory protein [Burkholderia sp.
           CCGE1001]
 gi|123168083|sp|Q13UB4|ERPA1_BURXL RecName: Full=Putative iron-sulfur cluster insertion protein erpA 1
 gi|226694531|sp|B2SYK8|ERPA_BURPP RecName: Full=Putative iron--sulfur cluster insertion protein erpA
 gi|91689125|gb|ABE32325.1| HesB/YadR/YfhF family protein [Burkholderia xenovorans LB400]
 gi|187716519|gb|ACD17743.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           phytofirmans PsJN]
 gi|295886766|gb|EFG66607.1| iron-sulfur cluster assembly accessory protein [Burkholderia sp.
           Ch1-1]
 gi|323384319|gb|ADX56410.1| iron-sulfur cluster assembly accessory protein [Burkholderia sp.
           CCGE1001]
          Length = 121

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 57/111 (51%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 12  MPAPFVFTDAAADKVKQLIEEEGNADLKLRVFVQGGGCSGFQYGFTFDEAVNEDDTVMN- 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 71  KSGVQLLIDSMSYQYLVGAEIDYKDDINGAQFVIKNPNATTTCGCGSSFSV 121


>gi|251792354|ref|YP_003007079.1| iron-sulfur cluster insertion protein ErpA [Aggregatibacter
           aphrophilus NJ8700]
 gi|247533746|gb|ACS96992.1| conserved hypothetical protein, putative [Aggregatibacter
           aphrophilus NJ8700]
          Length = 113

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/114 (35%), Positives = 63/114 (55%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           M+DI   +T T+AA  ++K ++   +  A  +R+ +  GGC+G +Y      +   DGD 
Sbjct: 1   MTDISVPLTFTDAAAQKVKSLISEEENPALKLRVYITGGGCSGFQYGFTFD-EKVNDGDL 59

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +E  GV++ ID  SL Y++G  +D+      S FV +NPN  S CGCG S  I
Sbjct: 60  TVENSGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFVVNNPNASSTCGCGSSFSI 113


>gi|295677654|ref|YP_003606178.1| iron-sulfur cluster assembly accessory protein [Burkholderia sp.
           CCGE1002]
 gi|295437497|gb|ADG16667.1| iron-sulfur cluster assembly accessory protein [Burkholderia sp.
           CCGE1002]
          Length = 121

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M      T+AA  ++K+++         +R+ ++ GGC+G +Y      +   + D ++ 
Sbjct: 12  MPAPFVFTDAAADKVKQLIDEEGNPELKLRVFVQGGGCSGFQYGFTFD-EAINEDDTVMN 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 71  KSGVQLLIDSMSYQYLVGAEIDYKDDINGAQFVIKNPNATTTCGCGSSFSV 121


>gi|332286789|ref|YP_004418700.1| iron-sulfur cluster insertion protein ErpA [Pusillimonas sp. T7-7]
 gi|330430742|gb|AEC22076.1| iron-sulfur cluster insertion protein ErpA [Pusillimonas sp. T7-7]
          Length = 122

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 61/109 (55%), Gaps = 1/109 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              +  T+AA +++KE++ +       +R+ ++ GGC+G +Y      +   D D  I+K
Sbjct: 14  PSPLIFTDAAAHKVKELLADEDNPELKLRVFVQGGGCSGFQYGFTFD-ETINDDDTTIDK 72

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +GV++ +D  S  Y++G EID+K +   + FV  NPN  S CGCG S  
Sbjct: 73  EGVQLLVDPMSFQYLVGAEIDYKDDLEGAQFVIRNPNANSTCGCGSSFA 121


>gi|285017119|ref|YP_003374830.1| iron-sulfur cluster assembly accessory protein [Xanthomonas
           albilineans GPE PC73]
 gi|283472337|emb|CBA14843.1| hypothetical iron-sulfur cluster assembly accessory protein
           [Xanthomonas albilineans]
          Length = 128

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T AA  +++E++      A  +R+ ++ GGC+G +Y  +   +N  + D  ++ D V
Sbjct: 23  LNFTSAAAAKVRELIREEGNDALALRVYIQGGGCSGFQYGFEFD-ENRAEDDLAVQTDAV 81

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G E+D+      + FV  NPN  + CGCG S  +
Sbjct: 82  TLLVDPLSLQYLMGAEVDYSEGLHGAQFVIRNPNAKTTCGCGSSFSV 128


>gi|17545213|ref|NP_518615.1| iron-sulfur cluster insertion protein ErpA [Ralstonia solanacearum
           GMI1000]
 gi|83749317|ref|ZP_00946314.1| HesB protein family [Ralstonia solanacearum UW551]
 gi|207727939|ref|YP_002256333.1| hypothetical protein RSMK04258 [Ralstonia solanacearum MolK2]
 gi|207742343|ref|YP_002258735.1| hypothetical protein RSIPO_00530 [Ralstonia solanacearum IPO1609]
 gi|300692498|ref|YP_003753493.1| ironi-binding protein ErpA (ironi-sulfur cluster insertion protein)
           [Ralstonia solanacearum PSI07]
 gi|300705148|ref|YP_003746751.1| iron-binding protein ErpA [Ralstonia solanacearum CFBP2957]
 gi|81506514|sp|Q8Y242|ERPA_RALSO RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|17427504|emb|CAD14022.1| conserved hypothetical protein [Ralstonia solanacearum GMI1000]
 gi|83723995|gb|EAP71176.1| HesB protein family [Ralstonia solanacearum UW551]
 gi|206591181|emb|CAQ56793.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
 gi|206593733|emb|CAQ60660.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
 gi|299067946|emb|CBJ39160.1| Iron-binding protein ErpA (Iron-sulfur cluster insertion protein)
           [Ralstonia solanacearum CMR15]
 gi|299072812|emb|CBJ44167.1| Iron-binding protein ErpA (Iron-sulfur cluster insertion protein)
           [Ralstonia solanacearum CFBP2957]
 gi|299079558|emb|CBJ52236.1| Iron-binding protein ErpA (Iron-sulfur cluster insertion protein)
           [Ralstonia solanacearum PSI07]
          Length = 124

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 57/105 (54%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T++A  ++K+++         +R+ ++ GGC+G +Y      D   D   +  K+GV +
Sbjct: 21  FTDSAADKVKQLIEEEGNPELKLRVFVQGGGCSGFQYGFTFDEDTNEDDTTMT-KNGVTL 79

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 80  LIDSMSYQYLVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV 124


>gi|291614907|ref|YP_003525064.1| iron-sulfur cluster assembly accessory protein [Sideroxydans
           lithotrophicus ES-1]
 gi|291585019|gb|ADE12677.1| iron-sulfur cluster assembly accessory protein [Sideroxydans
           lithotrophicus ES-1]
          Length = 116

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 1/109 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           D +  T+ A  ++K+++         +R+ +  GGC+G +Y          D   +  K+
Sbjct: 9   DPLLFTDNAANKVKQLIEEEGNAELKLRVFVSGGGCSGFQYGFTFDEVANEDDTVMN-KN 67

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GV++ ID  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 68  GVQLLIDPMSFQYLVGAEIDYTEGLEGSQFVIKNPNATTTCGCGSSFSV 116


>gi|315634452|ref|ZP_07889738.1| iron-sulfur cluster insertion protein ErpA [Aggregatibacter segnis
           ATCC 33393]
 gi|315476810|gb|EFU67556.1| iron-sulfur cluster insertion protein ErpA [Aggregatibacter segnis
           ATCC 33393]
          Length = 113

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/114 (31%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           M++I   +T T+AA  ++K ++   +  A  +R+ +  GGC+G +Y              
Sbjct: 1   MTEISVPLTFTDAAAQKVKSLITEEENPALKLRVYITGGGCSGFQYGFTFDEKVNEGDLT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +    GV++ +D  SL Y++G  ID+      S FV +NPN  S CGCG S  I
Sbjct: 61  VENA-GVQLVVDPMSLQYLIGGTIDYTEGLEGSRFVVNNPNASSTCGCGSSFSI 113


>gi|292493540|ref|YP_003528979.1| iron-sulfur cluster assembly accessory protein [Nitrosococcus
           halophilus Nc4]
 gi|291582135|gb|ADE16592.1| iron-sulfur cluster assembly accessory protein [Nitrosococcus
           halophilus Nc4]
          Length = 119

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 56/111 (50%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T+AA  ++KE++         +R+ +  GGC+G +Y      +   +GD  +E
Sbjct: 10  MPSPLIFTDAAASKVKELIEEEGNDKLMLRVFISGGGCSGFQYGFTFD-ETCHEGDTQVE 68

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GV + ID  S  Y++G EID+      + FV  NPN  + CGCG S  +
Sbjct: 69  NGGVTLLIDPTSYQYLVGAEIDYTEGLEGAQFVIRNPNAATTCGCGSSFSV 119


>gi|237747469|ref|ZP_04577949.1| iron-sulfur cluster insertion protein ErpA [Oxalobacter formigenes
           HOxBLS]
 gi|229378820|gb|EEO28911.1| iron-sulfur cluster insertion protein ErpA [Oxalobacter formigenes
           HOxBLS]
          Length = 116

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 59/110 (53%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T+ AV ++ E++         +R+ ++ GGCAG +Y      +N  + D  + 
Sbjct: 7   MPAPINFTDNAVKKVAELIAEEGNPNLKLRVFVQGGGCAGFQYGFTFD-ENINEDDTTMM 65

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           KDG+++ ID  S  Y++G EID+K +   + FV  NPN  + CGCG S  
Sbjct: 66  KDGIQLLIDPMSYQYLVGAEIDYKEDINGAQFVIKNPNVTTTCGCGSSFA 115


>gi|53804946|ref|YP_113251.1| HesB/YadR/YfhF family protein [Methylococcus capsulatus str. Bath]
 gi|81682670|sp|Q60AU6|ERPA2_METCA RecName: Full=Iron-sulfur cluster insertion protein erpA 2
 gi|53758707|gb|AAU92998.1| HesB/YadR/YfhF family protein [Methylococcus capsulatus str. Bath]
          Length = 130

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T++A  R+ E++     +   +R+ +  GGC+G +Y          D   +  K+GV
Sbjct: 25  IKFTDSAAQRVSELLAEEGDQNLKLRVYVTGGGCSGFQYGFTFDEVVNEDDTVVE-KNGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  SL Y+ G EID+      S FV  NPN  + CGCG S  +
Sbjct: 84  SVLVDPMSLQYLQGAEIDYTENVSGSQFVIRNPNATTTCGCGSSFSV 130


>gi|71906293|ref|YP_283880.1| iron-sulfur cluster insertion protein ErpA [Dechloromonas aromatica
           RCB]
 gi|123628153|sp|Q47IC1|ERPA_DECAR RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|71845914|gb|AAZ45410.1| HesB/YadR/YfhF [Dechloromonas aromatica RCB]
          Length = 116

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+     T+ A  ++KE++         +R+ +  GGC+G +Y      +   D   +  
Sbjct: 7   MAVPFVFTDNAAGKVKELIEEEGNPGLKLRVFVTGGGCSGFQYGFTFDEEVNEDDTTME- 65

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV + ID  S  Y++G EID+      S FV  NPN  S CGCG S  
Sbjct: 66  KNGVTLLIDPMSYQYLVGAEIDYTEGLEGSQFVIRNPNATSTCGCGSSFS 115


>gi|152981570|ref|YP_001351989.1| iron-sulfur cluster insertion protein ErpA [Janthinobacterium sp.
           Marseille]
 gi|160385709|sp|A6SUP2|ERPA_JANMA RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|151281647|gb|ABR90057.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 116

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  +++A  ++ E++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 7   MPSPIVFSDSAAMKVAELIEEEGNPDLKLRVFVQGGGCSGFQYGFTFDEIVNEDDTTMT- 65

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  
Sbjct: 66  KNGVQLLIDSMSYQYLVGAEIDYKDDLEGAQFVIKNPNATTTCGCGSSFS 115


>gi|187927473|ref|YP_001897960.1| iron-sulfur cluster insertion protein ErpA [Ralstonia pickettii
           12J]
 gi|241662003|ref|YP_002980363.1| iron-sulfur cluster insertion protein ErpA [Ralstonia pickettii
           12D]
 gi|309779825|ref|ZP_07674580.1| iron-sulfur cluster insertion protein ErpA [Ralstonia sp.
           5_7_47FAA]
 gi|226694555|sp|B2UFK5|ERPA_RALPJ RecName: Full=Putative iron--sulfur cluster insertion protein erpA
 gi|187724363|gb|ACD25528.1| iron-sulfur cluster assembly accessory protein [Ralstonia pickettii
           12J]
 gi|240864030|gb|ACS61691.1| iron-sulfur cluster assembly accessory protein [Ralstonia pickettii
           12D]
 gi|308921402|gb|EFP67044.1| iron-sulfur cluster insertion protein ErpA [Ralstonia sp.
           5_7_47FAA]
          Length = 124

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 57/105 (54%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T++A  ++K+++         +R+ ++ GGC+G +Y      +   D   +  K+GV +
Sbjct: 21  FTDSAADKVKQLIEEEGNPELKLRVFVQGGGCSGFQYGFTFDEETNEDDTTMT-KNGVSL 79

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 80  LIDSMSYQYLVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV 124


>gi|317122268|ref|YP_004102271.1| iron-sulfur cluster assembly accessory protein [Thermaerobacter
           marianensis DSM 12885]
 gi|315592248|gb|ADU51544.1| iron-sulfur cluster assembly accessory protein [Thermaerobacter
           marianensis DSM 12885]
          Length = 124

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 63/111 (56%), Gaps = 1/111 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T  A  +++E++   +     +R+ ++ GGC+G  Y +     N  D D +IE+DG
Sbjct: 1   MITLTPEAARKVRELLAERRRDDLALRVFVQPGGCSGFSYGLAFD-SNRSDDDQVIEQDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           ++V +D+ S  ++ G +ID+      SGF  HNPN +  CGCGQS   +  
Sbjct: 60  IRVVVDAMSARFLKGAQIDYVESLAGSGFAIHNPNAIHTCGCGQSFRTRDE 110


>gi|192362320|ref|YP_001981396.1| HesB/YadR/YfhF family protein [Cellvibrio japonicus Ueda107]
 gi|190688485|gb|ACE86163.1| HesB/YadR/YfhF family protein [Cellvibrio japonicus Ueda107]
          Length = 117

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 61/110 (55%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             +VT+T++AV +++ ++         +R+ +  GGC+G +Y      +   + D ++E+
Sbjct: 9   PQVVTVTDSAVAKVRSLIEEEGNADLKLRVYVTGGGCSGFQYGFTFD-ELVAEDDSVVER 67

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GVKV +D+ S  Y+ G ++D++     S FV  NPN  S CGCG S  +
Sbjct: 68  GGVKVVVDAMSYPYLAGAQVDYEEGLQGSKFVIQNPNASSTCGCGSSFSL 117


>gi|303258280|ref|ZP_07344287.1| iron-sulfur cluster insertion protein ErpA [Burkholderiales
           bacterium 1_1_47]
 gi|302859033|gb|EFL82117.1| iron-sulfur cluster insertion protein ErpA [Burkholderiales
           bacterium 1_1_47]
          Length = 123

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            D +  T+AA  ++KE++         +R+ ++ GGC+G +Y          D   ++  
Sbjct: 15  PDPIIFTDAASLKVKELIDEEGNPNLKLRVFVQGGGCSGFQYGFTFDETTNEDDAVMVR- 73

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +GV + IDS S  Y++G EID+K +   + FV  NPN  + C CG S  +
Sbjct: 74  NGVTLLIDSMSYQYLVGAEIDYKEDLEGAQFVIKNPNATTTCSCGSSFSV 123


>gi|331001113|ref|ZP_08324744.1| iron-sulfur cluster insertion protein ErpA [Parasutterella
           excrementihominis YIT 11859]
 gi|329569418|gb|EGG51196.1| iron-sulfur cluster insertion protein ErpA [Parasutterella
           excrementihominis YIT 11859]
          Length = 123

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            D +  T+AA  ++KE++         +R+ ++ GGC+G +Y          D   ++  
Sbjct: 15  PDPIIFTDAASLKVKELIDEEGNPNLKLRVFVQGGGCSGFQYGFTFDETTNEDDAVMVR- 73

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +GV + IDS S  Y++G EID+K +   + FV  NPN  + C CG S  +
Sbjct: 74  NGVTLLIDSMSYQYLVGAEIDYKEDLEGAQFVIKNPNATTTCSCGSSFSV 123


>gi|237747557|ref|ZP_04578037.1| iron-sulfur cluster insertion protein ErpA [Oxalobacter formigenes
           OXCC13]
 gi|229378919|gb|EEO29010.1| iron-sulfur cluster insertion protein ErpA [Oxalobacter formigenes
           OXCC13]
          Length = 116

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T++A  ++ E++         +R+ ++ GGC+G +Y          D   ++ KDGV
Sbjct: 11  INFTDSAAKKVAELIAEEGNPNLKLRVFVQGGGCSGFQYGFTFDEKVNEDDTSMM-KDGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           ++ ID  S  Y++G EID+K +   + FV  NPN  S CGCG S  
Sbjct: 70  ELLIDPMSYQYLVGAEIDYKEDINGAQFVIKNPNVTSTCGCGSSFA 115


>gi|325578505|ref|ZP_08148605.1| iron-sulfur cluster insertion protein ErpA [Haemophilus
           parainfluenzae ATCC 33392]
 gi|301156365|emb|CBW15836.1| conserved protein [Haemophilus parainfluenzae T3T1]
 gi|325159741|gb|EGC71871.1| iron-sulfur cluster insertion protein ErpA [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 115

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 56/111 (50%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +T T+AA  ++K ++   +     +R+ +  GGC+G +Y              +  
Sbjct: 6   MAVPLTFTDAAANKVKSLISEEENNELKLRVYITGGGCSGFQYGFTFDDKVNEGDLTIE- 64

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV++ ID  SL Y++G  +D+      S FV +NPN  S CGCG S  I
Sbjct: 65  KAGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFVVNNPNATSTCGCGSSFSI 115


>gi|21229963|ref|NP_635880.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66766839|ref|YP_241601.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|188989912|ref|YP_001901922.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas campestris
           pv. campestris str. B100]
 gi|81307172|sp|Q4UZE2|ERPA_XANC8 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|81796909|sp|Q8PD57|ERPA_XANCP RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|226694576|sp|B0RN15|ERPA_XANCB RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|21111476|gb|AAM39804.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572171|gb|AAY47581.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167731672|emb|CAP49850.1| putative Iron-sulfur cluster assembly protein [Xanthomonas
           campestris pv. campestris]
          Length = 128

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  + AA  +++E++         +R+ ++ GGC+G +Y  +   +N  + D  +  DGV
Sbjct: 23  LNFSNAAAAKVRELIQEEGNAELALRVYIQGGGCSGFQYGFEFD-ENRAEDDLAVATDGV 81

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G E+D+      + FV  NPN  + CGCG S  +
Sbjct: 82  TLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV 128


>gi|16273609|ref|NP_439864.1| iron-sulfur cluster insertion protein ErpA [Haemophilus influenzae
           Rd KW20]
 gi|145629181|ref|ZP_01784980.1| hypothetical protein CGSHi22121_10275 [Haemophilus influenzae
           22.1-21]
 gi|145639124|ref|ZP_01794731.1| hypothetical protein CGSHiII_03779 [Haemophilus influenzae PittII]
 gi|260581063|ref|ZP_05848885.1| FeS assembly scaffold SufA [Haemophilus influenzae RdAW]
 gi|260582821|ref|ZP_05850607.1| FeS assembly scaffold SufA [Haemophilus influenzae NT127]
 gi|329123177|ref|ZP_08251746.1| iron-sulfur cluster insertion protein ErpA [Haemophilus aegyptius
           ATCC 11116]
 gi|1175501|sp|P45344|ERPA_HAEIN RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|116666731|pdb|2APN|A Chain A, Hi1723 Solution Structure
 gi|1574579|gb|AAC23369.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|144978684|gb|EDJ88407.1| hypothetical protein CGSHi22121_10275 [Haemophilus influenzae
           22.1-21]
 gi|145271686|gb|EDK11596.1| hypothetical protein CGSHiII_03779 [Haemophilus influenzae PittII]
 gi|260092303|gb|EEW76244.1| FeS assembly scaffold SufA [Haemophilus influenzae RdAW]
 gi|260094147|gb|EEW78049.1| FeS assembly scaffold SufA [Haemophilus influenzae NT127]
 gi|301170475|emb|CBW30082.1| conserved protein [Haemophilus influenzae 10810]
 gi|309750705|gb|ADO80689.1| Iron-sulfur cluster insertion protein ErpA [Haemophilus influenzae
           R2866]
 gi|327471522|gb|EGF16966.1| iron-sulfur cluster insertion protein ErpA [Haemophilus aegyptius
           ATCC 11116]
          Length = 114

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +T T+AA  ++K ++   +     +R+ +  GGC+G +Y      +   DGD  IE
Sbjct: 5   MAVPLTFTDAAANKVKSLISEEENTDLKLRVYITGGGCSGFQYGFTFD-EKVNDGDLTIE 63

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV++ ID  SL Y++G  +D+      S F  +NPN  S CGCG S  I
Sbjct: 64  KSGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI 114


>gi|74316474|ref|YP_314214.1| HesB-like protein [Thiobacillus denitrificans ATCC 25259]
 gi|123611076|sp|Q3SF18|ERPA_THIDA RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|74055969|gb|AAZ96409.1| HesB-like protein [Thiobacillus denitrificans ATCC 25259]
          Length = 116

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++K ++         +R+ +  GGC+G +Y          D   ++ 
Sbjct: 7   MESPLVFTDSAASKVKSLIDEEGNPDLKLRVFVSGGGCSGFQYGFTFDEAQNADDTVMV- 65

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV + +DS S  Y++G EID+      + FV  NPN  + CGCG S  
Sbjct: 66  KNGVTLLVDSMSFQYLVGAEIDYSEGLEGAQFVIKNPNATTTCGCGSSFS 115


>gi|171464165|ref|YP_001798278.1| iron-sulfur cluster assembly accessory protein [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|171193703|gb|ACB44664.1| iron-sulfur cluster assembly accessory protein [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 128

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 1/104 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T++A  ++ +++         +R+ ++ GGC+G +Y          D      K+GV +
Sbjct: 25  FTDSAAAKVADLIAEEGNPELKLRVFVQGGGCSGFQYGFTFDDAVNEDDTLFE-KNGVTL 83

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            +DS S  Y++G EID+K +   S FV  NPN  + CGCG S  
Sbjct: 84  LVDSMSFQYLVGAEIDYKEDINGSQFVIKNPNAQTTCGCGSSFS 127


>gi|91778664|ref|YP_553872.1| iron-sulfur cluster insertion protein ErpA [Burkholderia xenovorans
           LB400]
 gi|123167432|sp|Q13N17|ERPA2_BURXL RecName: Full=Putative iron-sulfur cluster insertion protein erpA 2
 gi|91691324|gb|ABE34522.1| HesB/YadR/YfhF [Burkholderia xenovorans LB400]
          Length = 124

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 52/108 (48%), Gaps = 1/108 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++  T  A  ++  ++         +R+ +  GGC+G +Y      D   D D     DG
Sbjct: 18  LLEFTRQAAAKVASLIEEEGNPNLKLRLYVSGGGCSGFQYGFAFD-DQVADDDMQTVTDG 76

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V + +DS SL Y+ G  +D++     S FV HNPN  S CGCG S  +
Sbjct: 77  VTLLVDSMSLQYLPGARVDYEDGLEGSRFVIHNPNAQSTCGCGSSFSV 124


>gi|329909870|ref|ZP_08275141.1| putative iron binding protein from the HesB IscA SufA family
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327546388|gb|EGF31400.1| putative iron binding protein from the HesB IscA SufA family
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 116

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  +++A  ++ +++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 7   MPAPILFSDSAAMKVAQLIEEEGNPDLKLRVFVQGGGCSGFQYGFTFDEIANEDDTTMT- 65

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV++ IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  
Sbjct: 66  KNGVQLLIDSMSYQYLVGAEIDYKDDLEGAQFVIKNPNATTTCGCGSSFS 115


>gi|68250321|ref|YP_249433.1| iron-sulfur cluster insertion protein ErpA [Haemophilus influenzae
           86-028NP]
 gi|145641016|ref|ZP_01796597.1| hypothetical protein CGSHiR3021_08101 [Haemophilus influenzae
           R3021]
 gi|148827141|ref|YP_001291894.1| iron-sulfur cluster insertion protein ErpA [Haemophilus influenzae
           PittGG]
 gi|319776022|ref|YP_004138510.1| hypothetical protein HICON_13690 [Haemophilus influenzae F3047]
 gi|319896793|ref|YP_004134987.1| hypothetical protein HIBPF04670 [Haemophilus influenzae F3031]
 gi|81335259|sp|Q4QJM4|ERPA_HAEI8 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160380676|sp|A5UFF5|ERPA_HAEIG RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|68058520|gb|AAX88773.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP]
 gi|145274177|gb|EDK14042.1| hypothetical protein CGSHiR3021_08101 [Haemophilus influenzae
           22.4-21]
 gi|148718383|gb|ABQ99510.1| methionine aminopeptidase [Haemophilus influenzae PittGG]
 gi|317432296|emb|CBY80649.1| conserved hypothetical protein [Haemophilus influenzae F3031]
 gi|317450613|emb|CBY86832.1| conserved hypothetical protein [Haemophilus influenzae F3047]
          Length = 114

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +T T+AA  ++K ++   +     +R+ +  GGC+G +Y      +   DGD  IE
Sbjct: 5   MAVPLTFTDAAANKVKSLISEEENTNLKLRVYITGGGCSGFQYGFTFD-EKVNDGDLTIE 63

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV++ ID  SL Y++G  +D+      S F  +NPN  S CGCG S  I
Sbjct: 64  KSGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI 114


>gi|307825815|ref|ZP_07656031.1| iron-sulfur cluster assembly accessory protein [Methylobacter
           tundripaludum SV96]
 gi|307733123|gb|EFO03984.1| iron-sulfur cluster assembly accessory protein [Methylobacter
           tundripaludum SV96]
          Length = 110

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS+ +  T++A  ++ E++         +R+ +  GGC+G +Y      +   D   +  
Sbjct: 1   MSNPIVFTDSAASKVGELIAEEGNDNLKLRVYVSGGGCSGFQYGFTFDEEVNEDDTCVEN 60

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             GV V IDS S+ Y+ G EID+K +   + FV  NPN  + CGCG S  
Sbjct: 61  -GGVTVLIDSMSIQYLTGAEIDYKEDLSGAQFVIRNPNATTTCGCGSSFS 109


>gi|56475933|ref|YP_157522.1| iron-sulfur cluster insertion protein ErpA [Aromatoleum aromaticum
           EbN1]
 gi|81358430|sp|Q5P7U0|ERPA_AZOSE RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|56311976|emb|CAI06621.1| conserved hypothetical protein [Aromatoleum aromaticum EbN1]
          Length = 116

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 1/109 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            +++  T++A  ++KE++         +R+ +  GGC+G +Y      +   D      K
Sbjct: 8   PELMVFTDSAAMKVKELIEEEGNPELKLRVFVSGGGCSGFQYGFTFDEEVNEDDTAFE-K 66

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +GV + +D  S  Y++G EID+      S FV  NPN  S CGCG S  
Sbjct: 67  NGVTLLVDPMSYQYLVGAEIDYSEGLEGSQFVIRNPNATSTCGCGSSFS 115


>gi|198284753|ref|YP_002221074.1| iron-sulfur cluster assembly accessory protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218666508|ref|YP_002427434.1| iron-sulfur cluster assembly accessory protein [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|226736757|sp|B7JAH6|ERPA_ACIF2 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226736758|sp|B5EQH0|ERPA_ACIF5 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|198249274|gb|ACH84867.1| iron-sulfur cluster assembly accessory protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218518721|gb|ACK79307.1| iron-sulfur cluster assembly accessory protein [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 124

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 1/109 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T+T+ A  +I  ++         +R+ +  GGC+G +Y      +      ++ + 
Sbjct: 16  PPVMTLTQNAADKIASLIEEEGSDDLKLRVFVTGGGCSGFQYGFTFDENMNEGDTEVHQL 75

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            GV + ID  S  Y++G EID+      + FV  NPN  + CGCG S  
Sbjct: 76  -GVSLLIDPMSYQYLVGAEIDYSEGLEGAQFVIKNPNATTTCGCGSSFS 123


>gi|152978702|ref|YP_001344331.1| iron-sulfur cluster insertion protein ErpA [Actinobacillus
           succinogenes 130Z]
 gi|171704278|sp|A6VN49|ERPA_ACTSZ RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|150840425|gb|ABR74396.1| iron-sulfur cluster assembly accessory protein [Actinobacillus
           succinogenes 130Z]
          Length = 113

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 36/114 (31%), Positives = 57/114 (50%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           M+DI   +T T+AA  ++K ++ + +     +R+ +  GGC+G +Y              
Sbjct: 1   MTDISVPLTFTDAAANKVKSLITDEENPNLKLRVYITGGGCSGFQYGFTFDEKVNEGDLT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +    GV++ ID  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 61  VENA-GVQLVIDPMSLQYLIGGTVDYTEGLEGSRFVVQNPNASSTCGCGSSFSI 113


>gi|165976887|ref|YP_001652480.1| iron-sulfur cluster insertion protein ErpA [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|303250961|ref|ZP_07337150.1| iron-sulfur cluster insertion protein ErpA [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307253110|ref|ZP_07534991.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|226736760|sp|B0BR51|ERPA_ACTPJ RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|165876988|gb|ABY70036.1| hypothetical protein APJL_1484 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|302650178|gb|EFL80345.1| iron-sulfur cluster insertion protein ErpA [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306859404|gb|EFM91436.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 113

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 55/114 (48%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           M+DI   +  T+AA  ++K ++         +R+ +  GGC+G +Y              
Sbjct: 1   MNDIQIPIIFTDAAAKKVKSLIEGEDNPNLRLRVYITGGGCSGFQYGFTFDDQVNDGDLT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +  ++ V + +D  SL Y++G  +D+      S FV +NPN  S CGCG S  I
Sbjct: 61  IENQN-VGLVVDPMSLQYLIGGTVDYTEGLDGSRFVVNNPNATSTCGCGSSFSI 113


>gi|145590062|ref|YP_001156659.1| iron-sulfur cluster assembly accessory protein [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|226694552|sp|A4T031|ERPA_POLSQ RecName: Full=Putative iron--sulfur cluster insertion protein erpA
 gi|145048468|gb|ABP35095.1| iron-sulfur cluster assembly accessory protein [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 124

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 32/104 (30%), Positives = 52/104 (50%), Gaps = 1/104 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T+ A  ++ +++         +R+ ++ GGC+G +Y          D      K+GV +
Sbjct: 21  FTDNAAAKVADLIAEEGNPELKLRVFVQGGGCSGFQYGFTFDDAVNEDDTLFE-KNGVTL 79

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            +DS S  Y++G EID+K +   S FV  NPN  + CGCG S  
Sbjct: 80  LVDSMSFQYLVGAEIDYKEDINGSQFVIKNPNATTTCGCGSSFS 123


>gi|149927683|ref|ZP_01915935.1| iron-sulfur cluster assembly accessory protein [Limnobacter sp.
           MED105]
 gi|149823509|gb|EDM82739.1| iron-sulfur cluster assembly accessory protein [Limnobacter sp.
           MED105]
          Length = 116

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++  T++A  ++++++         +R+ ++ GGC+G +Y      D   D   L  K
Sbjct: 8   PSVLVFTDSAAAKVRDLINEEGNPNLKLRVFVQGGGCSGFQYGFTFDEDVNEDDTALD-K 66

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GV + IDS S  Y+ G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 67  GGVTLLIDSMSYQYLTGAEIDYKEDINGAQFVIKNPNATTTCGCGSSFSV 116


>gi|146340504|ref|YP_001205552.1| Iron-sulfur cluster assembly protein [Bradyrhizobium sp. ORS278]
 gi|146193310|emb|CAL77326.1| Iron-sulfur cluster assembly protein [Bradyrhizobium sp. ORS278]
          Length = 129

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 47/115 (40%), Positives = 82/115 (71%), Gaps = 1/115 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++ +T+AA  RI+E+   ++ +  G+R+ +K GGCAG  Y V+   D     + + +K
Sbjct: 16  PQVMRLTDAAATRIRELTQRAESEIIGLRVGVKNGGCAGQSYTVEYAHDIRPTDEVVEDK 75

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            GVK+ +D  ++L++LGTE+D++T+K+ + FVF+NPNQ+SACGCG+SV++K A++
Sbjct: 76  -GVKILVDPKAVLFLLGTEMDYQTDKMQAQFVFNNPNQISACGCGESVQLKPAEV 129


>gi|77164557|ref|YP_343082.1| HesB/YadR/YfhF [Nitrosococcus oceani ATCC 19707]
 gi|254434127|ref|ZP_05047635.1| hypothetical protein NOC27_1058 [Nitrosococcus oceani AFC27]
 gi|123594613|sp|Q3JC94|ERPA_NITOC RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|76882871|gb|ABA57552.1| HesB/YadR/YfhF [Nitrosococcus oceani ATCC 19707]
 gi|207090460|gb|EDZ67731.1| hypothetical protein NOC27_1058 [Nitrosococcus oceani AFC27]
          Length = 116

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 51/110 (46%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M + +  T+ A  ++KE++         +R+ +  GGC+G +Y       +      +  
Sbjct: 7   MPNPLIFTDIAAGKVKELIEEEGNDKLMLRVFITGGGCSGFQYGFTFDETSHEGDTRVKN 66

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             GV + ID  S  Y++G EID+      + FV  NPN  + CGCG S  
Sbjct: 67  -GGVTLLIDPTSYQYLVGAEIDYTEGLEGAQFVIRNPNAETTCGCGSSFS 115


>gi|319786007|ref|YP_004145482.1| iron-sulfur cluster assembly accessory protein [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317464519|gb|ADV26251.1| iron-sulfur cluster assembly accessory protein [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 122

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              +  + AA  +++E++         +R+ ++ GGC+G +Y  +   +N  + D  +  
Sbjct: 14  DQPLRFSSAAAAKVRELISEEGNADLKLRVYIQGGGCSGFQYGFEFD-ENQAEDDMAVAT 72

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGV + +D  SL Y++G E+D+      + FV  NPN  + CGCG S  +
Sbjct: 73  DGVTLLVDPLSLQYLMGAEVDYSEGLSGAQFVIRNPNAKTTCGCGSSFSV 122


>gi|194367473|ref|YP_002030083.1| iron-sulfur cluster insertion protein ErpA [Stenotrophomonas
           maltophilia R551-3]
 gi|226694573|sp|B4SLD1|ERPA_STRM5 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|194350277|gb|ACF53400.1| iron-sulfur cluster assembly accessory protein [Stenotrophomonas
           maltophilia R551-3]
          Length = 130

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 31/106 (29%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TE+A  ++K ++         +R+ ++ GGC+G +Y  +   +N  + D  ++  GV
Sbjct: 25  LNFTESAAAKVKSLIQEEGNLDLALRVYIEGGGCSGFQYGFEFD-ENRAEDDLAVQTSGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            + +D  SL Y++G E+D+      + FV  NPN  + CGCG S  
Sbjct: 84  TLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFS 129


>gi|319942885|ref|ZP_08017168.1| iron-sulfur cluster insertion protein ErpA [Lautropia mirabilis
           ATCC 51599]
 gi|319743427|gb|EFV95831.1| iron-sulfur cluster insertion protein ErpA [Lautropia mirabilis
           ATCC 51599]
          Length = 116

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 61/110 (55%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T++A  ++ E++         +R+ ++ GGC+G +Y      ++  + D ++E
Sbjct: 7   MPPPLLFTDSAATKVGELIMEEGNPDLKLRVFVQGGGCSGFQYGFTFD-EDVAEDDTVME 65

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV + ID+ S  Y++G EID+K +   S FV  NPN  + CGCG S  
Sbjct: 66  KNGVTLLIDAMSYQYLVGAEIDYKDDLHGSQFVIKNPNAATTCGCGSSFS 115


>gi|254517417|ref|ZP_05129474.1| HesB/YadR/YfhF [gamma proteobacterium NOR5-3]
 gi|219674255|gb|EED30624.1| HesB/YadR/YfhF [gamma proteobacterium NOR5-3]
          Length = 117

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 59/110 (53%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            + +T+++ AV +++E+V   +  A  +R+ +  GGC+G +Y      D   D   +   
Sbjct: 9   PNAITLSDRAVNKVRELVNEEENTALKLRVFITGGGCSGFQYGFSFDEDAAEDDTTIER- 67

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +GV V +D  S  Y+ G+E+D+      S F+ +NPN  + CGCG S  +
Sbjct: 68  EGVTVLVDPMSFPYLAGSEVDYSEGLEGSRFIVNNPNATTTCGCGASFSV 117


>gi|163796144|ref|ZP_02190106.1| hypothetical protein BAL199_30237 [alpha proteobacterium BAL199]
 gi|159178603|gb|EDP63143.1| hypothetical protein BAL199_30237 [alpha proteobacterium BAL199]
          Length = 121

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 76/115 (66%), Gaps = 2/115 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKA-QGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M   +T+T+AA  R+++++  S      G+R+ +K  GC+GL Y+++    +    +DL+
Sbjct: 5   MKAPITLTDAAAARVRDLMAKSPEDGVIGLRVGVKNTGCSGLSYVIEYA-KDRKKFEDLV 63

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           E  GV + ID  +++++LG+E+D+K +KL+SGFVF+NPN+   CGCG+S  +  A
Sbjct: 64  EDKGVSILIDPTAVMFILGSEMDYKEDKLFSGFVFNNPNETGRCGCGESFSVAAA 118


>gi|329904746|ref|ZP_08273921.1| putative iron binding protein from the HesB IscA SufA family
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327547849|gb|EGF32609.1| putative iron binding protein from the HesB IscA SufA family
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 116

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 55/110 (50%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T+ A  ++ +++         +R+ ++ GGC+G +Y          D   +  
Sbjct: 7   MPAPILFTDNAAAKVAQLIEEEGNPELKLRVFVQGGGCSGFQYGFTFDEVANEDDTTME- 65

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV++ IDS S  Y++G EID+K +   + FV  NP   S CGCG S  
Sbjct: 66  KNGVQLLIDSMSYQYLVGAEIDYKDDLEGAQFVIKNPGATSTCGCGSSFS 115


>gi|145631863|ref|ZP_01787621.1| hypothetical protein CGSHi22421_09801 [Haemophilus influenzae
           R3021]
 gi|145635423|ref|ZP_01791124.1| hypothetical protein CGSHiAA_03346 [Haemophilus influenzae PittAA]
 gi|145637870|ref|ZP_01793516.1| hypothetical protein CGSHiHH_02841 [Haemophilus influenzae PittHH]
 gi|148825738|ref|YP_001290491.1| iron-sulfur cluster insertion protein ErpA [Haemophilus influenzae
           PittEE]
 gi|229845254|ref|ZP_04465387.1| iron-sulfur cluster insertion protein ErpA [Haemophilus influenzae
           6P18H1]
 gi|229847340|ref|ZP_04467442.1| iron-sulfur cluster insertion protein ErpA [Haemophilus influenzae
           7P49H1]
 gi|160380675|sp|A5UBF7|ERPA_HAEIE RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|144982519|gb|EDJ90077.1| hypothetical protein CGSHi22421_09801 [Haemophilus influenzae
           R3021]
 gi|145267297|gb|EDK07300.1| hypothetical protein CGSHiAA_03346 [Haemophilus influenzae PittAA]
 gi|145268940|gb|EDK08897.1| hypothetical protein CGSHiHH_02841 [Haemophilus influenzae PittHH]
 gi|148715898|gb|ABQ98108.1| hypothetical protein CGSHiEE_03435 [Haemophilus influenzae PittEE]
 gi|229809765|gb|EEP45489.1| iron-sulfur cluster insertion protein ErpA [Haemophilus influenzae
           7P49H1]
 gi|229811849|gb|EEP47545.1| iron-sulfur cluster insertion protein ErpA [Haemophilus influenzae
           6P18H1]
 gi|309972885|gb|ADO96086.1| Iron-sulfur cluster insertion protein ErpA [Haemophilus influenzae
           R2846]
          Length = 114

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T T+AA  ++K ++   +     +R+ +  GGC+G +Y      +   DGD  IEK GV
Sbjct: 9   LTFTDAAANKVKSLISEEENTDLKLRVYITGGGCSGFQYGFTFD-EKVNDGDLTIEKSGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ ID  SL Y++G  +D+      S F  +NPN  S CGCG S  I
Sbjct: 68  QLVIDPMSLQYLIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI 114


>gi|116623293|ref|YP_825449.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Solibacter usitatus Ellin6076]
 gi|116226455|gb|ABJ85164.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 107

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 63/108 (58%), Gaps = 1/108 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +V +T+ AV +++EI+ + +    G+RI++  GGC+G  Y +       V        +G
Sbjct: 1   MVQITDRAVGKVREIMASQEPAPAGLRIAVVGGGCSGFSYSMAFENQPNVLDKTYNY-EG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +K+++D ASLLY+ G E+D+      SGF F+NP   S CGCG S ++
Sbjct: 60  LKIFVDQASLLYLDGAEVDYVETLEGSGFKFNNPQVKSTCGCGSSFQV 107


>gi|82523695|emb|CAI78476.1| hypothetical protein [uncultured beta proteobacterium]
          Length = 123

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 55/110 (50%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  TE+A  ++K ++         +R+ +  GGC+G +Y      +     D ++ 
Sbjct: 14  MESPLIFTESAASKVKSLIDEEGNPDLKLRVFVSGGGCSGFQYGFTFD-ETQNADDTVMV 72

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+GV + +DS S  Y++G EID+      + FV  NPN  + CGCG S  
Sbjct: 73  KNGVSLLVDSMSFQYLVGAEIDYSEGLEGAQFVIKNPNATTTCGCGSSFS 122


>gi|313902275|ref|ZP_07835680.1| iron-sulfur cluster assembly accessory protein [Thermaerobacter
           subterraneus DSM 13965]
 gi|313467426|gb|EFR62935.1| iron-sulfur cluster assembly accessory protein [Thermaerobacter
           subterraneus DSM 13965]
          Length = 124

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 63/111 (56%), Gaps = 1/111 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T  AV ++KE++   Q     +R+ ++ GGC+G  Y + L ++   D   +  +DG
Sbjct: 1   MITLTPEAVAKVKELLAERQRDDLALRVFIQPGGCSGFNYGLALDSNLHDDDTVID-QDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           V+V +DSAS  ++ G  +D+      SGF  HNPN V  CGCGQS   +  
Sbjct: 60  VRVVVDSASARFLKGARVDYVESLSGSGFAIHNPNAVHTCGCGQSFRTRDE 110


>gi|157825851|ref|YP_001493571.1| Iron-sulfur cluster assembly accessory protein [Rickettsia akari
           str. Hartford]
 gi|157799809|gb|ABV75063.1| Iron-sulfur cluster assembly accessory protein [Rickettsia akari
           str. Hartford]
          Length = 110

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 69/111 (62%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T++A  ++K ++        G+R+ +K GGCAG  Y V+         D+++E
Sbjct: 1   MKNVISLTDSAAKQVKLLIEKRDKPTFGVRVGVKSGGCAGQTYYVEYADSK-NQFDEVVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+EID+   K  S F F NPN+ + CGCG+S  +
Sbjct: 60  EKGVRILIDPKALMYILGSEIDYVETKFKSQFTFTNPNEKAGCGCGKSFSV 110


>gi|86157022|ref|YP_463807.1| HesB/YadR/YfhF [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85773533|gb|ABC80370.1| HesB/YadR/YfhF [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 110

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/111 (38%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  + ++E A   IK +       A G+R+ +K GGC+GL Y +D   +     D +IE
Sbjct: 1   MAAAIEISEKAAVHIKALGAQKGAPAGGLRLGVKGGGCSGLSYFIDWANEP-ARFDQVIE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +DG +V++D  S +++ GT ID++   + +GFVF NPN  SACGCG+S  I
Sbjct: 60  RDGARVFVDPKSAVFLAGTVIDWQQTLMQTGFVFRNPNVKSACGCGESFTI 110


>gi|88858261|ref|ZP_01132903.1| putative HesB/YadR/YfhF family protein [Pseudoalteromonas tunicata
           D2]
 gi|88819878|gb|EAR29691.1| putative HesB/YadR/YfhF family protein [Pseudoalteromonas tunicata
           D2]
          Length = 112

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 35/113 (30%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  T+AA  ++K+++   +     +R+ +  GGC+G +Y      +    GD  
Sbjct: 1   MSDQIPIKFTDAAANKVKQLIEEEENPQLKLRVYVTGGGCSGFQYGFTFD-EKTNPGDLE 59

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           I K GV + +D  SL Y++  E+D+      S F  +NPN  + CGCG S  +
Sbjct: 60  IVKSGVTLVVDPMSLQYLVDGEVDYTEGLEGSRFFVNNPNATATCGCGSSFSV 112


>gi|148255362|ref|YP_001239947.1| Iron-sulfur cluster assembly protein [Bradyrhizobium sp. BTAi1]
 gi|146407535|gb|ABQ36041.1| Iron-sulfur cluster assembly protein [Bradyrhizobium sp. BTAi1]
          Length = 134

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 45/115 (39%), Positives = 82/115 (71%), Gaps = 1/115 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++ +T+AA  RI+E++  ++ +  G+R+ +K GGCAG  Y V+   D     + + +K
Sbjct: 21  PQVMRLTDAAATRIRELMQRAESEIIGLRVGVKNGGCAGQSYTVEYAHDIRPTDEVVEDK 80

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            GVK+ +D  ++L++LGTE+D++ +++ + FVF+NPNQ+SACGCG+SV++K A++
Sbjct: 81  -GVKIMVDPKAVLFLLGTEMDYQADRMQAQFVFNNPNQISACGCGESVQLKPAEV 134


>gi|289663869|ref|ZP_06485450.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas campestris
           pv. vasculorum NCPPB702]
 gi|289669457|ref|ZP_06490532.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas campestris
           pv. musacearum NCPPB4381]
          Length = 128

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  + AA  +++E++         +R+ ++ GGC+G +Y  +   +N  + D  +  DGV
Sbjct: 23  LNFSVAAAAKVRELIQEEGNADLALRVYIQGGGCSGFQYGFEFD-ENRAEDDLAVATDGV 81

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G E+D+      + FV  NPN  + CGCG S  +
Sbjct: 82  TLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV 128


>gi|21241270|ref|NP_640852.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas axonopodis
           pv. citri str. 306]
 gi|294627252|ref|ZP_06705839.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294667730|ref|ZP_06732942.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|81805262|sp|Q8PQ32|ERPA_XANAC RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|21106587|gb|AAM35388.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|292598491|gb|EFF42641.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292602570|gb|EFF46009.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 128

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  + AA  +++E++         +R+ ++ GGC+G +Y  +   +N  + D  +  DGV
Sbjct: 23  LNFSVAAAAKVRELIQEEGNADLALRVYIQGGGCSGFQYGFEFD-ENRAEDDLAVATDGV 81

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G E+D+      + FV  NPN  + CGCG S  +
Sbjct: 82  TLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV 128


>gi|78046090|ref|YP_362265.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|325926790|ref|ZP_08188097.1| Iron-sulfur cluster assembly accessory protein [Xanthomonas
           perforans 91-118]
 gi|123586035|sp|Q3BY98|ERPA_XANC5 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|78034520|emb|CAJ22165.1| putative Iron-sulfur cluster assembly accessory protein
           [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|325542811|gb|EGD14267.1| Iron-sulfur cluster assembly accessory protein [Xanthomonas
           perforans 91-118]
          Length = 128

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  + AA  +++E++         +R+ ++ GGC+G +Y  +   +N  + D  +  DGV
Sbjct: 23  LNFSVAAAAKVRELIQEEGNADLALRVYIQGGGCSGFQYGFEFD-ENRAEDDLAVATDGV 81

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G E+D+      + FV  NPN  + CGCG S  +
Sbjct: 82  TLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV 128


>gi|94309359|ref|YP_582569.1| iron-sulfur cluster insertion protein ErpA [Cupriavidus
           metallidurans CH34]
 gi|160385718|sp|Q1LRC6|ERPA_RALME RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|93353211|gb|ABF07300.1| iron-sulfur cluster assembly accessory protein (yadR) [Cupriavidus
           metallidurans CH34]
          Length = 122

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 58/105 (55%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T++A  ++K+++         +R+ ++ GGC+G +Y      D   D   ++ K+GV +
Sbjct: 19  FTDSAADKVKQLIEEEGNAELKLRVFVQGGGCSGFQYGFTFDEDVNEDDTTMV-KNGVTL 77

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 78  LIDSMSYQYLVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV 122


>gi|73540177|ref|YP_294697.1| iron-sulfur cluster insertion protein ErpA [Ralstonia eutropha
           JMP134]
 gi|113866514|ref|YP_725003.1| iron-sulfur cluster insertion protein ErpA [Ralstonia eutropha H16]
 gi|188591229|ref|YP_001795829.1| iron-sulfur cluster insertion protein erpa [Cupriavidus taiwanensis
           LMG 19424]
 gi|123134422|sp|Q0KED6|ERPA_RALEH RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|123625855|sp|Q475T0|ERPA_RALEJ RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|226694533|sp|B2AH60|ERPA_CUPTR RecName: Full=Putative iron--sulfur cluster insertion protein erpA
 gi|72117590|gb|AAZ59853.1| HesB/YadR/YfhF [Ralstonia eutropha JMP134]
 gi|113525290|emb|CAJ91635.1| iron sulfur cluster assembly protein [Ralstonia eutropha H16]
 gi|170938123|emb|CAP63109.1| conserved hypothetical protein, HesB family [Cupriavidus
           taiwanensis LMG 19424]
          Length = 122

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 58/105 (55%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T++A  ++K+++         +R+ ++ GGC+G +Y      +   D   ++ K+GV +
Sbjct: 19  FTDSAADKVKQLIEEEGNAELKLRVFVQGGGCSGFQYGFTFDEEVNEDDTTMV-KNGVTL 77

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IDS S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 78  LIDSMSYQYLVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV 122


>gi|160901343|ref|YP_001566925.1| iron-sulfur cluster insertion protein ErpA [Delftia acidovorans
           SPH-1]
 gi|226694534|sp|A9C177|ERPA_DELAS RecName: Full=Putative iron--sulfur cluster insertion protein erpA
 gi|160366927|gb|ABX38540.1| iron-sulfur cluster assembly accessory protein [Delftia acidovorans
           SPH-1]
          Length = 124

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 57/105 (54%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T++A  ++ +++         +R+ ++ GGC+G +Y      +   D D  + K+GV +
Sbjct: 21  FTDSAAAKVADLIAEEGNPDLKLRVFVQGGGCSGFQYGFTFD-EITNDDDTTMTKNGVSL 79

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            ID+ S  Y++G EID+K +   + FV  NPN  + CGCG S  +
Sbjct: 80  LIDAMSYQYLVGAEIDYKEDLQGAQFVIKNPNASTTCGCGSSFSV 124


>gi|144899511|emb|CAM76375.1| HesB/YadR/YfhF [Magnetospirillum gryphiswaldense MSR-1]
          Length = 112

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 70/111 (63%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +T+TE+A  R++ ++      + GIRI ++  GC+G++Y ++   +     D+++E
Sbjct: 3   MKAPITITESAAQRVRAMLDKRGKPSAGIRIGVRSKGCSGMQYTLEYADEK-SPFDEVVE 61

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + G+ V ID  + +++ GTE+D+  EK+ SGFVF NPN+   CGCG+S  +
Sbjct: 62  QGGITVLIDPKAAMFIFGTEMDWVEEKMQSGFVFRNPNEKGRCGCGESFHV 112


>gi|88704557|ref|ZP_01102270.1| HesB/YadR/YfhF family protein [Congregibacter litoralis KT71]
 gi|88700878|gb|EAQ97984.1| HesB/YadR/YfhF family protein [Congregibacter litoralis KT71]
          Length = 117

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 59/110 (53%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            + +T+++ AV +++E+V   +  A  +R+ +  GGC+G +Y      D   D   +   
Sbjct: 9   PNAITLSDRAVNKVRELVSEEENTALKLRVFITGGGCSGFQYGFSFDEDAAEDDTTIER- 67

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +GV V +D  S  Y+ G+E+D+      S F+ +NPN  + CGCG S  +
Sbjct: 68  EGVTVLVDPMSFPYLAGSEVDYSEGLEGSRFIVNNPNASTTCGCGASFSV 117


>gi|15837007|ref|NP_297695.1| iron-sulfur cluster insertion protein ErpA [Xylella fastidiosa
           9a5c]
 gi|28199544|ref|NP_779858.1| iron-sulfur cluster insertion protein ErpA [Xylella fastidiosa
           Temecula1]
 gi|71899316|ref|ZP_00681477.1| HesB/YadR/YfhF [Xylella fastidiosa Ann-1]
 gi|182682281|ref|YP_001830441.1| iron-sulfur cluster insertion protein ErpA [Xylella fastidiosa M23]
 gi|54040224|sp|P64343|ERPA_XYLFT RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|54042361|sp|P64342|ERPA_XYLFA RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|226694586|sp|B2I891|ERPA_XYLF2 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|9105241|gb|AAF83215.1|AE003891_14 conserved hypothetical protein [Xylella fastidiosa 9a5c]
 gi|28057659|gb|AAO29507.1| HesB-like protein [Xylella fastidiosa Temecula1]
 gi|71730942|gb|EAO33012.1| HesB/YadR/YfhF [Xylella fastidiosa Ann-1]
 gi|182632391|gb|ACB93167.1| iron-sulfur cluster assembly accessory protein [Xylella fastidiosa
           M23]
 gi|307578558|gb|ADN62527.1| iron-sulfur cluster insertion protein ErpA [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 128

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T AA  +++E++         +R+ ++ GGC+G +Y  +   +N  D D  +E DGV
Sbjct: 23  LNFTMAAAAKVRELIQEENNADLALRVYIQGGGCSGFQYGFEFD-ENRADDDLALETDGV 81

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y+LG E+D+      + FV  NPN  + CGCG S  +
Sbjct: 82  VLLVDPLSLQYLLGAEVDYTESLTGAKFVIRNPNAKTTCGCGSSFSV 128


>gi|325915229|ref|ZP_08177552.1| Iron-sulfur cluster assembly accessory protein [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325538589|gb|EGD10262.1| Iron-sulfur cluster assembly accessory protein [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 128

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  + AA  +++E++         +R+ ++ GGC+G +Y  +   +N  + D  +  DGV
Sbjct: 23  LNFSGAAAAKVRELIQEEGNADLALRVYIQGGGCSGFQYGFEFD-ENRAEDDLAVATDGV 81

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G E+D+      + FV  NPN  + CGCG S  I
Sbjct: 82  TLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSI 128


>gi|257456008|ref|ZP_05621217.1| iron-sulfur cluster insertion protein ErpA [Enhydrobacter
           aerosaccus SK60]
 gi|257446597|gb|EEV21631.1| iron-sulfur cluster insertion protein ErpA [Enhydrobacter
           aerosaccus SK60]
          Length = 118

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 54/111 (48%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M D VT+T+ A  +++ +  +       +R+ +  GGC+G  Y  +   +   D D    
Sbjct: 9   MVDGVTLTDNAAKKVRNLRDSEGNNDLMLRVYVTGGGCSGFSYGFNFEENL-GDDDATFS 67

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            D V + +DS S  Y+ G+ ID+      S F  +NPN  + CGCG S  I
Sbjct: 68  NDDVALVVDSLSYQYLNGSTIDYVEGLEGSRFTVNNPNATTTCGCGSSFSI 118


>gi|307250734|ref|ZP_07532668.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306857238|gb|EFM89360.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 113

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/114 (30%), Positives = 55/114 (48%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSDI   +T T+AA  ++K ++         +R+ +  GGC+G +Y              
Sbjct: 1   MSDIQIPLTFTDAAAKKVKSLIEGEDNPNLRLRVYITGGGCSGFQYGFTFDDQINEGDLT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +  ++ V + +D  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 61  IENQN-VGLVVDPMSLQYLIGGTVDYTEGLDGSRFVVQNPNASSTCGCGSSFSI 113


>gi|149376106|ref|ZP_01893871.1| hypothetical protein MDG893_13958 [Marinobacter algicola DG893]
 gi|149359511|gb|EDM47970.1| hypothetical protein MDG893_13958 [Marinobacter algicola DG893]
          Length = 117

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           ++++AV +++E+V         +R+ +  GGC+G +Y          +   +   DGV +
Sbjct: 14  LSDSAVSKVRELVDEEGNSDLKLRVFVTGGGCSGFQYGFSFDEAQDEEDTVIER-DGVML 72

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  S  Y++G  +D++     S FV  NPN  S CGCG S  I
Sbjct: 73  LVDPMSYQYLVGATVDYQEGLQGSQFVVQNPNASSTCGCGSSFSI 117


>gi|152995043|ref|YP_001339878.1| iron-sulfur cluster assembly accessory protein [Marinomonas sp.
           MWYL1]
 gi|150835967|gb|ABR69943.1| iron-sulfur cluster assembly accessory protein [Marinomonas sp.
           MWYL1]
          Length = 115

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 58/109 (53%), Gaps = 1/109 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           D +  T+AA  +++ ++   +     +R+ +  GGC+G +Y      ++  D  ++   +
Sbjct: 8   DPIEFTDAAAAKLQSLIEEEENDRLMLRVYVTGGGCSGFQYGFTFDEEHQEDDTEIKR-N 66

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GV + +D  S  Y++G+E+D+K     + FV  NPN  S CGCG S  I
Sbjct: 67  GVTLVVDPLSFQYLVGSEVDYKENLEGARFVVQNPNATSTCGCGASFSI 115


>gi|254448473|ref|ZP_05061933.1| HesB/YadR/YfhF [gamma proteobacterium HTCC5015]
 gi|198261856|gb|EDY86141.1| HesB/YadR/YfhF [gamma proteobacterium HTCC5015]
          Length = 124

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 53/110 (48%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            D +  T+AA  ++K ++   + +A  +R+ +  GGC+G +Y      +       +   
Sbjct: 16  PDPLVFTDAAAQKVKTLIDEEENEALKLRVFVSGGGCSGFQYGFTFDENVDGADTAVENA 75

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GV + +D  S  Y+ G EID+      + FV  NPN  + CGCG S  +
Sbjct: 76  -GVTLLVDPISYQYLAGAEIDYTEGLEGAQFVIRNPNASTTCGCGSSFSV 124


>gi|114704645|ref|ZP_01437553.1| hypothetical protein FP2506_06911 [Fulvimarina pelagi HTCC2506]
 gi|114539430|gb|EAU42550.1| hypothetical protein FP2506_06911 [Fulvimarina pelagi HTCC2506]
          Length = 151

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 56/114 (49%), Positives = 87/114 (76%), Gaps = 1/114 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++++T+AA  R++ I+ N+   A G+R+ +KKGGCAG+EY V+L   +  + +D++EKD
Sbjct: 29  QVLSITDAAASRVQAILDNAAADALGVRVGVKKGGCAGMEYTVELA-KDHRENEDVVEKD 87

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           G +V+I   ++L++LGTE+D++   L SGFVF+NPNQ SACGCG+SVE+K ADL
Sbjct: 88  GARVYIAPEAVLFLLGTEMDYEETVLRSGFVFNNPNQTSACGCGESVELKAADL 141


>gi|332976309|gb|EGK13166.1| iron-sulfur cluster insertion protein ErpA [Psychrobacter sp.
           1501(2011)]
          Length = 109

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 52/107 (48%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T++A  +++ +          +R+ +  GGC+G  Y  +   +   D  +    D V
Sbjct: 4   ITLTDSAANKVRRLREEEGDNNLMLRVYVTGGGCSGFSYGFNFADEVGEDDANFEN-DDV 62

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +DS S  Y+ G+ +D+      + FV  NPN  + CGCG S  I
Sbjct: 63  TLLVDSLSYQYLQGSTVDYTEGLEGARFVVSNPNATTTCGCGSSFSI 109


>gi|284009167|emb|CBA76209.1| iron-sulphur protein [Arsenophonus nasoniae]
          Length = 135

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 5/115 (4%)

Query: 1   MSD----IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGD 56
           MS+     +  T+AA  ++K ++ + +     +R+ +  GGC+G +Y      D   +GD
Sbjct: 22  MSNDTALPIQFTDAAANKVKALIADEENPNLRLRVYITGGGCSGFQYGFTFD-DKMNEGD 80

Query: 57  DLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             IEK GV++ +D  SL Y++G  +D+      + FV  NPN  + CGCG S  I
Sbjct: 81  LTIEKQGVELIVDPMSLQYLVGGCVDYIEGLEGARFVVTNPNAKTTCGCGSSFSI 135


>gi|138896543|ref|YP_001126996.1| HesB protein [Geobacillus thermodenitrificans NG80-2]
 gi|196250902|ref|ZP_03149587.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           G11MC16]
 gi|134268056|gb|ABO68251.1| HesB protein [Geobacillus thermodenitrificans NG80-2]
 gi|196209631|gb|EDY04405.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           G11MC16]
          Length = 121

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 66/110 (60%), Gaps = 2/110 (1%)

Query: 1   MSD-IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M++ I+T+TEAA ++IK+++   + +   +R+ +  GGC+GL Y +    +   D D  +
Sbjct: 1   MTEAIITLTEAAAFQIKDMMKEQEEENAYLRVGVHGGGCSGLSYGMGFAHER-NDDDIEL 59

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           E+ G+K+ ID  S   + GT ID+K   L  GF  +NPN ++ CGCG S 
Sbjct: 60  EQHGIKILIDRDSAPILRGTVIDYKQSLLGGGFTINNPNAIATCGCGSSF 109


>gi|240948915|ref|ZP_04753271.1| iron-sulfur cluster insertion protein ErpA [Actinobacillus minor
           NM305]
 gi|240296730|gb|EER47341.1| iron-sulfur cluster insertion protein ErpA [Actinobacillus minor
           NM305]
          Length = 113

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/114 (31%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSDI   +T T+AA  ++K ++         +R+ +  GGC+G +Y              
Sbjct: 1   MSDIQIPLTFTDAAANKVKSLIEGEDNPNLRLRVYITGGGCSGFQYGFTFDDQINEGDLT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +  ++ V + +D  SL Y++G  +D+      S FV HNPN  S CGCG S  I
Sbjct: 61  IENQN-VGLVVDPMSLQYLIGGTVDYTEGLDGSRFVVHNPNASSTCGCGSSFSI 113


>gi|84622145|ref|YP_449517.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|123523335|sp|Q2P884|ERPA_XANOM RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160386995|sp|Q5H5J1|ERPA_XANOR RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|84366085|dbj|BAE67243.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 128

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  + AA  +++E++         +R+ ++ GGC+G +Y  +   +N  + D  +  DGV
Sbjct: 23  LHFSVAAAAKVRELIQEEGNADLALRVYIQGGGCSGFQYGFEFD-ENRAEDDLAVVTDGV 81

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G E+D+      + FV  NPN  + CGCG S  +
Sbjct: 82  TLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV 128


>gi|328868087|gb|EGG16467.1| iron-sulfur cluster assembly 1 like protein [Dictyostelium
           fasciculatum]
          Length = 148

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/112 (34%), Positives = 72/112 (64%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             + +MT++A+ +IKE++     K QG+R+ +K+ GC+GL+Y +D  +  P   D+++  
Sbjct: 14  KAVFSMTDSAITKIKELMIKEGEKCQGLRLGVKQRGCSGLQYTLDFTSQPPNKLDEVVTD 73

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
            G+ + +DS +L+ ++GTE+D+  E +   F+F NPN  + CGCG+S  +K 
Sbjct: 74  KGITIVVDSKALMSVIGTEMDYIEEPIKKEFIFINPNATNTCGCGESFTVKD 125


>gi|58580148|ref|YP_199164.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|58424742|gb|AAW73779.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 138

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  + AA  +++E++         +R+ ++ GGC+G +Y  +   +N  + D  +  DGV
Sbjct: 33  LHFSVAAAAKVRELIQEEGNADLALRVYIQGGGCSGFQYGFEFD-ENRAEDDLAVVTDGV 91

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G E+D+      + FV  NPN  + CGCG S  +
Sbjct: 92  TLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV 138


>gi|153003511|ref|YP_001377836.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           sp. Fw109-5]
 gi|152027084|gb|ABS24852.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           sp. Fw109-5]
          Length = 109

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + ++E A  RI+ +         G+R+ +K GGC+GL Y +D   +     D +IE+DG 
Sbjct: 4   IEISEKAAVRIRALSQEKGTPQGGLRLGVKGGGCSGLSYFIDWAPEPAK-HDQVIERDGA 62

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++++D  S +++ GT +D++   + SGFVF NPN  SACGCG+S  I
Sbjct: 63  RLFVDPKSAVFLAGTVVDWQQTLMQSGFVFRNPNVKSACGCGESFTI 109


>gi|166713787|ref|ZP_02244994.1| hypothetical protein Xoryp_20710 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 128

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  + AA  +++E++         +R+ ++ GGC+G +Y  +   +N  + D  +  DGV
Sbjct: 23  LHFSVAAAAKVRELIQEEGNADLALRVYIQGGGCSGFQYGFEFD-ENRAEDDLAVATDGV 81

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G E+D+      + FV  NPN  + CGCG S  +
Sbjct: 82  TLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV 128


>gi|167646557|ref|YP_001684220.1| iron-sulfur cluster assembly accessory protein [Caulobacter sp.
           K31]
 gi|167348987|gb|ABZ71722.1| iron-sulfur cluster assembly accessory protein [Caulobacter sp.
           K31]
          Length = 130

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 47/113 (41%), Positives = 73/113 (64%), Gaps = 1/113 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             +V++T AA  R+KEI+  +     G+R+ +K GGCAG  Y+ +         D+++E 
Sbjct: 14  PKVVSLTPAAAARVKEIMDRADRPYAGLRVGVKNGGCAGSAYIFEYA-AEKGPIDEVVED 72

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            GV + ID  ++L+++GT ID++T KL S FVF+NPN+  ACGCG+SV I+ A
Sbjct: 73  QGVTILIDPKAVLFLIGTTIDYETTKLSSKFVFNNPNETDACGCGESVTIQPA 125


>gi|325921890|ref|ZP_08183701.1| Iron-sulfur cluster assembly accessory protein [Xanthomonas
           gardneri ATCC 19865]
 gi|325547592|gb|EGD18635.1| Iron-sulfur cluster assembly accessory protein [Xanthomonas
           gardneri ATCC 19865]
          Length = 128

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  + AA  +++E++         +R+ ++ GGC+G +Y  +   +N  + D  +  DGV
Sbjct: 23  LNFSVAAAAKVRELIQEEGNAELALRVYIQGGGCSGFQYGFEFD-ENRAEDDLSVATDGV 81

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G E+D+      + FV  NPN  + CGCG S  +
Sbjct: 82  TLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV 128


>gi|295098653|emb|CBK87743.1| Iron-sulfur cluster assembly accessory protein [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 114

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ +       +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 9   LEFTEAAAKKVKTLIADEDNPDLKLRVYITGGGCSGFQYGFTFD-DQVNDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 68  ALVVDPMSLQYLVGGSVDYTEGLEGSRFVVTNPNATSTCGCGSSFSI 114


>gi|260913602|ref|ZP_05920078.1| iron-sulfur cluster insertion protein ErpA [Pasteurella dagmatis
           ATCC 43325]
 gi|260632141|gb|EEX50316.1| iron-sulfur cluster insertion protein ErpA [Pasteurella dagmatis
           ATCC 43325]
          Length = 113

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/114 (35%), Positives = 63/114 (55%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           M+DI   +T T+AA  ++K ++   +     +R+ +  GGC+G +Y      +   DGD 
Sbjct: 1   MTDISVPLTFTDAAANKVKALISEEENNNLKLRVYITGGGCSGFQYGFTFD-EKVNDGDL 59

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IEK GV++ ID  SL Y++G  +D+      S F+ +NPN  + CGCG S  I
Sbjct: 60  TIEKAGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFIVNNPNASTTCGCGSSFSI 113


>gi|320451379|ref|YP_004203475.1| iron-sulfur cluster biosynthesis protein IscA [Thermus scotoductus
           SA-01]
 gi|320151548|gb|ADW22926.1| iron-sulfur cluster biosynthesis protein IscA [Thermus scotoductus
           SA-01]
          Length = 126

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/112 (32%), Positives = 58/112 (51%), Gaps = 1/112 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T  A  + KEI+     +   IR+ +K GGC+G +Y + +          +    G
Sbjct: 8   VIRITPLAAEKAKEILARYGKEHAAIRVYIKSGGCSGFQYGMAVDERELEGDTLVEM-HG 66

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           V++ +D  SL Y++G+EID+    +  GF  HNPN  S CGCG S   K  +
Sbjct: 67  VRLVVDPMSLPYLVGSEIDWVESLMGGGFTVHNPNAASTCGCGHSFRTKDQE 118


>gi|167855042|ref|ZP_02477815.1| hypothetical protein HPS_08682 [Haemophilus parasuis 29755]
 gi|167853780|gb|EDS25021.1| hypothetical protein HPS_08682 [Haemophilus parasuis 29755]
          Length = 113

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 54/114 (47%), Gaps = 4/114 (3%)

Query: 1   MSDIV---TMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSDI+     T+AA  ++K ++   +     +R+ +  GGC+G +Y              
Sbjct: 1   MSDILVPLIFTDAAAKKVKFLIEGEENPELRLRVYITGGGCSGFQYGFTFDDKLNEGDLT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +   D V + ID  SL Y++G  ID+      S FV  NPN  S CGCG S  I
Sbjct: 61  IENLD-VALVIDPMSLQYLIGATIDYVEGLEGSRFVVQNPNASSTCGCGASFSI 113


>gi|163751943|ref|ZP_02159155.1| HesB/YadR/YfhF family protein [Shewanella benthica KT99]
 gi|161328159|gb|EDP99325.1| HesB/YadR/YfhF family protein [Shewanella benthica KT99]
          Length = 123

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++   +  A  +R+ +  GGC+G +Y              +  K GV
Sbjct: 18  IRFTDAAASKVKTLLDEEENDALKLRVYVTGGGCSGFQYGFTFDEKVNEGDLTVE-KQGV 76

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G E+D+ T    S F   NPN  + CGCG S  +
Sbjct: 77  QLVVDPMSLQYLVGGEVDYTTGLEGSRFFVKNPNATTTCGCGASFSV 123


>gi|156935326|ref|YP_001439242.1| hypothetical protein ESA_03184 [Cronobacter sakazakii ATCC BAA-894]
 gi|260596579|ref|YP_003209150.1| Iron-sulfur cluster insertion protein erpA [Cronobacter turicensis
           z3032]
 gi|160380671|sp|A7MGR3|ERPA_ENTS8 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|156533580|gb|ABU78406.1| hypothetical protein ESA_03184 [Cronobacter sakazakii ATCC BAA-894]
 gi|260215756|emb|CBA28157.1| Iron-sulfur cluster insertion protein erpA [Cronobacter turicensis
           z3032]
          Length = 114

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ +       +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 9   LQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFD-DQINDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV +NPN  S CGCG S  I
Sbjct: 68  SLVVDPMSLQYLVGGAVDYTEGLEGSRFVVNNPNATSTCGCGSSFSI 114


>gi|108805561|ref|YP_645498.1| HesB/YadR/YfhF [Rubrobacter xylanophilus DSM 9941]
 gi|108766804|gb|ABG05686.1| HesB/YadR/YfhF [Rubrobacter xylanophilus DSM 9941]
          Length = 141

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 63/107 (58%), Gaps = 1/107 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           IV++T+ A  +++ ++     +   +RI ++ GGC+G +Y +    +   D +    K G
Sbjct: 35  IVSITDKAAEKVRALMEQEGEEDLALRIGVRPGGCSGFQYSIYFDDEVAEDDEVFETK-G 93

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           VK+ +D+ S+ Y++G+E D++   + +GFV +NPN   +CGCG S  
Sbjct: 94  VKILVDAMSVPYLMGSEFDWQESLMGAGFVVNNPNVQGSCGCGGSFT 140


>gi|295696477|ref|YP_003589715.1| iron-sulfur cluster assembly accessory protein [Bacillus tusciae
           DSM 2912]
 gi|295412079|gb|ADG06571.1| iron-sulfur cluster assembly accessory protein [Bacillus tusciae
           DSM 2912]
          Length = 118

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 64/106 (60%), Gaps = 2/106 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+ A  +++E++ +   +   +R+ +K GGC+G  Y   +  D P + D+++E +G
Sbjct: 1   MITLTQEAAGKLRELIADKGSEDLAVRVFIKAGGCSGFSY--GMALDEPKNEDNVVESEG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           V+V ID  S  Y+ G EID+      +GF  HNPN VS CGCG S 
Sbjct: 59  VRVVIDPMSAPYLTGAEIDYVDTLTGAGFKIHNPNAVSTCGCGHSF 104


>gi|114319596|ref|YP_741279.1| iron-sulfur cluster insertion protein ErpA [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|122312473|sp|Q0ABJ8|ERPA_ALHEH RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|114225990|gb|ABI55789.1| iron-sulfur cluster assembly accessory protein [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 122

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 35/105 (33%), Positives = 56/105 (53%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T++A  R+ +++   +     +R+ +  GGC+G +Y      +   +GD ++EKDGV  
Sbjct: 19  VTDSAAARVAQLIAQEESDDLKLRVFVSGGGCSGFQYGFTFD-ERIEEGDSVVEKDGVTF 77

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  S  Y++G EIDF        FV  NPN  + CGCG S  I
Sbjct: 78  LVDPMSSQYLMGAEIDFVEGIEGEQFVIRNPNATTTCGCGSSFSI 122


>gi|188583651|ref|YP_001927096.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           populi BJ001]
 gi|179347149|gb|ACB82561.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           populi BJ001]
          Length = 126

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 82/117 (70%), Gaps = 3/117 (2%)

Query: 1   MS--DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MS   ++T+T+ A  R+K I+ +++    G+R+ +K GGCAG+ Y ++   +    G+D+
Sbjct: 1   MSGFKVITLTDRAADRLKAIMADAEKPIAGLRVGVKNGGCAGMSYTMEYA-EERKAGEDV 59

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           IE  GV V+ID  ++L++LGTE+DF+T KL S FVF+NPNQ SACGCG+SV I  A+
Sbjct: 60  IEDRGVTVFIDPKAVLFLLGTEMDFQTTKLSSQFVFNNPNQTSACGCGESVAITPAN 116


>gi|15602323|ref|NP_245395.1| iron-sulfur cluster insertion protein ErpA [Pasteurella multocida
           subsp. multocida str. Pm70]
 gi|81637160|sp|Q9CNH3|ERPA_PASMU RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|12720713|gb|AAK02542.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 114

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 61/114 (53%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           M++I   +  T+AA  ++K ++   +     +R+ +  GGC+G +Y      +   DGD 
Sbjct: 2   MTEISVPLIFTDAAANKVKALISEEENPNLKLRVYITGGGCSGFQYGFTFD-EKVNDGDL 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IEK GV + ID  SL Y++G  +D+      S FV +NPN  + CGCG S  I
Sbjct: 61  TIEKSGVHLVIDPMSLQYLIGGTVDYTEGLEGSRFVVNNPNASTTCGCGSSFSI 114


>gi|296331800|ref|ZP_06874267.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|305675810|ref|YP_003867482.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           subtilis subsp. spizizenii str. W23]
 gi|296151125|gb|EFG92007.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|305414054|gb|ADM39173.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           subtilis subsp. spizizenii str. W23]
          Length = 120

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS+ VT+TEAA   IK+++   + +   +R+ +K GGC+GL Y +    +          
Sbjct: 1   MSNPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKGESDSMFD- 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           + G+ V +D  SL  M GT ID+K   L  GF   NPN +++CGCG S 
Sbjct: 60  QHGITVLVDKESLDIMNGTVIDYKQSMLGGGFTIDNPNAIASCGCGSSF 108


>gi|209963822|ref|YP_002296737.1| Iron-sulfur cluster assembly accessory protein [Rhodospirillum
           centenum SW]
 gi|209957288|gb|ACI97924.1| Iron-sulfur cluster assembly accessory protein [Rhodospirillum
           centenum SW]
          Length = 117

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 68/110 (61%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              +T+T+AA  R++ ++  S     G+R+ +K  GC+G+ Y V+    +    ++++E 
Sbjct: 9   PKALTLTDAAAERVRLLMARSSEPILGLRVGVKARGCSGMSYFVEYA-KDRKKFEEVVED 67

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GV + ID A+ +++LG+E+D+  ++  SGF F NPN+ + CGCG+S  +
Sbjct: 68  KGVTILIDPAATMFLLGSEMDYVEDRFQSGFTFRNPNEKARCGCGESFTV 117


>gi|56421491|ref|YP_148809.1| hypothetical protein GK2956 [Geobacillus kaustophilus HTA426]
 gi|56381333|dbj|BAD77241.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
          Length = 121

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 61/106 (57%), Gaps = 1/106 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TEAA ++IK+++   + +   +R+ +  GGC+GL Y +    +   D  +   + G
Sbjct: 5   VITLTEAAAFQIKDMMKEQEEEGAYLRVGVHGGGCSGLSYGMGFDHERREDDIEFE-QHG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           +K+ +D  S   + GT ID+K   L  GF  +NPN ++ CGCG S 
Sbjct: 64  IKILVDRDSAPILRGTVIDYKQSLLGGGFTINNPNAIATCGCGSSF 109


>gi|71274648|ref|ZP_00650936.1| HesB/YadR/YfhF [Xylella fastidiosa Dixon]
 gi|71899639|ref|ZP_00681793.1| HesB/YadR/YfhF [Xylella fastidiosa Ann-1]
 gi|170730915|ref|YP_001776348.1| iron-sulfur cluster insertion protein ErpA [Xylella fastidiosa M12]
 gi|226694587|sp|B0U4D9|ERPA_XYLFM RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|71164380|gb|EAO14094.1| HesB/YadR/YfhF [Xylella fastidiosa Dixon]
 gi|71730591|gb|EAO32668.1| HesB/YadR/YfhF [Xylella fastidiosa Ann-1]
 gi|167965708|gb|ACA12718.1| HesB-like protein [Xylella fastidiosa M12]
          Length = 128

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T AA  +++E++         +R+ ++ GGC+G +Y  +   +N  D D ++E DGV
Sbjct: 23  LNFTMAAAAKVRELIQEENSADLALRVYIQGGGCSGFQYGFEFD-ENRADDDLVLETDGV 81

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y+LG E+D+      + FV  NPN  + CGCG S  I
Sbjct: 82  VLLVDPLSLQYLLGAEVDYTESLTGAKFVIRNPNAKTTCGCGSSFSI 128


>gi|148651864|ref|YP_001278957.1| iron-sulfur cluster insertion protein ErpA [Psychrobacter sp.
           PRwf-1]
 gi|148570948|gb|ABQ93007.1| iron-sulfur cluster assembly accessory protein [Psychrobacter sp.
           PRwf-1]
          Length = 109

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 52/107 (48%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T++A  +++++          +R+ +  GGC+G  Y  +   +   D       D V
Sbjct: 4   ITLTDSAANKVRKLREEEGDNNLMLRVYVTGGGCSGFSYGFNFADEEGEDDASFENAD-V 62

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +DS S  Y+ G+ +D+      + FV  NPN  + CGCG S  I
Sbjct: 63  TLLVDSLSYQYLQGSTVDYTEGLEGARFVVTNPNATTTCGCGSSFSI 109


>gi|288939871|ref|YP_003442111.1| iron-sulfur cluster assembly accessory protein [Allochromatium
           vinosum DSM 180]
 gi|288895243|gb|ADC61079.1| iron-sulfur cluster assembly accessory protein [Allochromatium
           vinosum DSM 180]
          Length = 116

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 32/104 (30%), Positives = 54/104 (51%), Gaps = 1/104 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T +A  ++ E++ +       +R+ ++ GGC+G +Y      D      +++  DGVK+
Sbjct: 13  FTASAASKVAELIRDEGNPGLMLRVYIQGGGCSGFQYGFTFDEDVQDGDTEVVT-DGVKL 71

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            +D  SL Y++G EID+      + FV  NPN  + CGCG S  
Sbjct: 72  LVDPMSLQYLMGAEIDYTEGLQGAQFVIRNPNATTTCGCGSSFS 115


>gi|226328923|ref|ZP_03804441.1| hypothetical protein PROPEN_02825 [Proteus penneri ATCC 35198]
 gi|225202109|gb|EEG84463.1| hypothetical protein PROPEN_02825 [Proteus penneri ATCC 35198]
          Length = 114

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +  T+AA  ++K+++ + +     +R+ +  GGC+G +Y      D   +GD  IE
Sbjct: 5   MALPLQFTDAAANKVKDLIADEENPNLRLRVYITGGGCSGFQYGFTFD-DAMNEGDMTIE 63

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV + +D  SL Y++G  +D+      S F+  NPN  S CGCG S  I
Sbjct: 64  KQGVALVVDPMSLQYLVGGCVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI 114


>gi|197284115|ref|YP_002149987.1| iron-sulphur protein [Proteus mirabilis HI4320]
 gi|227358013|ref|ZP_03842355.1| HesB family protein [Proteus mirabilis ATCC 29906]
 gi|226694553|sp|B4EUE2|ERPA_PROMH RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|194681602|emb|CAR40598.1| putative iron-sulphur protein [Proteus mirabilis HI4320]
 gi|227161748|gb|EEI46780.1| HesB family protein [Proteus mirabilis ATCC 29906]
          Length = 114

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +  T+AA  ++K+++ + +     +R+ +  GGC+G +Y      D   +GD  IE
Sbjct: 5   MALPLQFTDAAANKVKDLIADEENPNLRLRVYITGGGCSGFQYGFTFD-DAMNEGDMTIE 63

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV + ID  SL Y++G  +D+      S F+  NPN  S CGCG S  I
Sbjct: 64  KQGVALVIDPMSLQYLVGGCVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI 114


>gi|16080269|ref|NP_391096.1| chaperone involved in Fe-S cluster assembly [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221311158|ref|ZP_03593005.1| hypothetical protein Bsubs1_17456 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221315485|ref|ZP_03597290.1| hypothetical protein BsubsN3_17372 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221320400|ref|ZP_03601694.1| hypothetical protein BsubsJ_17335 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221324684|ref|ZP_03605978.1| hypothetical protein BsubsS_17486 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321312760|ref|YP_004205047.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           subtilis BSn5]
 gi|6648028|sp|O32113|YUTM_BACSU RecName: Full=Uncharacterized protein yutM
 gi|2635713|emb|CAB15206.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|320019034|gb|ADV94020.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           subtilis BSn5]
          Length = 120

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS+ VT+TEAA   IK+++   + +   +R+ +K GGC+GL Y +    +          
Sbjct: 1   MSNPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKSESDSVFD- 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           + G+ V +D  SL  M GT ID+K   L  GF   NPN +++CGCG S 
Sbjct: 60  QHGITVLVDKESLDIMNGTVIDYKQSMLGGGFTIDNPNAIASCGCGSSF 108


>gi|269214368|ref|ZP_06158536.1| iron-sulfur cluster assembly protein IscA [Neisseria lactamica ATCC
           23970]
 gi|313668527|ref|YP_004048811.1| HesB-like protein [Neisseria lactamica ST-640]
 gi|269209929|gb|EEZ76384.1| iron-sulfur cluster assembly protein IscA [Neisseria lactamica ATCC
           23970]
 gi|313005989|emb|CBN87448.1| HesB-like protein [Neisseria lactamica 020-06]
          Length = 126

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 65/110 (59%), Gaps = 2/110 (1%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            +++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V +   D      +
Sbjct: 19  KNMITLTENAAKHINDYLAK-RGKGLGVRLGVKTSGCSGMAYNLEFVDEADGDDLIFE-E 76

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 77  HGARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 126


>gi|167622970|ref|YP_001673264.1| iron-sulfur cluster insertion protein ErpA [Shewanella halifaxensis
           HAW-EB4]
 gi|189037866|sp|B0TIR0|ERPA_SHEHH RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|167352992|gb|ABZ75605.1| iron-sulfur cluster assembly accessory protein [Shewanella
           halifaxensis HAW-EB4]
          Length = 116

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++   +  A  +R+ +  GGC+G +Y              +  K GV
Sbjct: 11  IRFTDAAASKVKTLLEEEENDALKLRVYVTGGGCSGFQYGFTFDEKINEGDYTVE-KQGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G E+D+ +    S F   NPN  + CGCG S  +
Sbjct: 70  QLVVDPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV 116


>gi|83748485|ref|ZP_00945507.1| HesB protein family [Ralstonia solanacearum UW551]
 gi|207725257|ref|YP_002255653.1| hypothetical protein RSMK00197 [Ralstonia solanacearum MolK2]
 gi|207743632|ref|YP_002260024.1| hypothetical protein RSIPO_01815 [Ralstonia solanacearum IPO1609]
 gi|300692016|ref|YP_003753011.1| Fe-S cluster assembly and activation factor [Ralstonia solanacearum
           PSI07]
 gi|300704649|ref|YP_003746252.1| Fe-S cluster assembly and activation factor [Ralstonia solanacearum
           CFBP2957]
 gi|83724896|gb|EAP72052.1| HesB protein family [Ralstonia solanacearum UW551]
 gi|206590491|emb|CAQ37453.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
 gi|206595031|emb|CAQ61958.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
 gi|299066986|emb|CBJ38181.1| Fe-S cluster assembly and activation factor [Ralstonia solanacearum
           CMR15]
 gi|299072313|emb|CBJ43647.1| Fe-S cluster assembly and activation factor [Ralstonia solanacearum
           CFBP2957]
 gi|299079076|emb|CBJ51738.1| Fe-S cluster assembly and activation factor [Ralstonia solanacearum
           PSI07]
          Length = 106

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+ A   +   +   +GK  G+R+ +K  GC+GL Y ++   D     D++ E +G
Sbjct: 1   MITLTDKAAQHVTRYLA-RRGKGVGLRLGVKTTGCSGLAYKLEYA-DEIAAEDNVFESNG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV +D  SL Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 59  VKVIVDPKSLPYIDGTELDYAREGLNEGFRFNNPNVKDECGCGESFRV 106


>gi|297528904|ref|YP_003670179.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           C56-T3]
 gi|297252156|gb|ADI25602.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           C56-T3]
          Length = 121

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 61/106 (57%), Gaps = 1/106 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TEAA ++IK+++   + +   +R+ +  GGC+GL Y +    +   D  +   + G
Sbjct: 5   VITLTEAAAFQIKDMMKEQEEEGAYLRVGVHGGGCSGLSYGMGFDHERRDDDIEFE-QHG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           +K+ +D  S   + GT ID+K   L  GF  +NPN ++ CGCG S 
Sbjct: 64  IKILVDRDSAPILRGTVIDYKQSLLGGGFTINNPNAIATCGCGSSF 109


>gi|190150738|ref|YP_001969263.1| hypothetical protein APP7_1469 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307264140|ref|ZP_07545734.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|226736759|sp|B3H296|ERPA_ACTP7 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|189915869|gb|ACE62121.1| hypothetical protein APP7_1469 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306870514|gb|EFN02264.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 113

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           M+DI   +  T+AA  ++K ++         +R+ +  GGC+G +Y              
Sbjct: 1   MNDIQIPIIFTDAAAKKVKSLIEGEDNPNLRLRVYITGGGCSGFQYGFTFDDQINEGDLT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +  ++ V + +D  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 61  IENQN-VGLVVDPMSLQYLIGGTVDYTEGLDGSRFVVQNPNASSTCGCGSSFSI 113


>gi|296101326|ref|YP_003611472.1| iron-sulfur cluster insertion protein ErpA [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295055785|gb|ADF60523.1| iron-sulfur cluster insertion protein ErpA [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 114

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ +       +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 9   LEFTEAAANKVKTLIADEDNPDLKLRVYITGGGCSGFQYGFTFD-DQVNDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 68  ALVVDPMSLQYLVGGSVDYTEGLEGSRFVVTNPNATSTCGCGSSFSI 114


>gi|55981604|ref|YP_144901.1| iron-sulfur cluster biosynthesis protein IscA [Thermus thermophilus
           HB8]
 gi|55773017|dbj|BAD71458.1| iron-sulfur cluster biosynthesis protein IscA [Thermus thermophilus
           HB8]
          Length = 126

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 36/112 (32%), Positives = 58/112 (51%), Gaps = 1/112 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T  A  + KEI+     +   IR+ +K GGC+G +Y + +          +    G
Sbjct: 8   VIRITPLAAEKAKEILARYGKEHAAIRVYIKSGGCSGFQYGMAVDERELPGDTFVEM-HG 66

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           V++ +D  SL Y++G+EID+    +  GF  HNPN  S CGCG S   K  +
Sbjct: 67  VRLVVDRMSLPYLVGSEIDWVESLMGGGFTVHNPNAASTCGCGHSFRTKDQE 118


>gi|269468555|gb|EEZ80204.1| hypothetical protein Sup05_0673 [uncultured SUP05 cluster
           bacterium]
          Length = 117

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 59/107 (55%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  +++A  ++ +++   + +   +R+ +  GGC+G  Y      ++  +GD  +E +GV
Sbjct: 12  IIFSDSAAKKVADLIQEEKNENLKLRVYITGGGCSGFSYGFTFD-EDHKEGDSGVENNGV 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  S  Y++G  +D+  +   S F+ HNPN  + CGCG S  +
Sbjct: 71  QLVVDPMSYQYLIGATVDYLEDLQGSRFIIHNPNAKTTCGCGSSFSV 117


>gi|254456455|ref|ZP_05069884.1| HesB protein [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083457|gb|EDZ60883.1| HesB protein [Candidatus Pelagibacter sp. HTCC7211]
          Length = 111

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 51/112 (45%), Positives = 84/112 (75%), Gaps = 1/112 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+ I+ +++ A  RIKEI+ N++  + G+R+S+K GGCAG+ Y+++   +     D++IE
Sbjct: 1   MNPIIKLSDNAALRIKEIMSNAEKDSLGVRVSVKTGGCAGMSYVMEYTKEA-NPNDEVIE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
             GVKV++DSA+++Y+LGTE+D+K E+L S FVF+NPN+   CGCG+S +I+
Sbjct: 60  DKGVKVFVDSAAVMYLLGTEMDYKKEELSSSFVFNNPNETERCGCGESFKIE 111


>gi|197121046|ref|YP_002132997.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           sp. K]
 gi|220915739|ref|YP_002491043.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|196170895|gb|ACG71868.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           sp. K]
 gi|219953593|gb|ACL63977.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 110

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 43/111 (38%), Positives = 68/111 (61%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  + ++E A  +IK +       A G+R+ +K GGC+GL Y +D   +     D +IE
Sbjct: 1   MAAAIEISEKAAVQIKALGAQKGTPAGGLRLGVKGGGCSGLSYFIDWSNEP-ARFDQVIE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +DG +V++D  S +++ GT ID++   + +GFVF NPN  SACGCG+S  I
Sbjct: 60  RDGARVFVDPKSAVFLAGTVIDWQQTLMQTGFVFRNPNVKSACGCGESFTI 110


>gi|170725565|ref|YP_001759591.1| iron-sulfur cluster insertion protein ErpA [Shewanella woodyi ATCC
           51908]
 gi|169810912|gb|ACA85496.1| iron-sulfur cluster assembly accessory protein [Shewanella woodyi
           ATCC 51908]
          Length = 122

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++   +  A  +R+ +  GGC+G +Y              +  K GV
Sbjct: 17  IQFTDAAASKVKTLLEEEENDALKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTVE-KQGV 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G E+D+ +    S F   NPN  + CGCG S  +
Sbjct: 76  QLVVDPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV 122


>gi|28867833|ref|NP_790452.1| HesB/YadR/YfhF family protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|66047795|ref|YP_237636.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. syringae B728a]
 gi|71737840|ref|YP_272983.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|213967619|ref|ZP_03395766.1| HesB/YadR/YfhF family protein [Pseudomonas syringae pv. tomato T1]
 gi|237803465|ref|ZP_04591050.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. oryzae str. 1_6]
 gi|257483165|ref|ZP_05637206.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|289623558|ref|ZP_06456512.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. aesculi str. NCPPB3681]
 gi|289650836|ref|ZP_06482179.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. aesculi str. 2250]
 gi|298485365|ref|ZP_07003456.1| FeS cluster assembly protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|301381484|ref|ZP_07229902.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. tomato Max13]
 gi|302058573|ref|ZP_07250114.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. tomato K40]
 gi|302132207|ref|ZP_07258197.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. tomato NCPPB 1108]
 gi|302189574|ref|ZP_07266247.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. syringae 642]
 gi|75500398|sp|Q4ZMM4|ERPA_PSEU2 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|81732647|sp|Q889Z2|ERPA_PSESM RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|123638278|sp|Q48NN6|ERPA_PSE14 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|28851069|gb|AAO54147.1| HesB/YadR/YfhF family protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|63258502|gb|AAY39598.1| HesB/YadR/YfhF [Pseudomonas syringae pv. syringae B728a]
 gi|71558393|gb|AAZ37604.1| HesB/YadR/YfhF family protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|213927395|gb|EEB60943.1| HesB/YadR/YfhF family protein [Pseudomonas syringae pv. tomato T1]
 gi|298160132|gb|EFI01162.1| FeS cluster assembly protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320325934|gb|EFW81993.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. glycinea str. B076]
 gi|320332000|gb|EFW87936.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. glycinea str. race 4]
 gi|330868549|gb|EGH03258.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. aesculi str. 0893_23]
 gi|330878333|gb|EGH12482.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. morsprunorum str. M302280PT]
 gi|330882163|gb|EGH16312.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. glycinea str. race 4]
 gi|330891254|gb|EGH23915.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. mori str. 301020]
 gi|330898954|gb|EGH30373.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. japonica str. M301072PT]
 gi|330938386|gb|EGH42012.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. pisi str. 1704B]
 gi|330955038|gb|EGH55298.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           Cit 7]
 gi|330961007|gb|EGH61267.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. maculicola str. ES4326]
 gi|330963947|gb|EGH64207.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. actinidiae str. M302091]
 gi|330970783|gb|EGH70849.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. aceris str. M302273PT]
 gi|330980908|gb|EGH79011.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. aptata str. DSM 50252]
 gi|330985738|gb|EGH83841.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. lachrymans str. M301315]
 gi|331011601|gb|EGH91657.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|331017522|gb|EGH97578.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. lachrymans str. M302278PT]
 gi|331025447|gb|EGI05503.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. oryzae str. 1_6]
          Length = 116

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T  A +++K +V         +R+ +  GGC+G +Y      ++  D D ++E++GV
Sbjct: 11  LEFTPNAAHKVKTLVDEEGNDRLKLRVFVTGGGCSGFQYGFTFD-EDVADDDTIVEREGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S  Y+ G E+D++     S FV  NPN  + CGCG S  I
Sbjct: 70  SLVVDPMSFQYLAGAEVDYQEGLEGSRFVIKNPNASTTCGCGSSFSI 116


>gi|187927981|ref|YP_001898468.1| iron-sulfur cluster assembly protein IscA [Ralstonia pickettii 12J]
 gi|241662563|ref|YP_002980923.1| iron-sulfur cluster assembly protein IscA [Ralstonia pickettii 12D]
 gi|309781146|ref|ZP_07675883.1| iron-sulfur cluster assembly protein IscA [Ralstonia sp. 5_7_47FAA]
 gi|187724871|gb|ACD26036.1| iron-sulfur cluster assembly protein IscA [Ralstonia pickettii 12J]
 gi|240864590|gb|ACS62251.1| iron-sulfur cluster assembly protein IscA [Ralstonia pickettii 12D]
 gi|308919967|gb|EFP65627.1| iron-sulfur cluster assembly protein IscA [Ralstonia sp. 5_7_47FAA]
          Length = 106

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+ A   +   +   +GK  G+R+ +K  GC+GL Y ++   D     D + E +G
Sbjct: 1   MITLTDKAAQHVSRYL-TRRGKGVGLRVGVKTTGCSGLAYKLEYA-DEIATEDQVFESNG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV +D  SL Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 59  VKVIVDPKSLPYIDGTELDYAREGLNEGFRFNNPNVKDECGCGESFRV 106


>gi|134291402|ref|YP_001115171.1| iron-sulfur cluster insertion protein ErpA [Burkholderia
           vietnamiensis G4]
 gi|160380660|sp|A4JRL3|ERPA2_BURVG RecName: Full=Putative iron-sulfur cluster insertion protein erpA 2
 gi|134134591|gb|ABO58916.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           vietnamiensis G4]
          Length = 124

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T  A  ++  ++         +R+ +  GGC+G +Y      D   D D  +  DGV
Sbjct: 19  LDFTPNAAAKVAALIDAEGNPQLKLRLYVSGGGCSGFQYGFAFD-DQVADDDLQVVTDGV 77

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + ID+ S  Y+ G  +D++     S FV  NPN  S CGCG S  +
Sbjct: 78  TLLIDAMSRQYLAGARVDYEDGLEGSRFVIQNPNAQSTCGCGSSFSV 124


>gi|46199574|ref|YP_005241.1| hesB protein [Thermus thermophilus HB27]
 gi|46197200|gb|AAS81614.1| hesB protein [Thermus thermophilus HB27]
          Length = 126

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/112 (33%), Positives = 59/112 (52%), Gaps = 1/112 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T  A  + KEI+     +   IR+ +K GGC+G +Y + +          +    G
Sbjct: 8   VIRITPLAAEKAKEILARYGKEHAAIRVYIKSGGCSGFQYGMAVDERELPGDTFVEM-HG 66

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           V++ +D  SL Y++G+EID+    +  GF  HNPN VS CGCG S   K  +
Sbjct: 67  VRLVVDRMSLPYLVGSEIDWVESLMGGGFTVHNPNAVSTCGCGHSFRTKDQE 118


>gi|157147412|ref|YP_001454731.1| hypothetical protein CKO_03211 [Citrobacter koseri ATCC BAA-895]
 gi|226694532|sp|A8ALD2|ERPA_CITK8 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|157084617|gb|ABV14295.1| hypothetical protein CKO_03211 [Citrobacter koseri ATCC BAA-895]
          Length = 114

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ +       +R+ +  GGC+G +Y              +  K GV
Sbjct: 9   LQFTEAAAKKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIE-KQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 68  GLVVDPMSLQYLVGGAVDYTEGLEGSRFVVTNPNAKSTCGCGSSFSI 114


>gi|15892651|ref|NP_360365.1| hesB protein [Rickettsia conorii str. Malish 7]
 gi|15619822|gb|AAL03266.1| hesB protein [Rickettsia conorii str. Malish 7]
          Length = 110

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 70/111 (63%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T++A  +IK ++        GIR+ +K GGCAG  Y V+         D+++E
Sbjct: 1   MKNVISLTDSAAKQIKLLIEKRAKPTFGIRVGVKSGGCAGQTYYVEYADSK-NQFDEVVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+E+D+   K  S F F NPN+ ++CGCG+S  +
Sbjct: 60  EKGVRILIDPKALMYILGSEMDYVETKFKSQFTFTNPNEKASCGCGKSFRV 110


>gi|219872095|ref|YP_002476470.1| iron-sulfur cluster insertion protein ErpA [Haemophilus parasuis
           SH0165]
 gi|254783676|sp|B8F870|ERPA_HAEPS RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|219692299|gb|ACL33522.1| iron-sulfur cluster insertion protein ErpA [Haemophilus parasuis
           SH0165]
          Length = 113

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 54/114 (47%), Gaps = 4/114 (3%)

Query: 1   MSDIV---TMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSDI+     T+AA  ++K ++   +     +R+ +  GGC+G +Y              
Sbjct: 1   MSDILVPLIFTDAAAKKVKFLIEGEENPELRLRVYITGGGCSGFQYGFTFDDKLNEGDLT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +   D V + ID  SL Y++G  ID+      S FV  NPN  S CGCG S  I
Sbjct: 61  IENLD-VALVIDPMSLQYLIGATIDYVEGLDGSRFVVQNPNASSTCGCGASFSI 113


>gi|261338845|ref|ZP_05966703.1| hypothetical protein ENTCAN_05041 [Enterobacter cancerogenus ATCC
           35316]
 gi|288318668|gb|EFC57606.1| iron-sulfur cluster insertion protein ErpA [Enterobacter
           cancerogenus ATCC 35316]
          Length = 114

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ +       +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 9   LQFTEAAANKVKTLIADEDNPDLKLRVYITGGGCSGFQYGFTFD-DQVNDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 68  ALVVDPMSLQYLVGGAVDYTEGLEGSRFVVTNPNATSTCGCGSSFSI 114


>gi|104779734|ref|YP_606232.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas entomophila
           L48]
 gi|160385715|sp|Q1IFY7|ERPA_PSEE4 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|95108721|emb|CAK13415.1| conserved hypothetical protein; HESB/YADR/YFHF family protein
           [Pseudomonas entomophila L48]
          Length = 116

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T  A +++K +V         +R+ +  GGC+G +Y      ++  + D ++E++GV
Sbjct: 11  LEFTPGAAHKVKTLVSEEGNDRLKLRVFVTGGGCSGFQYGFTFD-EDVAEDDTIVEREGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S  Y+ G E+D++     S FV  NPN  + CGCG S  I
Sbjct: 70  ALVVDPMSFQYLAGAEVDYQEGLEGSRFVIKNPNATTTCGCGSSFSI 116


>gi|73540762|ref|YP_295282.1| HesB/YadR/YfhF:Iron-sulphur cluster assembly protein IscA
           [Ralstonia eutropha JMP134]
 gi|72118175|gb|AAZ60438.1| HesB/YadR/YfhF:Iron-sulphur cluster assembly protein IscA
           [Ralstonia eutropha JMP134]
          Length = 106

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMTE A   +   +   +GK  G+R+ +K  GC+GL Y ++ V +   + +      G
Sbjct: 1   MITMTEKAARHVARYL-ERRGKGVGLRLGVKTTGCSGLAYKLEYVDELHPEDEVFE-SHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +KV +D+ SL Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 59  IKVIVDAKSLPYIDGTELDYAREGLNEGFRFNNPNVKDECGCGESFTV 106


>gi|17545740|ref|NP_519142.1| hypothetical protein RSc1021 [Ralstonia solanacearum GMI1000]
 gi|17428034|emb|CAD14723.1| conserved hypothetical protein [Ralstonia solanacearum GMI1000]
          Length = 106

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 42/108 (38%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A   +   +   +GK  G+R+ +K  GC+GL Y ++   D     D++ E +G
Sbjct: 1   MITLTEKAAQHVTRYLA-RRGKGVGLRVGVKTTGCSGLAYKLEYA-DEIAAEDNVFESNG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV +D  SL Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 59  VKVIVDPKSLPYIDGTELDYAREGLNEGFRFNNPNVKDECGCGESFRV 106


>gi|326794259|ref|YP_004312079.1| Iron--sulfur cluster insertion protein erpA [Marinomonas
           mediterranea MMB-1]
 gi|326545023|gb|ADZ90243.1| Iron--sulfur cluster insertion protein erpA [Marinomonas
           mediterranea MMB-1]
          Length = 113

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 30/109 (27%), Positives = 57/109 (52%), Gaps = 1/109 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           D +  T AA  ++K ++   + +   +R+ +  GGC+G +Y      +   D  ++   +
Sbjct: 6   DPIEFTSAAAAKLKSLIEEEENERLMLRVYVTGGGCSGFQYGFTFDEEYQEDDTEVKR-E 64

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GV++ +D  S  Y++G+E+D++     + F   NPN  S CGCG S  +
Sbjct: 65  GVRMVVDPLSFQYLVGSEVDYQENLEGARFTVTNPNATSTCGCGASFSV 113


>gi|241068515|ref|XP_002408456.1| iron-sulfur protein Isa2, putative [Ixodes scapularis]
 gi|215492444|gb|EEC02085.1| iron-sulfur protein Isa2, putative [Ixodes scapularis]
          Length = 129

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 69/111 (62%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T++A  ++K ++        GIR+ +K GGCAG  Y V+         D+++E
Sbjct: 20  MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGVKSGGCAGQTYYVEYADSK-NQFDEIVE 78

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+E+D+   K  S F F NPN+ + CGCG+S  +
Sbjct: 79  EKGVRILIDPKALMYILGSEMDYVETKFKSQFTFTNPNEKANCGCGKSFSV 129


>gi|218296259|ref|ZP_03497015.1| iron-sulfur cluster assembly accessory protein [Thermus aquaticus
           Y51MC23]
 gi|218243331|gb|EED09861.1| iron-sulfur cluster assembly accessory protein [Thermus aquaticus
           Y51MC23]
          Length = 126

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 36/112 (32%), Positives = 58/112 (51%), Gaps = 1/112 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T  A  + KEI+     +   IR+ +K GGC+G +Y + +          +    G
Sbjct: 8   VIRITPLAAEKAKEILARYGKEGAAIRVYIKSGGCSGFQYGMAVDERELEGDTFVEM-HG 66

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           V++ +D  SL Y++G+EID+    +  GF  HNPN  S CGCG S   K  +
Sbjct: 67  VRLVVDQRSLPYLVGSEIDWVESLMGGGFTVHNPNAASTCGCGHSFRTKDQE 118


>gi|157960813|ref|YP_001500847.1| iron-sulfur cluster insertion protein ErpA [Shewanella pealeana
           ATCC 700345]
 gi|189037867|sp|A8H175|ERPA_SHEPA RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|157845813|gb|ABV86312.1| iron-sulfur cluster assembly accessory protein [Shewanella pealeana
           ATCC 700345]
          Length = 116

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++   +  A  +R+ +  GGC+G +Y              +  K GV
Sbjct: 11  IRFTDAAASKVKTLLEEEENDALKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTVE-KQGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G E+D+ +    S F   NPN  + CGCG S  +
Sbjct: 70  QLVVDPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV 116


>gi|300114569|ref|YP_003761144.1| iron-sulfur cluster assembly accessory protein [Nitrosococcus
           watsonii C-113]
 gi|299540506|gb|ADJ28823.1| iron-sulfur cluster assembly accessory protein [Nitrosococcus
           watsonii C-113]
          Length = 116

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 52/110 (47%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M + +  T+ A  ++KE++     +   +R+ +  GGC+G +Y       +      +  
Sbjct: 7   MLNSLIFTDTAAGKVKELIKEEGNEKLMLRVFITGGGCSGFQYGFTFDEASHEGDTQVKN 66

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             GV + ID  S  Y++G EID+      + FV  NPN  + CGCG S  
Sbjct: 67  -GGVTLLIDPTSYQYLVGAEIDYTEGLEGAQFVIRNPNAETTCGCGSSFS 115


>gi|269926518|ref|YP_003323141.1| iron-sulfur cluster assembly accessory protein [Thermobaculum
           terrenum ATCC BAA-798]
 gi|269790178|gb|ACZ42319.1| iron-sulfur cluster assembly accessory protein [Thermobaculum
           terrenum ATCC BAA-798]
          Length = 118

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 61/107 (57%), Gaps = 1/107 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +VT+TE+A  +IK+++     +   +R+ +  GGC+GL Y +    +   +      ++G
Sbjct: 1   MVTITESAAAKIKDLMEKEGQQGAALRLYVAGGGCSGLNYGMAFEEEVDPEDHVFE-QNG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           VK+ IDS S  Y+ G+EID+      SGF  +NPN VS C CG S +
Sbjct: 60  VKILIDSYSYPYVKGSEIDYIDGLFGSGFTINNPNAVSTCACGHSFD 106


>gi|291485680|dbj|BAI86755.1| hypothetical protein BSNT_04758 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 121

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS+ VT+TEAA   IK+++   + +   +R+ +K GGC+GL Y +    +          
Sbjct: 2   MSNPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKSESDSVFD- 60

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           + G+ V +D  SL  M GT ID+K   L  GF   NPN +++CGCG S 
Sbjct: 61  QHGITVLVDKESLDIMNGTVIDYKQSMLGGGFTIDNPNAIASCGCGSSF 109


>gi|170768608|ref|ZP_02903061.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           albertii TW07627]
 gi|170122712|gb|EDS91643.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           albertii TW07627]
          Length = 114

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 52/107 (48%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ +       +R+ +  GGC+G +Y              +  K GV
Sbjct: 9   LEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIE-KQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+ +NPN  S CGCG S  I
Sbjct: 68  GLVVDPMSLQYLVGGSVDYTEGLEGSRFIVNNPNAKSTCGCGSSFSI 114


>gi|289676241|ref|ZP_06497131.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. syringae FF5]
          Length = 116

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T  A +++K +V         +R+ +  GGC+G +Y      D   D   +   +GV
Sbjct: 11  LEFTPNAAHKVKTLVDEEGNDRLKLRVFVTGGGCSGFQYGFTFDDDVADDDTIVER-EGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S  Y+ G E+D++     S FV  NPN  + CGCG S  I
Sbjct: 70  SLVVDPMSFQYLAGAEVDYQEGLEGSRFVIKNPNASTTCGCGSSFSI 116


>gi|240128415|ref|ZP_04741076.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268686811|ref|ZP_06153673.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268627095|gb|EEZ59495.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae SK-93-1035]
          Length = 126

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 64/109 (58%), Gaps = 2/109 (1%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V +   D        
Sbjct: 20  NMITLTENAAKHINDYLAK-RGKGLGVRLGVKTSGCSGMAYNLEFVDEANGDDLIFER-H 77

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 78  GARIYIDPKSLVYLDGTQVDYTKEDLQEGFKFENPNVKDSCGCGESFHV 126


>gi|332991814|gb|AEF01869.1| HesB protein family [Alteromonas sp. SN2]
          Length = 114

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +  ++AA  ++K ++   +  A  +R+ +  GGC+G +Y      +   DGD  I+
Sbjct: 5   MALPIEFSDAAATKVKALITEEENPALKLRVYVTGGGCSGFQYGFTFD-EKVNDGDMTID 63

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KD V + +D  SL Y++G  +D+      S F+  NPN  + CGCG S  +
Sbjct: 64  KDDVTLVVDPMSLQYLVGGVVDYVEGLEGSRFLVQNPNATTTCGCGASFSV 114


>gi|329296147|ref|ZP_08253483.1| iron-sulfur cluster assembly accessory protein [Plautia stali
           symbiont]
          Length = 115

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ + Q  A  +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 10  LQFTDAAAKKVKNLIADEQNPALKLRVYITGGGCSGFQYGFTFD-DQMNDGDMTIEKQGV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  + CGCG S  I
Sbjct: 69  ALVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSI 115


>gi|297172837|gb|ADI23800.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF4000_47G05]
          Length = 110

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 58/111 (52%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  + ++++AV ++  ++ +        R+ ++ GGC+G +Y      +   D  +   
Sbjct: 1   MTPDIQISDSAVNQLANLIASKDNPNLLFRVYIQGGGCSGFQYGFQFEEEAAGDDLEFDH 60

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GV+V +D  SL Y+ G EIDF  +   S FV +NPN  + CGCG S  +
Sbjct: 61  -SGVRVVVDPMSLQYLGGAEIDFIDDLQGSRFVVNNPNATTTCGCGASFGV 110


>gi|289207588|ref|YP_003459654.1| iron-sulfur cluster assembly accessory protein [Thioalkalivibrio
           sp. K90mix]
 gi|288943219|gb|ADC70918.1| iron-sulfur cluster assembly accessory protein [Thioalkalivibrio
           sp. K90mix]
          Length = 126

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            + +  T+AA  ++K ++     +   +R+ +  GGC+G +Y      +   DGD ++E 
Sbjct: 18  PNPLIFTDAAASKVKGLIEEENNENLKLRVFVSGGGCSGFQYGFTFD-ETVGDGDTVVEN 76

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GV + ID  S  Y++G EID+      + FV  NPN  + CGCG S  +
Sbjct: 77  GGVTLLIDPMSFQYLVGAEIDYTEGLEGAQFVIRNPNATTTCGCGSSFSV 126


>gi|157374234|ref|YP_001472834.1| iron-sulfur cluster insertion protein ErpA [Shewanella sediminis
           HAW-EB3]
 gi|157316608|gb|ABV35706.1| iron-sulfur cluster assembly accessory protein [Shewanella
           sediminis HAW-EB3]
          Length = 120

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++   +  A  +R+ +  GGC+G +Y              +  K GV
Sbjct: 15  IQFTDAAASKVKTLLEEEENDALKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTVE-KQGV 73

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G E+D+ +    S F   NPN  + CGCG S  +
Sbjct: 74  QLVVDPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV 120


>gi|15677244|ref|NP_274397.1| HesB/YadR/YfhF family protein [Neisseria meningitidis MC58]
 gi|7226622|gb|AAF41749.1| HesB/YadR/YfhF family protein [Neisseria meningitidis MC58]
 gi|308389500|gb|ADO31820.1| HesB-like protein [Neisseria meningitidis alpha710]
 gi|316984200|gb|EFV63178.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           H44/76]
          Length = 126

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 64/109 (58%), Gaps = 2/109 (1%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V +   D        
Sbjct: 20  NMITLTENAAKHINDYLAK-RGKGLGVRLGVKTSGCSGMAYNLEFVDEADGDDLIFEG-H 77

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 78  GARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 126


>gi|283783941|ref|YP_003363806.1| hypothetical protein ROD_01601 [Citrobacter rodentium ICC168]
 gi|282947395|emb|CBG86940.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 114

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ +       +R+ +  GGC+G +Y              +  K GV
Sbjct: 9   LQFTEAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIE-KQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 68  GLVVDPMSLQYLVGGSVDYTEGLEGSRFVVTNPNAKSTCGCGSSFSI 114


>gi|237729464|ref|ZP_04559945.1| iron-sulfur cluster insertion protein ErpA [Citrobacter sp. 30_2]
 gi|226909193|gb|EEH95111.1| iron-sulfur cluster insertion protein ErpA [Citrobacter sp. 30_2]
          Length = 114

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ +       +R+ +  GGC+G +Y              +  K GV
Sbjct: 9   LQFTEAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIE-KQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 68  GLVVDPMSLQYLVGGAVDYTEGLEGSRFVVTNPNAKSTCGCGSSFSI 114


>gi|71064617|ref|YP_263344.1| iron-sulfur cluster insertion protein ErpA [Psychrobacter arcticus
           273-4]
 gi|93004875|ref|YP_579312.1| iron-sulfur cluster insertion protein ErpA [Psychrobacter
           cryohalolentis K5]
 gi|122416174|sp|Q1QES5|ERPA_PSYCK RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|123649904|sp|Q4FVP8|ERPA_PSYA2 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|71037602|gb|AAZ17910.1| conserved hypothetical protein [Psychrobacter arcticus 273-4]
 gi|92392553|gb|ABE73828.1| HesB/YadR/YfhF [Psychrobacter cryohalolentis K5]
          Length = 126

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 52/110 (47%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++ +T++A  +++ +          +R+ +  GGC+G  Y  +   +   D  +    
Sbjct: 18  PTVLNLTDSAAQKVRRLREEEGDSNLMLRVYVTGGGCSGFSYGFNFANELNEDDANFDN- 76

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + V + +DS S  Y+ G+ +D+      + F+  NPN  + CGCG S  I
Sbjct: 77  NDVTLVVDSLSYQYLQGSTVDYTEGLEGARFIVTNPNATTTCGCGSSFSI 126


>gi|83648879|ref|YP_437314.1| hypothetical protein HCH_06242 [Hahella chejuensis KCTC 2396]
 gi|123530588|sp|Q2S8Y5|ERPA_HAHCH RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|83636922|gb|ABC32889.1| uncharacterized conserved protein [Hahella chejuensis KCTC 2396]
          Length = 117

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+ A  ++K ++ +       +R+ +  GGC+G +Y          D   +  KDGV
Sbjct: 12  IIFTDNAAAKVKSLIEDEGNDELSLRVFVTGGGCSGFQYGFSFDEAVNEDDTIVE-KDGV 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +DS S  Y++G E+DF+     + FV  NPN  + CGCG S  I
Sbjct: 71  RLVVDSLSYQYLVGAEVDFREGLEGAQFVIKNPNASTTCGCGSSFSI 117


>gi|221234871|ref|YP_002517307.1| HesB protein family [Caulobacter crescentus NA1000]
 gi|220964043|gb|ACL95399.1| HesB protein family [Caulobacter crescentus NA1000]
          Length = 133

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 76/113 (67%), Gaps = 1/113 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             +VT+T+AA  R+KEI+  +     G+R+ +K GGCAG EY+ +   +     D+++E 
Sbjct: 17  PKVVTLTDAAAARVKEIMDKADQPYAGLRVGVKNGGCAGQEYVFEYAKEK-GPIDEVVED 75

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            GV + I+  ++L+++GTEID++  KL S FVFHNPN+  ACGCG+SV I+ A
Sbjct: 76  KGVTILIEPKAVLFLVGTEIDYEVTKLSSKFVFHNPNETDACGCGESVTIQPA 128


>gi|88813724|ref|ZP_01128949.1| HesB/YadR/YfhF [Nitrococcus mobilis Nb-231]
 gi|88789017|gb|EAR20159.1| HesB/YadR/YfhF [Nitrococcus mobilis Nb-231]
          Length = 117

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/118 (33%), Positives = 65/118 (55%), Gaps = 8/118 (6%)

Query: 1   MSDIVT-------MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV 53
           M+++V         T++AV +++E++   +     +R+ +  GGC+G EY      +N  
Sbjct: 1   MTEVVEQGAVPLVFTDSAVEKVRELLHKEEKGDLKLRVYITGGGCSGFEYGFMFD-ENDE 59

Query: 54  DGDDLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +GD +IEKDGV + +D  S+ Y+ G EIDF      + FV  NPN  + CGCG S  +
Sbjct: 60  EGDTVIEKDGVTMVVDPMSIQYLSGAEIDFVESLEGAQFVIRNPNATTTCGCGSSFSV 117


>gi|300312140|ref|YP_003776232.1| transcription regulator protein [Herbaspirillum seropedicae SmR1]
 gi|83630795|gb|ABC26891.1| HesB family protein [Herbaspirillum seropedicae]
 gi|300074925|gb|ADJ64324.1| transcription regulator protein [Herbaspirillum seropedicae SmR1]
          Length = 106

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 43/111 (38%), Positives = 61/111 (54%), Gaps = 5/111 (4%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  +T+TE A  R+   +      A G+R+++K  GC+G+ Y ++         D   E
Sbjct: 1   MS--ITLTENAARRVHAFLAKRS--AVGLRLAVKTSGCSGMAYALEYADVA-EPQDVRFE 55

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GV V ID  SL Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 56  SHGVTVLIDPKSLPYLDGTELDFVREGLNEGFKFNNPNAKNQCGCGESFAV 106


>gi|71277930|ref|YP_271269.1| HesB/YadR/YfhF family protein [Colwellia psychrerythraea 34H]
 gi|123630812|sp|Q47VA3|ERPA_COLP3 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|71143670|gb|AAZ24143.1| HesB/YadR/YfhF family protein [Colwellia psychrerythraea 34H]
          Length = 113

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 38/114 (33%), Positives = 60/114 (52%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS+    +  T++A  ++  ++   +  A  +R+ +  GGC+G +Y      +   DGD 
Sbjct: 1   MSNPELPIKFTDSAASKVLSLITEEENPALKLRVYVTGGGCSGFQYGFTFD-EKVNDGDM 59

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IEK GV + ID  SL Y++  E+D+      S FV +NPN  + CGCG S  I
Sbjct: 60  TIEKQGVMMVIDPMSLQYLVDGEVDYLESLEGSRFVVNNPNATTTCGCGSSFSI 113


>gi|157803650|ref|YP_001492199.1| Iron-sulfur cluster assembly accessory protein [Rickettsia
           canadensis str. McKiel]
 gi|157784913|gb|ABV73414.1| Iron-sulfur cluster assembly accessory protein [Rickettsia
           canadensis str. McKiel]
          Length = 110

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T++A  +IK ++        GIR+ +K GGCAG  Y V+         + +  
Sbjct: 1   MKNVISLTDSAAKQIKLLIAKRDKPTFGIRVGVKSGGCAGQTYYVEYADSKNQFDEIVEA 60

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV++ ID  +L+Y+LG+++D+   K  S F F NPN+   CGCG+S  +
Sbjct: 61  K-GVRILIDPKALMYILGSKMDYVETKFKSQFTFTNPNEKGNCGCGKSFSV 110


>gi|283835220|ref|ZP_06354961.1| hypothetical protein CIT292_09525 [Citrobacter youngae ATCC 29220]
 gi|291068930|gb|EFE07039.1| iron-sulfur cluster insertion protein ErpA [Citrobacter youngae
           ATCC 29220]
          Length = 114

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ +       +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 9   LQFTEAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFD-DQVNDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 68  GLVVDPMSLQYLVGGSVDYTEGLEGSRFVVTNPNAKSTCGCGSSFSI 114


>gi|291616333|ref|YP_003519075.1| YadR [Pantoea ananatis LMG 20103]
 gi|291151363|gb|ADD75947.1| YadR [Pantoea ananatis LMG 20103]
 gi|327392786|dbj|BAK10208.1| HesB/YadR/YfhF family protein YadR [Pantoea ananatis AJ13355]
          Length = 115

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ + +  A  +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 10  LQFTDAAAKKVKNLIADEENPALKLRVYITGGGCSGFQYGFTFD-DQMNDGDMTIEKQGV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  + CGCG S  I
Sbjct: 69  SLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSI 115


>gi|322513307|ref|ZP_08066428.1| iron-sulfur cluster insertion protein ErpA [Actinobacillus ureae
           ATCC 25976]
 gi|322120906|gb|EFX92758.1| iron-sulfur cluster insertion protein ErpA [Actinobacillus ureae
           ATCC 25976]
          Length = 113

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           M+DI   +  T+AA  ++K ++         +R+ +  GGC+G +Y              
Sbjct: 1   MNDIQIPLIFTDAAAKKVKSLIEGEDNPNLRLRVYITGGGCSGFQYGFTFDDQINEGDLT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +  ++ V + +D  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 61  IENQN-VGLVVDPMSLQYLIGGTVDYTEGLDGSRFVVQNPNASSTCGCGSSFSI 113


>gi|118603022|ref|YP_904237.1| iron-sulfur cluster insertion protein ErpA [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
 gi|160385719|sp|A1AXV9|ERPA_RUTMC RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|118567961|gb|ABL02766.1| iron-sulfur cluster assembly accessory protein [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 117

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 27/107 (25%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  ++ A  ++  ++   + +   +R+ +  GGC+G  Y  +   +   +GD  +E +GV
Sbjct: 12  IIFSDNAAKKVSTLIEEEKNENLHLRVYITGGGCSGFSYGFNFD-ETYKEGDSSVENNGV 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  S  Y++G  +D+  +   + F+ HNPN  + CGCG S  +
Sbjct: 71  QLVVDPMSYQYLIGATVDYLEDLQGARFIIHNPNAKTTCGCGSSFSV 117


>gi|152968752|ref|YP_001333861.1| hypothetical protein KPN_00171 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238893154|ref|YP_002917888.1| hypothetical protein KP1_1009 [Klebsiella pneumoniae NTUH-K2044]
 gi|262044773|ref|ZP_06017819.1| iron-sulfur cluster insertion protein ErpA [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|330001635|ref|ZP_08304061.1| iron-sulfur cluster insertion protein ErpA [Klebsiella sp. MS 92-3]
 gi|226694551|sp|A6T4W0|ERPA_KLEP7 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|150953601|gb|ABR75631.1| hypothetical protein KPN_00171 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238545470|dbj|BAH61821.1| hypothetical protein KP1_1009 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259037885|gb|EEW39110.1| iron-sulfur cluster insertion protein ErpA [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|328537577|gb|EGF63797.1| iron-sulfur cluster insertion protein ErpA [Klebsiella sp. MS 92-3]
          Length = 114

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ +       +R+ +  GGC+G +Y              +  K GV
Sbjct: 9   LEFTEAAANKVKHLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIE-KQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  S CGCG S  +
Sbjct: 68  GLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSV 114


>gi|220923249|ref|YP_002498551.1| FeS assembly scaffold SufA [Methylobacterium nodulans ORS 2060]
 gi|219947856|gb|ACL58248.1| FeS assembly scaffold SufA [Methylobacterium nodulans ORS 2060]
          Length = 126

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 51/113 (45%), Positives = 77/113 (68%), Gaps = 1/113 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++T+TEAA  RIK I+  +     G+R+ +K GGCAG+ Y ++   +     D + ++ 
Sbjct: 6   KVMTLTEAAADRIKRIIAEADRPIAGVRVGVKNGGCAGMSYTMEYAEEQRPGEDVVEDR- 64

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           GV+V++D  ++L++LGTE+DF+T KL S FVF+NPNQ SACGCG+SV I  A 
Sbjct: 65  GVRVFVDPKAVLFLLGTEMDFQTTKLASQFVFNNPNQTSACGCGESVAITPAK 117


>gi|32034486|ref|ZP_00134658.1| COG0316: Uncharacterized conserved protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208926|ref|YP_001054151.1| iron-sulfur cluster insertion protein ErpA [Actinobacillus
           pleuropneumoniae L20]
 gi|160380679|sp|A3N2B0|ERPA_ACTP2 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|126097718|gb|ABN74546.1| hypothetical protein APL_1462 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
          Length = 113

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS+I   +  T+AA  ++K ++         +R+ +  GGC+G +Y              
Sbjct: 1   MSNIQIPLIFTDAAAKKVKSLIEGEDNPNLRLRVYITGGGCSGFQYGFTFDDQINEGDLT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +  ++ V + +D  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 61  IENQN-VGLVVDPMSLQYLIGGTVDYTEGLDGSRFVVQNPNASSTCGCGSSFSI 113


>gi|34581605|ref|ZP_00143085.1| hesB protein [Rickettsia sibirica 246]
 gi|157828603|ref|YP_001494845.1| Iron-sulfur cluster assembly accessory protein [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165933317|ref|YP_001650106.1| HesB protein family [Rickettsia rickettsii str. Iowa]
 gi|229586812|ref|YP_002845313.1| Iron-sulfur cluster assembly accessory protein [Rickettsia africae
           ESF-5]
 gi|238650789|ref|YP_002916644.1| HesB protein family protein [Rickettsia peacockii str. Rustic]
 gi|28262990|gb|EAA26494.1| hesB protein [Rickettsia sibirica 246]
 gi|157801084|gb|ABV76337.1| Iron-sulfur cluster assembly accessory protein [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165908404|gb|ABY72700.1| HesB protein family [Rickettsia rickettsii str. Iowa]
 gi|228021862|gb|ACP53570.1| Iron-sulfur cluster assembly accessory protein [Rickettsia africae
           ESF-5]
 gi|238624887|gb|ACR47593.1| HesB protein family protein [Rickettsia peacockii str. Rustic]
          Length = 110

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 69/111 (62%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T++A  ++K ++        GIR+ +K GGCAG  Y V+         D+++E
Sbjct: 1   MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGVKSGGCAGQTYYVEYADSK-NQFDEVVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+E+D+   K  S F F NPN+ + CGCG+S  +
Sbjct: 60  EKGVRILIDPKALMYILGSEMDYVETKFKSQFTFTNPNEKANCGCGKSFSV 110


>gi|161870255|ref|YP_001599425.1| HesB/YadR/YfhF family protein [Neisseria meningitidis 053442]
 gi|304387290|ref|ZP_07369483.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           ATCC 13091]
 gi|161595808|gb|ABX73468.1| HesB/YadR/YfhF family protein [Neisseria meningitidis 053442]
 gi|304338673|gb|EFM04790.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           ATCC 13091]
          Length = 126

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 64/109 (58%), Gaps = 2/109 (1%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V +   D        
Sbjct: 20  NMITLTENAAKHINDYLAK-RGKGLGVRLGVKTSGCSGMAYNLEFVDEADGDDLIFEG-H 77

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 78  GARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 126


>gi|194289265|ref|YP_002005172.1| Fe-S cluster assembly and activation factor [Cupriavidus
           taiwanensis LMG 19424]
 gi|193223100|emb|CAQ69105.1| Fe-S cluster assembly and activation factor [Cupriavidus
           taiwanensis LMG 19424]
          Length = 106

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 42/108 (38%), Positives = 66/108 (61%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMTE A   +   +   +GK  G+R+ +K  GC+GL Y ++ V +  +  D++ E  G
Sbjct: 1   MITMTEKAAKHVARYL-ERRGKGVGLRLGVKTTGCSGLAYKLEYVDEL-LPEDNVFESHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +KV +D+ SL Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 59  IKVIVDAKSLPYIDGTELDYAREGLNEGFRFNNPNVKDECGCGESFTV 106


>gi|206578591|ref|YP_002240354.1| iron-sulfur cluster assembly accessory protein [Klebsiella
           pneumoniae 342]
 gi|288937060|ref|YP_003441119.1| iron-sulfur cluster assembly accessory protein [Klebsiella
           variicola At-22]
 gi|290512481|ref|ZP_06551847.1| iron-sulfur cluster insertion protein erpA [Klebsiella sp. 1_1_55]
 gi|226694550|sp|B5Y1L3|ERPA_KLEP3 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|206567649|gb|ACI09425.1| iron-sulfur cluster assembly accessory protein [Klebsiella
           pneumoniae 342]
 gi|288891769|gb|ADC60087.1| iron-sulfur cluster assembly accessory protein [Klebsiella
           variicola At-22]
 gi|289774822|gb|EFD82824.1| iron-sulfur cluster insertion protein erpA [Klebsiella sp. 1_1_55]
          Length = 114

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ +       +R+ +  GGC+G +Y              +  K GV
Sbjct: 9   LEFTEAAANKVKHLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIE-KQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  S CGCG S  +
Sbjct: 68  GLVVDPMSLQYLVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSV 114


>gi|113867180|ref|YP_725669.1| iron sulfur cluster assembly protein (IscA) [Ralstonia eutropha
           H16]
 gi|113525956|emb|CAJ92301.1| iron sulfur cluster assembly protein (IscA) [Ralstonia eutropha
           H16]
          Length = 106

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 42/108 (38%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMTE A   +   +   +GK  G+R+ +K  GC+GL Y ++ V +  +  D + E  G
Sbjct: 1   MITMTEKAAKHVARYL-ERRGKGVGLRLGVKTTGCSGLAYKLEYVDEL-LPEDAVFESHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +KV +D+ SL Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 59  IKVIVDAKSLPYIDGTELDYAREGLNEGFRFNNPNVKDECGCGESFTV 106


>gi|144899911|emb|CAM76775.1| HesB/YadR/YfhF [Magnetospirillum gryphiswaldense MSR-1]
          Length = 109

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 59/110 (53%), Gaps = 2/110 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS+++ +TE+A  R++ ++         +R+++  GGC+G +Y ++L      D      
Sbjct: 1   MSNVI-LTESAAQRVQALIAMEGKPNMMLRVAVSGGGCSGFQYNIELDDKTGEDDVVTEH 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             GVK+ +D  SL  + GTE+DF  + + + F F NP   S CGCG S  
Sbjct: 60  -HGVKLVVDQTSLDLLDGTEVDFVEDLMGASFQFRNPQATSTCGCGSSFS 108


>gi|253689470|ref|YP_003018660.1| iron-sulfur cluster assembly accessory protein [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251756048|gb|ACT14124.1| iron-sulfur cluster assembly accessory protein [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 115

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ + +     +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 10  LQFTDAAASKVKNLIADEENPELKLRVYITGGGCSGFQYGFTFD-DQINDGDMTIEKQGV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  S CGCG S  +
Sbjct: 69  SLVVDPMSLQYLVGGAVDYTEGLEGSRFVVTNPNAKSTCGCGSSFSV 115


>gi|113971224|ref|YP_735017.1| iron-sulfur cluster insertion protein ErpA [Shewanella sp. MR-4]
 gi|114048462|ref|YP_739012.1| iron-sulfur cluster insertion protein ErpA [Shewanella sp. MR-7]
 gi|117921505|ref|YP_870697.1| iron-sulfur cluster insertion protein ErpA [Shewanella sp. ANA-3]
 gi|122943626|sp|Q0HG57|ERPA_SHESM RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|123030392|sp|Q0HSF0|ERPA_SHESR RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160385721|sp|A0KZS2|ERPA_SHESA RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|113885908|gb|ABI39960.1| iron-sulfur cluster assembly accessory protein [Shewanella sp.
           MR-4]
 gi|113889904|gb|ABI43955.1| iron-sulfur cluster assembly accessory protein [Shewanella sp.
           MR-7]
 gi|117613837|gb|ABK49291.1| iron-sulfur cluster assembly accessory protein [Shewanella sp.
           ANA-3]
          Length = 116

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++   Q  A  +R+ +  GGC+G +Y              +  K GV
Sbjct: 11  IKFTDAAAAKVKGLLEEEQNPALKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTVE-KQGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G E+D+ +    S F   NPN  + CGCG S  +
Sbjct: 70  QLVVDPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV 116


>gi|297250250|ref|ZP_06863916.2| iron-sulfur cluster assembly protein IscA [Neisseria polysaccharea
           ATCC 43768]
 gi|296839404|gb|EFH23342.1| iron-sulfur cluster assembly protein IscA [Neisseria polysaccharea
           ATCC 43768]
          Length = 126

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 64/109 (58%), Gaps = 2/109 (1%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V +   D        
Sbjct: 20  NMITLTENAAKHINDYLAK-RGKGLGVRLGVKTSGCSGMAYNLEFVDEADGDDLIFEG-H 77

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 78  GARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 126


>gi|160387032|sp|Q8EHC4|ERPA_SHEON RecName: Full=Iron-sulfur cluster insertion protein erpA
          Length = 116

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++   Q  A  +R+ +  GGC+G +Y              +  K GV
Sbjct: 11  IKFTDAAAAKVKGLLEEEQNPALKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTVE-KQGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G E+D+ +    S F   NPN  + CGCG S  +
Sbjct: 70  QLVVDPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV 116


>gi|15799840|ref|NP_285852.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           O157:H7 EDL933]
 gi|15829414|ref|NP_308187.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           O157:H7 str. Sakai]
 gi|16128149|ref|NP_414698.1| iron-sulfur cluster insertion protein [Escherichia coli str. K-12
           substr. MG1655]
 gi|30061716|ref|NP_835887.1| iron-sulfur cluster insertion protein ErpA [Shigella flexneri 2a
           str. 2457T]
 gi|56479616|ref|NP_706104.2| iron-sulfur cluster insertion protein ErpA [Shigella flexneri 2a
           str. 301]
 gi|74310777|ref|YP_309196.1| iron-sulfur cluster insertion protein ErpA [Shigella sonnei Ss046]
 gi|82542756|ref|YP_406703.1| iron-sulfur cluster insertion protein ErpA [Shigella boydii Sb227]
 gi|82775547|ref|YP_401894.1| iron-sulfur cluster insertion protein ErpA [Shigella dysenteriae
           Sd197]
 gi|89107037|ref|AP_000817.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|110640377|ref|YP_668105.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli 536]
 gi|110804211|ref|YP_687731.1| iron-sulfur cluster insertion protein ErpA [Shigella flexneri 5
           str. 8401]
 gi|117622443|ref|YP_851356.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli APEC
           O1]
 gi|157156275|ref|YP_001461327.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           E24377A]
 gi|157159623|ref|YP_001456941.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli HS]
 gi|168751376|ref|ZP_02776398.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4113]
 gi|168755770|ref|ZP_02780777.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4401]
 gi|168764337|ref|ZP_02789344.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4501]
 gi|168770371|ref|ZP_02795378.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4486]
 gi|168776994|ref|ZP_02802001.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4196]
 gi|168782049|ref|ZP_02807056.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4076]
 gi|168789266|ref|ZP_02814273.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC869]
 gi|168802312|ref|ZP_02827319.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC508]
 gi|170021490|ref|YP_001726444.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli ATCC
           8739]
 gi|170079793|ref|YP_001729113.1| hypothetical protein ECDH10B_0136 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170682180|ref|YP_001742285.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           SMS-3-5]
 gi|187733127|ref|YP_001878960.1| iron-sulfur cluster insertion protein ErpA [Shigella boydii CDC
           3083-94]
 gi|188494020|ref|ZP_03001290.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli 53638]
 gi|191166323|ref|ZP_03028155.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli B7A]
 gi|191172777|ref|ZP_03034314.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli F11]
 gi|193063211|ref|ZP_03044302.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli E22]
 gi|193067595|ref|ZP_03048562.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli E110019]
 gi|194428250|ref|ZP_03060792.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli B171]
 gi|194433385|ref|ZP_03065664.1| iron-sulfur cluster assembly accessory protein YadR [Shigella
           dysenteriae 1012]
 gi|194439094|ref|ZP_03071176.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli 101-1]
 gi|195938161|ref|ZP_03083543.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           O157:H7 str. EC4024]
 gi|208805701|ref|ZP_03248038.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4206]
 gi|208813117|ref|ZP_03254446.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4045]
 gi|208819602|ref|ZP_03259922.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4042]
 gi|209397990|ref|YP_002268765.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4115]
 gi|209917348|ref|YP_002291432.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli SE11]
 gi|215485319|ref|YP_002327750.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           O127:H6 str. E2348/69]
 gi|217325277|ref|ZP_03441361.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. TW14588]
 gi|218547612|ref|YP_002381403.1| iron-sulfur cluster insertion protein ErpA [Escherichia fergusonii
           ATCC 35469]
 gi|218552737|ref|YP_002385650.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli IAI1]
 gi|218557099|ref|YP_002390012.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli S88]
 gi|218688033|ref|YP_002396245.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli ED1a]
 gi|218693622|ref|YP_002401289.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli 55989]
 gi|218698577|ref|YP_002406206.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli IAI39]
 gi|218703412|ref|YP_002410931.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           UMN026]
 gi|227884929|ref|ZP_04002734.1| HesB family protein [Escherichia coli 83972]
 gi|237704317|ref|ZP_04534798.1| iron-sulfur cluster insertion protein ErpA [Escherichia sp.
           3_2_53FAA]
 gi|238899555|ref|YP_002925351.1| hypothetical protein BWG_0149 [Escherichia coli BW2952]
 gi|253774816|ref|YP_003037647.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254037576|ref|ZP_04871653.1| iron-sulfur cluster insertion protein ErpA [Escherichia sp. 1_1_43]
 gi|254160276|ref|YP_003043384.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli B str.
           REL606]
 gi|254791291|ref|YP_003076128.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           O157:H7 str. TW14359]
 gi|256021590|ref|ZP_05435455.1| iron-sulfur cluster insertion protein ErpA [Shigella sp. D9]
 gi|256025469|ref|ZP_05439334.1| iron-sulfur cluster insertion protein ErpA [Escherichia sp.
           4_1_40B]
 gi|260842390|ref|YP_003220168.1| hypothetical protein ECO103_0156 [Escherichia coli O103:H2 str.
           12009]
 gi|260853367|ref|YP_003227258.1| hypothetical protein ECO26_0159 [Escherichia coli O26:H11 str.
           11368]
 gi|260866306|ref|YP_003232708.1| hypothetical protein ECO111_0158 [Escherichia coli O111:H- str.
           11128]
 gi|261226912|ref|ZP_05941193.1| hypothetical protein EscherichiacoliO157_20317 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261255316|ref|ZP_05947849.1| hypothetical protein EscherichiacoliO157EcO_05744 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291280980|ref|YP_003497798.1| Iron-sulfur cluster insertion protein erpA [Escherichia coli O55:H7
           str. CB9615]
 gi|293403227|ref|ZP_06647324.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           FVEC1412]
 gi|293408250|ref|ZP_06652090.1| iron-sulfur cluster insertion protein erpA [Escherichia coli B354]
 gi|293418044|ref|ZP_06660666.1| iron-sulfur cluster insertion protein erpA [Escherichia coli B185]
 gi|293476815|ref|ZP_06665223.1| hypothetical protein ECCG_03138 [Escherichia coli B088]
 gi|297518786|ref|ZP_06937172.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli OP50]
 gi|298378761|ref|ZP_06988645.1| iron-sulfur cluster insertion protein erpA [Escherichia coli
           FVEC1302]
 gi|300816197|ref|ZP_07096420.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           107-1]
 gi|300824121|ref|ZP_07104241.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           119-7]
 gi|300900806|ref|ZP_07118949.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           198-1]
 gi|300901976|ref|ZP_07120003.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           84-1]
 gi|300919720|ref|ZP_07136206.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           115-1]
 gi|300923051|ref|ZP_07139118.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           182-1]
 gi|300932110|ref|ZP_07147396.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           187-1]
 gi|300938563|ref|ZP_07153297.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           21-1]
 gi|300949812|ref|ZP_07163785.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           116-1]
 gi|300956039|ref|ZP_07168365.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           175-1]
 gi|300984836|ref|ZP_07177125.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           200-1]
 gi|300993621|ref|ZP_07180477.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           45-1]
 gi|301025963|ref|ZP_07189447.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           69-1]
 gi|301028646|ref|ZP_07191869.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           196-1]
 gi|301049931|ref|ZP_07196854.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           185-1]
 gi|301330045|ref|ZP_07222729.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           78-1]
 gi|301646478|ref|ZP_07246355.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           146-1]
 gi|306815242|ref|ZP_07449391.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli NC101]
 gi|307136757|ref|ZP_07496113.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli H736]
 gi|307311395|ref|ZP_07591037.1| iron-sulfur cluster assembly accessory protein [Escherichia coli W]
 gi|309787175|ref|ZP_07681787.1| iron-sulfur cluster insertion protein erpA [Shigella dysenteriae
           1617]
 gi|309796333|ref|ZP_07690742.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           145-7]
 gi|312966293|ref|ZP_07780519.1| iron-sulfur cluster insertion protein erpA [Escherichia coli
           2362-75]
 gi|312970255|ref|ZP_07784437.1| iron-sulfur cluster insertion protein erpA [Escherichia coli
           1827-70]
 gi|331640611|ref|ZP_08341759.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli H736]
 gi|331645300|ref|ZP_08346411.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli M605]
 gi|331651062|ref|ZP_08352090.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli M718]
 gi|331661229|ref|ZP_08362161.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli TA206]
 gi|331661531|ref|ZP_08362455.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli TA143]
 gi|331666399|ref|ZP_08367280.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli TA271]
 gi|331671666|ref|ZP_08372464.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli TA280]
 gi|331680737|ref|ZP_08381396.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli H591]
 gi|331681542|ref|ZP_08382179.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli H299]
 gi|332282832|ref|ZP_08395245.1| iron-sulfur cluster insertion protein ErpA [Shigella sp. D9]
 gi|81175111|sp|P0ACC5|ERPA_ECO57 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|81175112|sp|P0ACC4|ERPA_ECOL6 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|81175113|sp|P0ACC3|ERPA_ECOLI RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|81175114|sp|P0ACC6|ERPA_SHIFL RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|123048466|sp|Q0T850|ERPA_SHIF8 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|123049494|sp|Q0TLH5|ERPA_ECOL5 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|123560544|sp|Q325Y3|ERPA_SHIBS RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|123563485|sp|Q32JV2|ERPA_SHIDS RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|123618035|sp|Q3Z5K1|ERPA_SHISS RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160380680|sp|A1A7K2|ERPA_ECOK1 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160380684|sp|Q1RG32|ERPA_ECOUT RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|226694535|sp|A7ZHP8|ERPA_ECO24 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694536|sp|B7MBD9|ERPA_ECO45 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694537|sp|B5Z0D6|ERPA_ECO5E RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694538|sp|B7NIB9|ERPA_ECO7I RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694539|sp|B7M197|ERPA_ECO8A RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694540|sp|B1XD26|ERPA_ECODH RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694541|sp|A7ZWA4|ERPA_ECOHS RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694542|sp|B1IQI4|ERPA_ECOLC RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694543|sp|B7N825|ERPA_ECOLU RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694544|sp|B6HZD2|ERPA_ECOSE RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694545|sp|B1LGV9|ERPA_ECOSM RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694548|sp|B7LWB7|ERPA_ESCF3 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694572|sp|B2U301|ERPA_SHIB3 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|254783673|sp|B7UIK3|ERPA_ECO27 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|254783674|sp|B7LGL8|ERPA_ECO55 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|254783675|sp|B7MP18|ERPA_ECO81 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|259646275|sp|C4ZRP9|ERPA_ECOBW RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|12512880|gb|AAG54460.1|AE005192_2 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|1552734|gb|AAB08586.1| hypothetical protein [Escherichia coli]
 gi|1786351|gb|AAC73267.1| iron-sulfur cluster insertion protein [Escherichia coli str. K-12
           substr. MG1655]
 gi|13359616|dbj|BAB33583.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|21239012|dbj|BAB96733.1| conserved hypothetical protein [Escherichia coli str. K12 substr.
           W3110]
 gi|30039958|gb|AAP15692.1| hypothetical protein S0151 [Shigella flexneri 2a str. 2457T]
 gi|56383167|gb|AAN41811.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|73854254|gb|AAZ86961.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81239695|gb|ABB60405.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|81244167|gb|ABB64875.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|110341969|gb|ABG68206.1| HesB family protein [Escherichia coli 536]
 gi|110613759|gb|ABF02426.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|115511567|gb|ABI99641.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|157065303|gb|ABV04558.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli HS]
 gi|157078305|gb|ABV18013.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli E24377A]
 gi|169756418|gb|ACA79117.1| iron-sulfur cluster assembly accessory protein [Escherichia coli
           ATCC 8739]
 gi|169887628|gb|ACB01335.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gi|170519898|gb|ACB18076.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli SMS-3-5]
 gi|187430119|gb|ACD09393.1| iron-sulfur cluster assembly accessory protein YadR [Shigella
           boydii CDC 3083-94]
 gi|187767685|gb|EDU31529.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4196]
 gi|188014576|gb|EDU52698.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4113]
 gi|188489219|gb|EDU64322.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli 53638]
 gi|189000438|gb|EDU69424.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4076]
 gi|189357046|gb|EDU75465.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4401]
 gi|189360731|gb|EDU79150.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4486]
 gi|189365643|gb|EDU84059.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4501]
 gi|189371105|gb|EDU89521.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC869]
 gi|189375678|gb|EDU94094.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC508]
 gi|190903574|gb|EDV63291.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli B7A]
 gi|190906927|gb|EDV66529.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli F11]
 gi|192931119|gb|EDV83722.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli E22]
 gi|192959007|gb|EDV89443.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli E110019]
 gi|194413625|gb|EDX29905.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli B171]
 gi|194418313|gb|EDX34403.1| iron-sulfur cluster assembly accessory protein YadR [Shigella
           dysenteriae 1012]
 gi|194421913|gb|EDX37918.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli 101-1]
 gi|208725502|gb|EDZ75103.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4206]
 gi|208734394|gb|EDZ83081.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4045]
 gi|208739725|gb|EDZ87407.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4042]
 gi|209159390|gb|ACI36823.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. EC4115]
 gi|209745964|gb|ACI71289.1| hypothetical protein ECs0160 [Escherichia coli]
 gi|209745966|gb|ACI71290.1| hypothetical protein ECs0160 [Escherichia coli]
 gi|209745968|gb|ACI71291.1| hypothetical protein ECs0160 [Escherichia coli]
 gi|209745970|gb|ACI71292.1| hypothetical protein ECs0160 [Escherichia coli]
 gi|209745972|gb|ACI71293.1| hypothetical protein ECs0160 [Escherichia coli]
 gi|209910607|dbj|BAG75681.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215263391|emb|CAS07711.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
 gi|217321498|gb|EEC29922.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli O157:H7 str. TW14588]
 gi|218350354|emb|CAU96037.1| putative chaperone involved in Fe-S cluster assembly and
           activation; hesB-like [Escherichia coli 55989]
 gi|218355153|emb|CAQ87760.1| putative chaperone involved in Fe-S cluster assembly and
           activation; hesB-like [Escherichia fergusonii ATCC
           35469]
 gi|218359505|emb|CAQ97043.1| putative chaperone involved in Fe-S cluster assembly and
           activation; hesB-like [Escherichia coli IAI1]
 gi|218363868|emb|CAR01532.1| putative chaperone involved in Fe-S cluster assembly and
           activation; hesB-like [Escherichia coli S88]
 gi|218368563|emb|CAR16300.1| putative chaperone involved in Fe-S cluster assembly and
           activation; hesB-like [Escherichia coli IAI39]
 gi|218425597|emb|CAR06383.1| putative chaperone involved in Fe-S cluster assembly and
           activation; hesB-like [Escherichia coli ED1a]
 gi|218430509|emb|CAR11375.1| putative chaperone involved in Fe-S cluster assembly and
           activation; hesB-like [Escherichia coli UMN026]
 gi|222031988|emb|CAP74727.1| Uncharacterized protein yadR [Escherichia coli LF82]
 gi|226840682|gb|EEH72684.1| iron-sulfur cluster insertion protein ErpA [Escherichia sp. 1_1_43]
 gi|226902229|gb|EEH88488.1| iron-sulfur cluster insertion protein ErpA [Escherichia sp.
           3_2_53FAA]
 gi|227838067|gb|EEJ48533.1| HesB family protein [Escherichia coli 83972]
 gi|238860427|gb|ACR62425.1| conserved protein [Escherichia coli BW2952]
 gi|242375989|emb|CAQ30671.1| essential respiratory protein A [Escherichia coli BL21(DE3)]
 gi|253325860|gb|ACT30462.1| iron-sulfur cluster assembly accessory protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972177|gb|ACT37848.1| hypothetical protein ECB_00155 [Escherichia coli B str. REL606]
 gi|253976386|gb|ACT42056.1| hypothetical protein ECD_00155 [Escherichia coli BL21(DE3)]
 gi|254590691|gb|ACT70052.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
 gi|257752016|dbj|BAI23518.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257757537|dbj|BAI29034.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|257762662|dbj|BAI34157.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|260450639|gb|ACX41061.1| iron-sulfur cluster assembly accessory protein [Escherichia coli
           DH1]
 gi|281177383|dbj|BAI53713.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|281599513|gb|ADA72497.1| Iron-binding protein erpA [Shigella flexneri 2002017]
 gi|284919933|emb|CBG32988.1| conserved hypothetical protein [Escherichia coli 042]
 gi|290760853|gb|ADD54814.1| Iron-sulfur cluster insertion protein erpA [Escherichia coli O55:H7
           str. CB9615]
 gi|291321268|gb|EFE60710.1| hypothetical protein ECCG_03138 [Escherichia coli B088]
 gi|291430142|gb|EFF03156.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           FVEC1412]
 gi|291430762|gb|EFF03760.1| iron-sulfur cluster insertion protein erpA [Escherichia coli B185]
 gi|291472501|gb|EFF14983.1| iron-sulfur cluster insertion protein erpA [Escherichia coli B354]
 gi|294493003|gb|ADE91759.1| iron-sulfur cluster assembly accessory protein YadR [Escherichia
           coli IHE3034]
 gi|298281095|gb|EFI22596.1| iron-sulfur cluster insertion protein erpA [Escherichia coli
           FVEC1302]
 gi|299878315|gb|EFI86526.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           196-1]
 gi|300298333|gb|EFJ54718.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           185-1]
 gi|300306597|gb|EFJ61117.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           200-1]
 gi|300317103|gb|EFJ66887.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           175-1]
 gi|300355724|gb|EFJ71594.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           198-1]
 gi|300395762|gb|EFJ79300.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           69-1]
 gi|300405862|gb|EFJ89400.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           84-1]
 gi|300406544|gb|EFJ90082.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           45-1]
 gi|300413220|gb|EFJ96530.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           115-1]
 gi|300420678|gb|EFK03989.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           182-1]
 gi|300450810|gb|EFK14430.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           116-1]
 gi|300456476|gb|EFK19969.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           21-1]
 gi|300460121|gb|EFK23614.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           187-1]
 gi|300523398|gb|EFK44467.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           119-7]
 gi|300531404|gb|EFK52466.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           107-1]
 gi|300843956|gb|EFK71716.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           78-1]
 gi|301075304|gb|EFK90110.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           146-1]
 gi|305850904|gb|EFM51359.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli NC101]
 gi|306908374|gb|EFN38872.1| iron-sulfur cluster assembly accessory protein [Escherichia coli W]
 gi|307552008|gb|ADN44783.1| HesB family protein [Escherichia coli ABU 83972]
 gi|307629734|gb|ADN74038.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli UM146]
 gi|308120037|gb|EFO57299.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           145-7]
 gi|308924753|gb|EFP70248.1| iron-sulfur cluster insertion protein erpA [Shigella dysenteriae
           1617]
 gi|309700365|emb|CBI99653.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|310337753|gb|EFQ02864.1| iron-sulfur cluster insertion protein erpA [Escherichia coli
           1827-70]
 gi|312289536|gb|EFR17430.1| iron-sulfur cluster insertion protein erpA [Escherichia coli
           2362-75]
 gi|312944766|gb|ADR25593.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli O83:H1
           str. NRG 857C]
 gi|313646785|gb|EFS11244.1| iron-sulfur cluster insertion protein erpA [Shigella flexneri 2a
           str. 2457T]
 gi|315059376|gb|ADT73703.1| iron-sulfur cluster assembly accessory protein [Escherichia coli W]
 gi|315134847|dbj|BAJ42006.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli DH1]
 gi|315254959|gb|EFU34927.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           85-1]
 gi|315285246|gb|EFU44691.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           110-3]
 gi|315294601|gb|EFU53948.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           153-1]
 gi|315300696|gb|EFU59923.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           16-3]
 gi|315616360|gb|EFU96978.1| iron-sulfur cluster insertion protein erpA [Escherichia coli 3431]
 gi|320177499|gb|EFW52495.1| putative iron binding protein from the HesB_IscA_SufA family
           [Shigella dysenteriae CDC 74-1112]
 gi|320179896|gb|EFW54840.1| putative iron binding protein from the HesB_IscA_SufA family
           [Shigella boydii ATCC 9905]
 gi|320186576|gb|EFW61301.1| putative iron binding protein from the HesB_IscA_SufA family
           [Shigella flexneri CDC 796-83]
 gi|320190318|gb|EFW64968.1| putative iron binding protein from the HesB_IscA_SufA family
           [Escherichia coli O157:H7 str. EC1212]
 gi|320197389|gb|EFW72003.1| putative iron binding protein from the HesB_IscA_SufA family
           [Escherichia coli WV_060327]
 gi|320200319|gb|EFW74905.1| putative iron binding protein from the HesB_IscA_SufA family
           [Escherichia coli EC4100B]
 gi|320639964|gb|EFX09549.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           O157:H7 str. G5101]
 gi|320644734|gb|EFX13778.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           O157:H- str. 493-89]
 gi|320652890|gb|EFX21128.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           O157:H- str. H 2687]
 gi|320658278|gb|EFX26007.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320663588|gb|EFX30872.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320668901|gb|EFX35696.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323157768|gb|EFZ43871.1| iron-sulfur cluster insertion protein erpA [Escherichia coli
           EPECa14]
 gi|323160225|gb|EFZ46184.1| iron-sulfur cluster insertion protein erpA [Escherichia coli
           E128010]
 gi|323165853|gb|EFZ51635.1| iron-sulfur cluster insertion protein erpA [Shigella sonnei 53G]
 gi|323170947|gb|EFZ56596.1| iron-sulfur cluster insertion protein erpA [Escherichia coli LT-68]
 gi|323176469|gb|EFZ62061.1| iron-sulfur cluster insertion protein erpA [Escherichia coli 1180]
 gi|323181663|gb|EFZ67077.1| iron-sulfur cluster insertion protein erpA [Escherichia coli 1357]
 gi|323190443|gb|EFZ75718.1| iron-sulfur cluster insertion protein erpA [Escherichia coli
           RN587/1]
 gi|323380065|gb|ADX52333.1| iron-sulfur cluster assembly accessory protein [Escherichia coli
           KO11]
 gi|323934997|gb|EGB31370.1| iron-sulfur cluster assembly accessory protein [Escherichia coli
           E1520]
 gi|323939968|gb|EGB36166.1| iron-sulfur cluster assembly accessory protein [Escherichia coli
           E482]
 gi|323945632|gb|EGB41681.1| iron-sulfur cluster assembly accessory protein [Escherichia coli
           H120]
 gi|323950843|gb|EGB46720.1| iron-sulfur cluster assembly accessory protein [Escherichia coli
           H252]
 gi|323955119|gb|EGB50894.1| iron-sulfur cluster assembly accessory protein [Escherichia coli
           H263]
 gi|323959917|gb|EGB55564.1| iron-sulfur cluster assembly accessory protein [Escherichia coli
           H489]
 gi|323964951|gb|EGB60417.1| iron-sulfur cluster assembly accessory protein [Escherichia coli
           M863]
 gi|323970636|gb|EGB65892.1| iron-sulfur cluster assembly accessory protein [Escherichia coli
           TA007]
 gi|323975676|gb|EGB70772.1| iron-sulfur cluster assembly accessory protein [Escherichia coli
           TW10509]
 gi|324008252|gb|EGB77471.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           57-2]
 gi|324012185|gb|EGB81404.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           60-1]
 gi|324017836|gb|EGB87055.1| iron-sulfur cluster assembly accessory protein [Escherichia coli MS
           117-3]
 gi|324112432|gb|EGC06409.1| iron-sulfur cluster assembly accessory protein [Escherichia
           fergusonii B253]
 gi|324118277|gb|EGC12172.1| iron-sulfur cluster assembly accessory protein [Escherichia coli
           E1167]
 gi|326339788|gb|EGD63596.1| putative iron binding protein from the HesB_IscA_SufA family
           [Escherichia coli O157:H7 str. 1044]
 gi|326345123|gb|EGD68866.1| putative iron binding protein from the HesB_IscA_SufA family
           [Escherichia coli O157:H7 str. 1125]
 gi|327255135|gb|EGE66738.1| iron-sulfur cluster insertion protein erpA [Escherichia coli
           STEC_7v]
 gi|330910008|gb|EGH38518.1| putative iron binding protein from the HesB_IscA_SufA family
           [Escherichia coli AA86]
 gi|331040357|gb|EGI12564.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli H736]
 gi|331046057|gb|EGI18176.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli M605]
 gi|331051516|gb|EGI23565.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli M718]
 gi|331052271|gb|EGI24310.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli TA206]
 gi|331061446|gb|EGI33409.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli TA143]
 gi|331066610|gb|EGI38487.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli TA271]
 gi|331071511|gb|EGI42868.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli TA280]
 gi|331072200|gb|EGI43536.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli H591]
 gi|331081763|gb|EGI52924.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli H299]
 gi|332095192|gb|EGJ00221.1| iron-sulfur cluster insertion protein erpA [Shigella boydii
           5216-82]
 gi|332097826|gb|EGJ02799.1| iron-sulfur cluster insertion protein erpA [Shigella dysenteriae
           155-74]
 gi|332098760|gb|EGJ03720.1| iron-sulfur cluster insertion protein erpA [Shigella boydii
           3594-74]
 gi|332105184|gb|EGJ08530.1| iron-sulfur cluster insertion protein ErpA [Shigella sp. D9]
 gi|332341489|gb|AEE54823.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           UMNK88]
 gi|332762028|gb|EGJ92299.1| iron-sulfur cluster insertion protein erpA [Shigella flexneri
           2747-71]
 gi|332762157|gb|EGJ92426.1| iron-sulfur cluster insertion protein erpA [Shigella flexneri
           4343-70]
 gi|332765002|gb|EGJ95230.1| iron-sulfur cluster insertion protein erpA [Shigella flexneri
           K-671]
 gi|332768658|gb|EGJ98838.1| essential respiratory protein A [Shigella flexneri 2930-71]
 gi|333009106|gb|EGK28562.1| iron-sulfur cluster insertion protein erpA [Shigella flexneri
           K-218]
 gi|333010649|gb|EGK30082.1| iron-sulfur cluster insertion protein erpA [Shigella flexneri VA-6]
 gi|333010993|gb|EGK30412.1| iron-sulfur cluster insertion protein erpA [Shigella flexneri
           K-272]
 gi|333021788|gb|EGK41037.1| iron-sulfur cluster insertion protein erpA [Shigella flexneri
           K-227]
 gi|333022217|gb|EGK41456.1| iron-sulfur cluster insertion protein erpA [Shigella flexneri
           K-304]
          Length = 114

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ +       +R+ +  GGC+G +Y              +  K GV
Sbjct: 9   LEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIE-KQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  S CGCG S  I
Sbjct: 68  GLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI 114


>gi|319942821|ref|ZP_08017122.1| iron-sulfur cluster assembly protein IscA [Sutterella
           wadsworthensis 3_1_45B]
 gi|319803588|gb|EFW00549.1| iron-sulfur cluster assembly protein IscA [Sutterella
           wadsworthensis 3_1_45B]
          Length = 107

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 46/111 (41%), Positives = 66/111 (59%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  VT+TEAA   +++ +   +GK  G+R+ +K  GC+G+ Y ++       D      
Sbjct: 1   MS--VTLTEAAAKHVQKYLA-RRGKGVGLRLGVKTSGCSGMAYKLEFADQVEPDDKVWES 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GVKV +D  SL Y+ GTE+D+  E L  GF FHNPN+ S CGCG+S +I
Sbjct: 58  F-GVKVLVDEKSLPYLDGTELDYTREGLQEGFKFHNPNEKSRCGCGESFQI 107


>gi|239947328|ref|ZP_04699081.1| HesB protein [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921604|gb|EER21628.1| HesB protein [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 110

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 69/111 (62%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T++A  ++K ++        GIR+ +K GGCAG  Y V+         D+++E
Sbjct: 1   MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGVKSGGCAGQTYYVEYADSK-NQFDEIVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+E+D+   K  S F F NPN+ + CGCG+S  +
Sbjct: 60  EKGVRILIDPKALMYILGSEMDYVETKFKSQFTFTNPNEKANCGCGKSFSV 110


>gi|121604473|ref|YP_981802.1| iron-sulfur cluster insertion protein ErpA [Polaromonas
           naphthalenivorans CJ2]
 gi|160380661|sp|A1VMK3|ERPA2_POLNA RecName: Full=Putative iron-sulfur cluster insertion protein erpA 2
 gi|120593442|gb|ABM36881.1| iron-sulfur cluster assembly accessory protein [Polaromonas
           naphthalenivorans CJ2]
          Length = 125

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 54/111 (48%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  T +A  ++ E++         +R+ +  GGC+G  Y          D   ++ 
Sbjct: 16  MPGQLEFTTSAAAKVSELIVEEGNPNLKLRLYVTGGGCSGFSYGFAFDDQTAEDDTLIVT 75

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +GV + +D+ SL Y+LG  +DF+     S FV HNPN  S CGCG S  +
Sbjct: 76  -EGVALVVDAMSLQYVLGARVDFEDGLEGSRFVIHNPNAQSTCGCGSSFSV 125


>gi|83644263|ref|YP_432698.1| hypothetical protein HCH_01411 [Hahella chejuensis KCTC 2396]
 gi|83632306|gb|ABC28273.1| uncharacterized conserved protein [Hahella chejuensis KCTC 2396]
          Length = 121

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 64/109 (58%), Gaps = 1/109 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AA   I++ +      AQG R+ LK  GC+G +Y+VDLV     D    +  D +
Sbjct: 12  LRITDAAAEHIRKQLRQH-PDAQGFRLGLKASGCSGFKYIVDLVKTPSDDDRKFVLADDI 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
            V++D+ SL Y+ G EIDF  E L   F F+NPN  S+CGCG+S  IK 
Sbjct: 71  PVYVDAKSLPYINGAEIDFVKEGLNYAFKFNNPNVDSSCGCGESFSIKE 119


>gi|330831281|ref|YP_004394233.1| iron-sulfur cluster insertion protein erpA [Aeromonas veronii B565]
 gi|328806417|gb|AEB51616.1| Iron-sulfur cluster insertion protein erpA [Aeromonas veronii B565]
          Length = 116

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + MT+AA  ++K ++   +     +R+ +  GGC+G +Y      +   DGD ++EK+GV
Sbjct: 11  IQMTDAAANKVKNLITEEENPELKLRVYITGGGCSGFQYGFTFD-EKINDGDTVVEKNGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + ID  SL Y++G  +D+      S F   NPN  + CGCG S  I
Sbjct: 70  TMVIDPMSLQYLVGGSVDYTEGLEGSRFTVTNPNATTTCGCGSSFSI 116


>gi|171058047|ref|YP_001790396.1| iron-sulfur cluster assembly accessory protein [Leptothrix
           cholodnii SP-6]
 gi|170775492|gb|ACB33631.1| iron-sulfur cluster assembly accessory protein [Leptothrix
           cholodnii SP-6]
          Length = 107

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T  A  +I++ + + +G   G+R+++K  GC+G  Y ++         D   E +GV
Sbjct: 3   VTVTPKAARQIRKAL-DQRGSGYGLRVAVKTSGCSGYAYALEFADAP-APEDLSFESEGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D+ SL  + GT++D+  + L  GF F+NPN  + CGCG+S  +
Sbjct: 61  FVLVDAKSLPMVDGTQLDWVRDGLNEGFQFNNPNASATCGCGESFTV 107


>gi|24372882|ref|NP_716924.1| iron-sulfur cluster insertion protein ErpA [Shewanella oneidensis
           MR-1]
 gi|24346999|gb|AAN54369.1|AE015574_5 HesB/YadR/YfhF family protein [Shewanella oneidensis MR-1]
          Length = 108

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++   Q  A  +R+ +  GGC+G +Y              +  K GV
Sbjct: 3   IKFTDAAAAKVKGLLEEEQNPALKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTVE-KQGV 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G E+D+ +    S F   NPN  + CGCG S  +
Sbjct: 62  QLVVDPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV 108


>gi|254490373|ref|ZP_05103562.1| HesB-like domain, putative [Methylophaga thiooxidans DMS010]
 gi|224464506|gb|EEF80766.1| HesB-like domain, putative [Methylophaga thiooxydans DMS010]
          Length = 110

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 54/110 (49%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   V  TEAA  ++ +++      A  +R+ +  GGC+G +Y      +      ++  
Sbjct: 1   MPSPVIFTEAAATKVSDLIAEEGNDALKLRVFITGGGCSGFQYGFTFEEEVGEGDTEVE- 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K GV + ID AS  Y++G EIDF      S FV  NPN  + CGCG S  
Sbjct: 60  KGGVTLLIDPASYQYLVGAEIDFTDGVEGSQFVIRNPNATTTCGCGSSFS 109


>gi|85711803|ref|ZP_01042859.1| HesB/IscA family protein [Idiomarina baltica OS145]
 gi|85694418|gb|EAQ32360.1| HesB/IscA family protein [Idiomarina baltica OS145]
          Length = 114

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  +E A  ++K+++   +     +R+ +  GGC+G +Y      +    GD  I+KDGV
Sbjct: 9   IEFSEHAAAQVKKLISEEENPNLKLRVYVTGGGCSGFQYGFTFE-EQINAGDMQIDKDGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D++     S F  +NPN  + CGCG S  I
Sbjct: 68  TLVVDPMSLQYLVGGVVDYEEGLQGSRFFVNNPNATTTCGCGSSFSI 114


>gi|302383285|ref|YP_003819108.1| iron-sulfur cluster assembly accessory protein [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193913|gb|ADL01485.1| iron-sulfur cluster assembly accessory protein [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 132

 Score =  129 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 49/114 (42%), Positives = 74/114 (64%), Gaps = 1/114 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             +VT+TEAA  R++EI+ N++     +R+ +K GGCAG EY      +     D+++E 
Sbjct: 15  PKVVTLTEAAAERVREIMANAEKAYVALRVGVKNGGCAGQEYTFAYA-EEIGPMDEVVED 73

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            GV + ID  ++L+++G+E+D++T KL S FVF NPNQ  ACGCG+SV I  A 
Sbjct: 74  KGVTILIDPKAILFLIGSEVDYETSKLSSKFVFRNPNQTDACGCGESVTIIPAK 127


>gi|212636588|ref|YP_002313113.1| iron-sulfur cluster insertion protein ErpA [Shewanella
           piezotolerans WP3]
 gi|226694571|sp|B8CQR0|ERPA_SHEPW RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|212558072|gb|ACJ30526.1| HesB/YadR/YfhF [Shewanella piezotolerans WP3]
          Length = 116

 Score =  129 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++ T+AA  ++K ++   +  A  +R+ +  GGC+G +Y              +  K GV
Sbjct: 11  ISFTDAAALKVKTLLDEEENDALKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTVE-KQGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G E+D+ +    S F   NPN  + CGCG S  +
Sbjct: 70  QLVVDPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV 116


>gi|39546289|ref|NP_459209.2| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|161504678|ref|YP_001571790.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161612572|ref|YP_001586537.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167550591|ref|ZP_02344348.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|167990088|ref|ZP_02571188.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|168230510|ref|ZP_02655568.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|168234980|ref|ZP_02660038.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|168245067|ref|ZP_02669999.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|168263931|ref|ZP_02685904.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|168464235|ref|ZP_02698138.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|194442784|ref|YP_002039444.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194447775|ref|YP_002044194.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194472760|ref|ZP_03078744.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194738261|ref|YP_002113226.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197248019|ref|YP_002145208.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197265134|ref|ZP_03165208.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|198242974|ref|YP_002214164.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|200389283|ref|ZP_03215895.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204926749|ref|ZP_03217951.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205351541|ref|YP_002225342.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|207855720|ref|YP_002242371.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|213027304|ref|ZP_03341751.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
 gi|213051743|ref|ZP_03344621.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213425930|ref|ZP_03358680.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213583697|ref|ZP_03365523.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213647540|ref|ZP_03377593.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|213854734|ref|ZP_03382974.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|238911270|ref|ZP_04655107.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|160387088|sp|Q57T51|ERPA_SALCH RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160387103|sp|Q5PD49|ERPA_SALPA RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160387114|sp|Q8XFF3|ERPA_SALTI RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160387123|sp|Q7CR66|ERPA_SALTY RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|226694556|sp|B5F8R7|ERPA_SALA4 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694557|sp|A9MPK5|ERPA_SALAR RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694558|sp|B5FJ03|ERPA_SALDC RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694563|sp|B5R3G8|ERPA_SALEP RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694564|sp|B5RHE2|ERPA_SALG2 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694566|sp|B4TK32|ERPA_SALHS RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694567|sp|B4SUY6|ERPA_SALNS RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694568|sp|A9N0Q2|ERPA_SALPB RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694569|sp|B4TXQ8|ERPA_SALSV RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|160866025|gb|ABX22648.1| hypothetical protein SARI_02800 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161361936|gb|ABX65704.1| hypothetical protein SPAB_00262 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194401447|gb|ACF61669.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194406079|gb|ACF66298.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194459124|gb|EDX47963.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194713763|gb|ACF92984.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|195632907|gb|EDX51361.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197211722|gb|ACH49119.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197243389|gb|EDY26009.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197291921|gb|EDY31271.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|197937490|gb|ACH74823.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|199606381|gb|EDZ04926.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204323414|gb|EDZ08609.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205271322|emb|CAR36115.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205324384|gb|EDZ12223.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205331333|gb|EDZ18097.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205335039|gb|EDZ21803.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205336164|gb|EDZ22928.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|205347416|gb|EDZ34047.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|206707523|emb|CAR31797.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|267991894|gb|ACY86779.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301156831|emb|CBW16307.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911174|dbj|BAJ35148.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|320084458|emb|CBY94251.1| putative iron-sulfur cluster insertion protein erpA [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
 gi|321222213|gb|EFX47285.1| putative iron binding protein from the HesB_IscA_SufA family
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322616026|gb|EFY12943.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322620810|gb|EFY17670.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322623839|gb|EFY20676.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322627287|gb|EFY24078.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322630594|gb|EFY27358.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322638187|gb|EFY34888.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322640673|gb|EFY37324.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322645543|gb|EFY42070.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322648163|gb|EFY44630.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322657114|gb|EFY53397.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322657485|gb|EFY53757.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322663804|gb|EFY60004.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322666637|gb|EFY62815.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322672205|gb|EFY68317.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322676484|gb|EFY72555.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322679424|gb|EFY75469.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322686248|gb|EFY82232.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|323193429|gb|EFZ78637.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323197549|gb|EFZ82684.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323201181|gb|EFZ86250.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323209577|gb|EFZ94510.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323212172|gb|EFZ96996.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323216476|gb|EGA01202.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323220879|gb|EGA05316.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323225895|gb|EGA10115.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323228564|gb|EGA12693.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323236823|gb|EGA20899.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323239677|gb|EGA23724.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323242276|gb|EGA26305.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323249938|gb|EGA33834.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323252367|gb|EGA36218.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323255651|gb|EGA39404.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323262912|gb|EGA46462.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323265398|gb|EGA48894.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323271815|gb|EGA55233.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
          Length = 114

 Score =  129 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ +       +R+ +  GGC+G +Y              +  K GV
Sbjct: 9   LQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIE-KQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  S CGCG S  I
Sbjct: 68  GLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI 114


>gi|90020483|ref|YP_526310.1| hypothetical protein Sde_0836 [Saccharophagus degradans 2-40]
 gi|123396529|sp|Q21MI1|ERPA_SACD2 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|89950083|gb|ABD80098.1| HesB/YadR/YfhF [Saccharophagus degradans 2-40]
          Length = 117

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 59/110 (53%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            + V +TE A+ ++K ++         +R+ +  GGC+G +Y      +   + D  IE+
Sbjct: 9   PEPVQVTENALAKVKALIEEEGNPDLKLRVFVTGGGCSGFQYGFAFD-EACAEDDAKIER 67

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGV V +D+ S  Y++G ++D++     S FV  NPN  + CGCG S  I
Sbjct: 68  DGVTVVVDAMSYPYLVGAQVDYEEGLKGSKFVVANPNASTTCGCGSSFSI 117


>gi|332288114|ref|YP_004418966.1| iron-sulfur cluster insertion protein ErpA [Gallibacterium anatis
           UMN179]
 gi|330431010|gb|AEC16069.1| iron-sulfur cluster insertion protein ErpA [Gallibacterium anatis
           UMN179]
          Length = 114

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T T+AA  ++K ++         +R+ +  GGC+G +Y      +       +    GV
Sbjct: 9   LTFTDAAARKVKFLIEGEDNPNLKLRVYITGGGCSGFQYGFTFDENVNEGDLTIEN-SGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  + CGCG S  I
Sbjct: 68  TLVVDPMSLQYLIGGTVDYTEGLEGSRFVVDNPNATTTCGCGSSFSI 114


>gi|134291401|ref|YP_001115170.1| iron-sulfur cluster assembly accessory protein [Burkholderia
           vietnamiensis G4]
 gi|134134590|gb|ABO58915.1| FeS assembly scaffold SufA [Burkholderia vietnamiensis G4]
          Length = 107

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 59/107 (55%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T AA   I++ +   +G   G+R+++K  GC+G  Y ++ V     D        GV
Sbjct: 3   ISVTPAAARHIEKAL-QKRGAGLGLRVAVKTSGCSGFAYALEFVDAPNDDDLCFAT-HGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  SL  + GTE+DF  E L  GF FHNPN  + CGCG+S  +
Sbjct: 61  TVVVDPRSLPMLDGTELDFVREGLNEGFKFHNPNATANCGCGESFAV 107


>gi|297182120|gb|ADI18293.1| uncharacterized conserved protein [uncultured Chromatiales
           bacterium HF0200_41F04]
          Length = 117

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 51/105 (48%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T++A  ++K ++      +  +R+ +  GGC+G +Y              +    GVK+
Sbjct: 14  FTDSAAQKVKTLIEEEGDDSLHLRVFISGGGCSGFQYGFTFDEKEGDGDTIVTN-GGVKL 72

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            ID  S+ Y++G EID+      + FV  NPN  + CGCG S  +
Sbjct: 73  LIDPMSIQYLMGAEIDYSEGLEGAQFVIRNPNAQTTCGCGSSFSV 117


>gi|317046970|ref|YP_004114618.1| iron-sulfur cluster assembly accessory protein [Pantoea sp. At-9b]
 gi|316948587|gb|ADU68062.1| iron-sulfur cluster assembly accessory protein [Pantoea sp. At-9b]
          Length = 115

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ + +     +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 10  LQFTDAAAKKVKNLIADEENPELKLRVYITGGGCSGFQYGFTFD-DQMNDGDMTIEKQGV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  + CGCG S  I
Sbjct: 69  ALVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSI 115


>gi|262195420|ref|YP_003266629.1| iron-sulfur cluster assembly accessory protein [Haliangium
           ochraceum DSM 14365]
 gi|262078767|gb|ACY14736.1| iron-sulfur cluster assembly accessory protein [Haliangium
           ochraceum DSM 14365]
          Length = 111

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 45/111 (40%), Positives = 62/111 (55%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS+ +T+TE A   IK        +   IRI ++ GGC G  Y+ D V   P D D +  
Sbjct: 1   MSETITITETAASEIKRQQSKRGAEQAAIRIGIRGGGCTGFAYLFDWVDGAPKDTDKVFS 60

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GV V++D  S  Y+ GTE+DF+T  +  GF F+NPN    CGCG+SV+ 
Sbjct: 61  AHGVSVYVDPKSFNYLKGTELDFETSIMGHGFKFNNPNAKGTCGCGESVQF 111


>gi|127511950|ref|YP_001093147.1| iron-sulfur cluster insertion protein ErpA [Shewanella loihica
           PV-4]
 gi|160385732|sp|A3QBP0|ERPA_SHELP RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|126637245|gb|ABO22888.1| iron-sulfur cluster assembly accessory protein [Shewanella loihica
           PV-4]
          Length = 116

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++   Q  A  +R+ +  GGC+G +Y              +  K GV
Sbjct: 11  IRFTDAAAAKVKTLLEEEQNDALKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTVE-KQGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G E+D+ +    S F   NPN  + CGCG S  +
Sbjct: 70  QLVVDPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV 116


>gi|295689535|ref|YP_003593228.1| iron-sulfur cluster assembly accessory protein [Caulobacter segnis
           ATCC 21756]
 gi|295431438|gb|ADG10610.1| iron-sulfur cluster assembly accessory protein [Caulobacter segnis
           ATCC 21756]
          Length = 130

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 48/113 (42%), Positives = 75/113 (66%), Gaps = 1/113 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             +VT+T+AA  R+K I+  +     G+R+ +K GGCAG EY+ +   +     D+++E 
Sbjct: 14  PKVVTLTDAAAARVKAIMDKADKPYVGLRVGVKNGGCAGQEYVFEYA-ETKGPIDEVVED 72

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            GV + I+  ++L+++GTEID++  KL S FVFHNPN+  ACGCG+SV I+ A
Sbjct: 73  KGVTILIEPKAVLFLIGTEIDYEVSKLSSKFVFHNPNETDACGCGESVTIQPA 125


>gi|194098844|ref|YP_002001907.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae NCCP11945]
 gi|240013961|ref|ZP_04720874.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae DGI18]
 gi|240016403|ref|ZP_04722943.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae FA6140]
 gi|240080522|ref|ZP_04725065.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae FA19]
 gi|240113110|ref|ZP_04727600.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae MS11]
 gi|240118164|ref|ZP_04732226.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID1]
 gi|240121530|ref|ZP_04734492.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID24-1]
 gi|240125903|ref|ZP_04738789.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae SK-92-679]
 gi|254493907|ref|ZP_05107078.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae 1291]
 gi|260440319|ref|ZP_05794135.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae DGI2]
 gi|268594966|ref|ZP_06129133.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae 35/02]
 gi|268596655|ref|ZP_06130822.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae FA19]
 gi|268599194|ref|ZP_06133361.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae MS11]
 gi|268601541|ref|ZP_06135708.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID18]
 gi|268603879|ref|ZP_06138046.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID1]
 gi|268682343|ref|ZP_06149205.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID332]
 gi|268684500|ref|ZP_06151362.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae SK-92-679]
 gi|291043613|ref|ZP_06569329.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae DGI2]
 gi|293398922|ref|ZP_06643087.1| iron-sulfur cluster assembly protein IscA [Neisseria gonorrhoeae
           F62]
 gi|193934134|gb|ACF29958.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae NCCP11945]
 gi|226512947|gb|EEH62292.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae 1291]
 gi|268548355|gb|EEZ43773.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae 35/02]
 gi|268550443|gb|EEZ45462.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae FA19]
 gi|268583325|gb|EEZ48001.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae MS11]
 gi|268585672|gb|EEZ50348.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID18]
 gi|268588010|gb|EEZ52686.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID1]
 gi|268622627|gb|EEZ55027.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID332]
 gi|268624784|gb|EEZ57184.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae SK-92-679]
 gi|291012076|gb|EFE04065.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae DGI2]
 gi|291610336|gb|EFF39446.1| iron-sulfur cluster assembly protein IscA [Neisseria gonorrhoeae
           F62]
 gi|317164423|gb|ADV07964.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 126

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 64/109 (58%), Gaps = 2/109 (1%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V +   D        
Sbjct: 20  NMITLTENAAKHINDYLAK-RGKGLGVRLGVKTSGCSGMAYNLEFVDEANGDDLIFEG-H 77

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 78  GARIYIDPKSLVYLDGTQVDYTKEDLQEGFKFENPNVKDSCGCGESFHV 126


>gi|258511034|ref|YP_003184468.1| iron-sulfur cluster assembly accessory protein [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257477760|gb|ACV58079.1| iron-sulfur cluster assembly accessory protein [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 117

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 56/106 (52%), Gaps = 2/106 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A  R++ ++ +       +RI  K GGC G  Y +    DN   GD +  + G
Sbjct: 1   MITLTEQAAERVRTLLESQSSGEDALRIYTKPGGCTGFTYGL--ALDNEKPGDVVTVQHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           VK+ +D  SL  + G+EID+  +    GF  +NPN    CGCG S 
Sbjct: 59  VKLVVDPESLELIDGSEIDYVDDLTGQGFKINNPNATQMCGCGSSF 104


>gi|262367083|gb|ACY63640.1| hypothetical protein YPD8_2968 [Yersinia pestis D182038]
          Length = 114

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 39/115 (33%), Positives = 60/115 (52%), Gaps = 5/115 (4%)

Query: 1   MSD----IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGD 56
           MS+     +  TEAA  ++K ++ + +     +R+ +  GGC+G +Y          DGD
Sbjct: 1   MSNETVLPLQFTEAAAKKVKLLISDEENPNLKLRVYITGGGCSGFQYGFTFDYQV-NDGD 59

Query: 57  DLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             IEK GV++ +D  SL Y++G  +D+      S F+  NPN  S CGCG S  I
Sbjct: 60  MTIEKQGVELVVDPMSLQYLVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI 114


>gi|238785045|ref|ZP_04629041.1| Iron-sulfur cluster insertion protein erpA [Yersinia bercovieri
           ATCC 43970]
 gi|238714017|gb|EEQ06033.1| Iron-sulfur cluster insertion protein erpA [Yersinia bercovieri
           ATCC 43970]
          Length = 114

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ + +     +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 9   LQFTEAAAKKVKLLISDEENPNLKLRVYITGGGCSGFQYGFTFD-DQINDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 68  ELVVDPMSLQYLVGGAVDYTEGLEGSRFVVTNPNAKSTCGCGSSFSI 114


>gi|218290548|ref|ZP_03494657.1| iron-sulfur cluster assembly accessory protein [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218239451|gb|EED06647.1| iron-sulfur cluster assembly accessory protein [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 117

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 56/106 (52%), Gaps = 2/106 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A  R++ ++ +       +RI  K GGC G  Y +    DN   GD +  + G
Sbjct: 1   MITLTEQAAERVRTLLESQSSGEDALRIYTKPGGCTGFAYGL--ALDNEKPGDVVTVQHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           VK+ +D  SL  + G+EID+  +    GF  +NPN    CGCG S 
Sbjct: 59  VKLVVDPESLELIDGSEIDYVDDLTGQGFKINNPNATQMCGCGSSF 104


>gi|149196449|ref|ZP_01873504.1| hypothetical protein LNTAR_14867 [Lentisphaera araneosa HTCC2155]
 gi|149140710|gb|EDM29108.1| hypothetical protein LNTAR_14867 [Lentisphaera araneosa HTCC2155]
          Length = 108

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 62/111 (55%), Gaps = 3/111 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M D++ +TE A   + E++     + +G+R+ +K GGC+GL Y +        + D+++ 
Sbjct: 1   MKDLIELTEKAKEHVLELIKKED-EGKGLRLGVKGGGCSGLSYSITFD--GQKERDNILS 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +G +V +D  S +Y+ G  +D+       GF+F NPN  + CGCG+S  I
Sbjct: 58  FEGFEVLLDPKSAVYLKGIVLDYDDSLEGKGFIFVNPNASNTCGCGESFSI 108


>gi|307246375|ref|ZP_07528451.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307255361|ref|ZP_07537171.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307257532|ref|ZP_07539296.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307259811|ref|ZP_07541529.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307261942|ref|ZP_07543600.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306852708|gb|EFM84937.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306861670|gb|EFM93654.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306863968|gb|EFM95887.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306866109|gb|EFM97979.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306868353|gb|EFN00172.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 113

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 34/114 (29%), Positives = 54/114 (47%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSDI   +  T+AA  ++K ++         +R+ +  GGC+G +Y              
Sbjct: 1   MSDIQIPLIFTDAAAKKVKSLIEGEDNPNLRLRVYITGGGCSGFQYGFTFDDQINEGDLT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +  ++ V + +D  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 61  IENQN-VGLVVDPMSLQYLIGGTVDYTEGLDGSRFVVQNPNASSTCGCGSSFSI 113


>gi|120599838|ref|YP_964412.1| iron-sulfur cluster insertion protein ErpA [Shewanella sp. W3-18-1]
 gi|146292226|ref|YP_001182650.1| iron-sulfur cluster insertion protein ErpA [Shewanella putrefaciens
           CN-32]
 gi|160385720|sp|A4Y4G8|ERPA_SHEPC RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160385722|sp|A1RMG3|ERPA_SHESW RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|120559931|gb|ABM25858.1| iron-sulfur cluster assembly accessory protein [Shewanella sp.
           W3-18-1]
 gi|145563916|gb|ABP74851.1| iron-sulfur cluster assembly accessory protein [Shewanella
           putrefaciens CN-32]
 gi|319425526|gb|ADV53600.1| iron-sulfur cluster assembly accessory protein [Shewanella
           putrefaciens 200]
          Length = 116

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++   Q  A  +R+ +  GGC+G +Y              +  K GV
Sbjct: 11  IQFTDAAAAKVKGLLEEEQNPALKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTVE-KQGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G E+D+ +    S F   NPN  + CGCG S  +
Sbjct: 70  QLVVDPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV 116


>gi|153868978|ref|ZP_01998689.1| Iron-sulphur cluster biosynthesis [Beggiatoa sp. PS]
 gi|152074445|gb|EDN71298.1| Iron-sulphur cluster biosynthesis [Beggiatoa sp. PS]
          Length = 121

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 29/109 (26%), Positives = 53/109 (48%), Gaps = 1/109 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              +  T+ A  ++++++         +R+ ++ GGC+G +Y      +       +  +
Sbjct: 13  PSPLLFTDTAALKVQKLIEEENNNDLMLRVFVQGGGCSGFQYGFTFDENIQEGDTVVENQ 72

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            GVK+ +D  S  Y++G EID+      + FV  NPN V+ CGCG S  
Sbjct: 73  -GVKLLVDPMSYQYLVGAEIDYSEGLEGAQFVIRNPNAVTTCGCGSSFS 120


>gi|304396633|ref|ZP_07378514.1| iron-sulfur cluster assembly accessory protein [Pantoea sp. aB]
 gi|308185730|ref|YP_003929861.1| hypothetical protein Pvag_0192 [Pantoea vagans C9-1]
 gi|304356142|gb|EFM20508.1| iron-sulfur cluster assembly accessory protein [Pantoea sp. aB]
 gi|308056240|gb|ADO08412.1| hypothetical protein Pvag_0192 [Pantoea vagans C9-1]
          Length = 115

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ + +  A  +R+ +  GGC+G +Y          DGD  IEK GV
Sbjct: 10  LQFTDAAATKVKNLIADEENPALKLRVYITGGGCSGFQYGFTFDDQL-NDGDMTIEKQGV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  + CGCG S  I
Sbjct: 69  SLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSI 115


>gi|109896872|ref|YP_660127.1| iron-sulfur cluster assembly accessory protein [Pseudoalteromonas
           atlantica T6c]
 gi|123171735|sp|Q15YG5|ERPA_PSEA6 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|109699153|gb|ABG39073.1| iron-sulfur cluster assembly accessory protein [Pseudoalteromonas
           atlantica T6c]
          Length = 114

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  ++AA  ++K +V   +     +R+ +  GGC+G +Y      +   DGD  I+KD V
Sbjct: 9   IEFSDAAARKVKALVEEEENPNLKLRVYVTGGGCSGFQYGFTFD-EKVNDGDTTIDKDQV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y+LG E+D+      S F+ +NPN  + CGCG S  +
Sbjct: 68  TLVVDPMSLQYLLGGEVDYTEGLEGSRFLVNNPNATTTCGCGASFTV 114


>gi|254362245|ref|ZP_04978359.1| possible HesB family protein [Mannheimia haemolytica PHL213]
 gi|261492906|ref|ZP_05989452.1| putative HesB family protein [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261496744|ref|ZP_05993119.1| putative HesB family protein [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|153093820|gb|EDN74755.1| possible HesB family protein [Mannheimia haemolytica PHL213]
 gi|261307583|gb|EEY08911.1| putative HesB family protein [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261311447|gb|EEY12604.1| putative HesB family protein [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 113

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 34/114 (29%), Positives = 55/114 (48%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSDI   +  T+AA  ++K ++   +     +R+ +  GGC+G +Y              
Sbjct: 1   MSDIQIPLIFTDAAARKVKSLIEGEENPNLRLRVYITGGGCSGFQYGFTFDDQVNEGDLT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +  +  V + +D  SL Y++G  +D+      S FV +NPN  S CGCG S  I
Sbjct: 61  IENQS-VGLVVDPMSLQYLIGGTVDYTEGLDGSRFVVNNPNASSTCGCGSSFSI 113


>gi|311280872|ref|YP_003943103.1| iron-sulfur cluster assembly accessory protein [Enterobacter
           cloacae SCF1]
 gi|308750067|gb|ADO49819.1| iron-sulfur cluster assembly accessory protein [Enterobacter
           cloacae SCF1]
          Length = 114

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ +       +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 9   LQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFD-DQINDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  S CGCG S  I
Sbjct: 68  GLVVDPMSLQYLVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI 114


>gi|108760194|ref|YP_633159.1| iron-sulfur cluster assembly accessory protein [Myxococcus xanthus
           DK 1622]
 gi|108464074|gb|ABF89259.1| iron-sulfur cluster assembly accessory protein [Myxococcus xanthus
           DK 1622]
          Length = 113

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+ ++AV R+KE++   Q    G+R+++K GGC+GL+Y ++    +         KDGV
Sbjct: 8   ITIADSAVARLKELLEQRQTPEAGLRLAVKGGGCSGLQYSMEWSEKSRERDKIFE-KDGV 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V++D  S LY++GTE+ F+   + SGF   NPN  +ACGCG+S  +
Sbjct: 67  RVFVDPKSYLYLIGTELVFEQTLMASGFKLDNPNIKAACGCGESFSV 113


>gi|298291341|ref|YP_003693280.1| iron-sulfur cluster assembly accessory protein [Starkeya novella
           DSM 506]
 gi|296927852|gb|ADH88661.1| iron-sulfur cluster assembly accessory protein [Starkeya novella
           DSM 506]
          Length = 128

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 49/114 (42%), Positives = 77/114 (67%), Gaps = 1/114 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T+T+AA  R++ I+  S     G+R+ +K  GCAG+EY ++   +     D+++E 
Sbjct: 8   PPVMTLTDAAAERVRAIIARSDKPVAGLRVGIKNAGCAGMEYTMEFAEEA-GRFDEVVED 66

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            GVKV ID  +++Y+LGT++D+KT+KL + FVF+NPNQ SACGCG+SV I    
Sbjct: 67  KGVKVLIDPKAIMYLLGTQMDYKTDKLSAQFVFNNPNQTSACGCGESVAITPVK 120


>gi|126666491|ref|ZP_01737469.1| hypothetical protein MELB17_20316 [Marinobacter sp. ELB17]
 gi|126628879|gb|EAZ99498.1| hypothetical protein MELB17_20316 [Marinobacter sp. ELB17]
          Length = 117

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 52/105 (49%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            +++A  + KE++         +R+ +  GGC+G +Y          +   +   DGVK+
Sbjct: 14  FSDSAAAKAKELIDEEGNADLKLRVYVTGGGCSGFQYGFSFDDAQDDEDTIIER-DGVKL 72

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  S  Y++G+ +D+      S FV +NPN  S CGCG S  I
Sbjct: 73  LVDPMSYQYLVGSTVDYLEGLQGSQFVVNNPNASSTCGCGSSFSI 117


>gi|113460970|ref|YP_719037.1| HesB family protein [Haemophilus somnus 129PT]
 gi|123031350|sp|Q0I3N9|ERPA_HAES1 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|112823013|gb|ABI25102.1| HesB family protein [Haemophilus somnus 129PT]
          Length = 113

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 59/107 (55%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T T+AA  ++K ++   +     +R+ +  GGC+G +Y      +   DGD ++E  GV
Sbjct: 8   LTFTDAAANKVKTLISEEENTELKLRVYITGGGCSGFQYGFTFD-EKTNDGDLIVENSGV 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y++G  +D+      S F+ +NPN  + CGCG S  I
Sbjct: 67  KLVVDPMSLQYLVGGTVDYTEGLEGSRFIVNNPNASTTCGCGSSFSI 113


>gi|325496089|gb|EGC93948.1| iron-sulfur cluster insertion protein ErpA [Escherichia fergusonii
           ECD227]
          Length = 118

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ +       +R+ +  GGC+G +Y              +  K GV
Sbjct: 13  LEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIE-KQGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  S CGCG S  I
Sbjct: 72  GLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI 118


>gi|16759195|ref|NP_454812.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29140745|ref|NP_804087.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56412477|ref|YP_149552.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|62178774|ref|YP_215191.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|197361412|ref|YP_002141048.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|25310150|pir||AF0527 conserved hypothetical protein STY0226 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16418708|gb|AAL19168.1| putative HesB-like domain protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16501485|emb|CAD01358.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29136369|gb|AAO67936.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56126734|gb|AAV76240.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62126407|gb|AAX64110.1| putative HesB-like domain [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|197092888|emb|CAR58317.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|261245436|emb|CBG23226.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|322713228|gb|EFZ04799.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|323128524|gb|ADX15954.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|326626567|gb|EGE32910.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
 gi|332987156|gb|AEF06139.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 129

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ +       +R+ +  GGC+G +Y              +  K GV
Sbjct: 24  LQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIE-KQGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  S CGCG S  I
Sbjct: 83  GLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI 129


>gi|154253460|ref|YP_001414284.1| iron-sulfur cluster assembly accessory protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154157410|gb|ABS64627.1| iron-sulfur cluster assembly accessory protein [Parvibaculum
           lavamentivorans DS-1]
          Length = 116

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+ A  RI  I+     +   +R++++ GGC+G +Y    + D   D D +IEK+GV
Sbjct: 12  ITVTDNAAKRIARILEGEG-EGVMLRVAVQGGGCSGFQYGF-TLDDLQNDDDLVIEKNGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS S+ Y+ G+EIDF  + + S F  +NPN  +ACGCG S  +
Sbjct: 70  KVLIDSVSVEYLAGSEIDFVDDLIGSAFKINNPNATAACGCGTSFSV 116


>gi|50122228|ref|YP_051395.1| hypothetical protein ECA3306 [Pectobacterium atrosepticum SCRI1043]
 gi|227112934|ref|ZP_03826590.1| hypothetical protein PcarbP_08219 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
 gi|227327646|ref|ZP_03831670.1| hypothetical protein PcarcW_10064 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
 gi|261820491|ref|YP_003258597.1| iron-sulfur cluster assembly accessory protein [Pectobacterium
           wasabiae WPP163]
 gi|81644272|sp|Q6D1Z1|ERPA_ERWCT RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|49612754|emb|CAG76204.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
 gi|261604504|gb|ACX86990.1| iron-sulfur cluster assembly accessory protein [Pectobacterium
           wasabiae WPP163]
          Length = 115

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ + +     +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 10  LQFTDAAASKVKNLIADEENPELKLRVYITGGGCSGFQYGFTFD-DQINDGDMTIEKQGV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  S CGCG S  +
Sbjct: 69  ALVVDPMSLQYLVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSV 115


>gi|222148795|ref|YP_002549752.1| FeS assembly scaffold SufA [Agrobacterium vitis S4]
 gi|221735781|gb|ACM36744.1| FeS assembly scaffold SufA [Agrobacterium vitis S4]
          Length = 128

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 67/113 (59%), Positives = 86/113 (76%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMT+AA  R+KEIV NS   A+GIR+ +KKGGCAG+EY +DLVT+     D +   DG
Sbjct: 5   VMTMTDAAAARVKEIVENSGPDAKGIRVGIKKGGCAGMEYTIDLVTEPNPRDDLIAR-DG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
             VW++ A++LY+LGTEIDF+T  L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  ASVWLEPAAVLYLLGTEIDFETTTLRSGFTFRNPNQTSACGCGESVELKAADL 116


>gi|170740699|ref|YP_001769354.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           sp. 4-46]
 gi|168194973|gb|ACA16920.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           sp. 4-46]
          Length = 108

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/111 (36%), Positives = 58/111 (52%), Gaps = 3/111 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+D +T+T  A  RI EI+  S+     +RIS+  GGC+G +Y  D+  D   D   +  
Sbjct: 1   MTD-ITLTPRAARRINEIM-GSEPPGSMLRISVNGGGCSGFQYAFDIARDRATDDLAVER 58

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            DG  V +D  SL YM G  IDF  + +   F   NP   ++CGCG S  +
Sbjct: 59  -DGATVLVDPLSLEYMRGATIDFVNDLIGQSFKIENPQATASCGCGTSFSL 108


>gi|322834341|ref|YP_004214368.1| iron-sulfur cluster assembly accessory protein [Rahnella sp. Y9602]
 gi|321169542|gb|ADW75241.1| iron-sulfur cluster assembly accessory protein [Rahnella sp. Y9602]
          Length = 119

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ + +     +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 14  LQFTEAAARKVKNLISDEENPNLKLRVYITGGGCSGFQYGFTFD-DKINDGDMTIEKAGV 72

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  + CGCG S  I
Sbjct: 73  ALVVDPMSLQYLVGGSVDYTEGLEGSRFVVTNPNAKTTCGCGSSFSI 119


>gi|205359856|ref|ZP_02832790.2| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|224582052|ref|YP_002635850.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|205342480|gb|EDZ29244.1| iron-sulfur cluster assembly accessory protein YadR [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|224466579|gb|ACN44409.1| hypothetical protein SPC_0220 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|326621908|gb|EGE28253.1| iron-sulfur cluster insertion protein ErpA [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
          Length = 118

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ +       +R+ +  GGC+G +Y              +  K GV
Sbjct: 13  LQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIE-KQGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  S CGCG S  I
Sbjct: 72  GLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI 118


>gi|67459235|ref|YP_246859.1| Iron-sulfur cluster assembly accessory protein [Rickettsia felis
           URRWXCal2]
 gi|67004768|gb|AAY61694.1| Iron-sulfur cluster assembly accessory protein [Rickettsia felis
           URRWXCal2]
          Length = 110

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 69/111 (62%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T++A  ++K ++        GIR+ +K GGCAG  Y V+         D+++E
Sbjct: 1   MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGVKAGGCAGQTYYVEYADSK-NQFDEVVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+E+D+   K  S F F NPN+ + CGCG+S  +
Sbjct: 60  EKGVRILIDPKALMYILGSEMDYVETKFKSQFTFTNPNEKANCGCGKSFNV 110


>gi|288961960|ref|YP_003452270.1| hypothetical protein AZL_c04330 [Azospirillum sp. B510]
 gi|288914240|dbj|BAI75726.1| hypothetical protein AZL_c04330 [Azospirillum sp. B510]
          Length = 114

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 69/110 (62%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              +T+T+AA  R+K ++  +  +  G+RI +K  GC+GL Y V    +     D+++E 
Sbjct: 6   PKAITITDAAAERVKALMSKATDEMIGLRIGVKARGCSGLSYDVQYAKEKMK-FDEVVED 64

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GV + ID A++++++G+E+D+  +K  +GFVF NPN+   CGCG+S  +
Sbjct: 65  KGVTILIDPAAVMFLIGSEMDYVDDKFQTGFVFKNPNEKGRCGCGESFHV 114


>gi|212640227|ref|YP_002316747.1| Fe-S cluster assembly scaffold protein [Anoxybacillus flavithermus
           WK1]
 gi|212561707|gb|ACJ34762.1| Fe-S cluster assembly scaffold protein [Anoxybacillus flavithermus
           WK1]
          Length = 120

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 62/109 (56%), Gaps = 1/109 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M  IV +TE AV ++K+++  S  +    R+ +  GGC+GL Y +    +   D  +   
Sbjct: 1   MEQIVLLTEKAVEQVKQMMKESGEEHAYFRVGVYGGGCSGLSYAMGFEHNKREDDHEFE- 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           ++G+++ +D  S L + GT ID++   +  GF  HNPN +++CGCG S 
Sbjct: 60  QNGLRILVDKESALVLKGTTIDYEQGAMGGGFTIHNPNAIASCGCGSSF 108


>gi|170717527|ref|YP_001784618.1| iron-sulfur cluster assembly accessory protein [Haemophilus somnus
           2336]
 gi|189037864|sp|B0UU19|ERPA_HAES2 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|168825656|gb|ACA31027.1| iron-sulfur cluster assembly accessory protein [Haemophilus somnus
           2336]
          Length = 113

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 38/114 (33%), Positives = 63/114 (55%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           M+DI   +T T+AA  ++K ++   +     +R+ +  GGC+G +Y      +   DGD 
Sbjct: 1   MADIAVPLTFTDAAANKVKTLISEEENTELKLRVYITGGGCSGFQYGFTFD-EKTNDGDL 59

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++E  GVK+ +D  SL Y++G  +D+      S F+ +NPN  + CGCG S  I
Sbjct: 60  IVENSGVKLVVDPMSLQYLVGGTVDYTEGLEGSRFIVNNPNASTTCGCGSSFSI 113


>gi|170742453|ref|YP_001771108.1| FeS assembly scaffold SufA [Methylobacterium sp. 4-46]
 gi|168196727|gb|ACA18674.1| FeS assembly scaffold SufA [Methylobacterium sp. 4-46]
          Length = 126

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 51/113 (45%), Positives = 78/113 (69%), Gaps = 1/113 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++++TEAA  R++ I+ ++     GIR+ +K GGCAG+ Y ++   +     D + ++ 
Sbjct: 6   KVMSLTEAAAERVRRIIADADRPIAGIRVGVKNGGCAGMSYTMEYAEERRPGEDVVEDR- 64

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           GV+V+ID  ++L++LGTE+DF+T KL S FVFHNPNQ SACGCG+SV I  A 
Sbjct: 65  GVRVFIDPKAVLFLLGTEMDFQTTKLSSQFVFHNPNQTSACGCGESVAITPAK 117


>gi|148245090|ref|YP_001219784.1| iron-sulfur cluster insertion protein ErpA [Candidatus
           Vesicomyosocius okutanii HA]
 gi|160385724|sp|A5CVH1|ERPA_VESOH RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|146326917|dbj|BAF62060.1| conserved hypothetical protein [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 117

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  ++ A  ++  ++   Q     +R+ +  GGC+G  Y      +   +GD  +  +GV
Sbjct: 12  IIFSDNAAKKVSTLIEEEQNNNLYLRVYITGGGCSGFSYGFTFD-EKRKEGDSSVTNNGV 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ ID  S  Y++G  +D+  +   + F+ HNPN  + CGCG S  +
Sbjct: 71  QLVIDPMSYQYLIGATVDYLEDLQGARFIIHNPNAKTTCGCGSSFSV 117


>gi|15595862|ref|NP_249356.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas aeruginosa
           PAO1]
 gi|107099631|ref|ZP_01363549.1| hypothetical protein PaerPA_01000647 [Pseudomonas aeruginosa PACS2]
 gi|116054390|ref|YP_788835.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152989323|ref|YP_001346201.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas aeruginosa
           PA7]
 gi|218889388|ref|YP_002438252.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas aeruginosa
           LESB58]
 gi|254237143|ref|ZP_04930466.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254243742|ref|ZP_04937064.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296387158|ref|ZP_06876657.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas aeruginosa
           PAb1]
 gi|313111706|ref|ZP_07797499.1| hypothetical protein PA39016_004010003 [Pseudomonas aeruginosa
           39016]
 gi|81541825|sp|Q9I5Q6|ERPA_PSEAE RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|122261467|sp|Q02TA1|ERPA_PSEAB RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|166919625|sp|A6UZG6|ERPA_PSEA7 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|226694554|sp|B7V623|ERPA_PSEA8 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|9946543|gb|AAG04054.1|AE004501_6 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115589611|gb|ABJ15626.1| HesB-like domain [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169074|gb|EAZ54585.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126197120|gb|EAZ61183.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|150964481|gb|ABR86506.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
 gi|218769611|emb|CAW25371.1| HesB-like domain [Pseudomonas aeruginosa LESB58]
 gi|310884001|gb|EFQ42595.1| hypothetical protein PA39016_004010003 [Pseudomonas aeruginosa
           39016]
          Length = 116

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/105 (33%), Positives = 56/105 (53%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T  A  ++K ++         +R+ +  GGC+G +Y      ++  D D +IE+DGV +
Sbjct: 13  FTPGAANKVKTLIDEEGNPRLKLRVFVTGGGCSGFQYGFTFD-EDIADDDTVIERDGVGL 71

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  S  Y+ G+E+D++     S FV  NPN  + CGCGQS  I
Sbjct: 72  VVDPMSFQYLAGSEVDYQEGLEGSRFVIKNPNAATTCGCGQSFSI 116


>gi|160380685|sp|A0KNY6|ERPA_AERHH RecName: Full=Iron-sulfur cluster insertion protein erpA
          Length = 116

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + MT+AA  ++K ++   +     +R+ +  GGC+G +Y              +  K GV
Sbjct: 11  IQMTDAAANKVKTLITEEENPELKLRVYITGGGCSGFQYGFTFDEKINEGDTVVE-KSGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + ID  SL Y++G  +D+      S F   NPN  + CGCG S  I
Sbjct: 70  TMVIDPMSLQYLVGGSVDYTEGLEGSRFTVTNPNATTTCGCGSSFSI 116


>gi|300721900|ref|YP_003711178.1| hypothetical protein XNC1_0889 [Xenorhabdus nematophila ATCC 19061]
 gi|297628395|emb|CBJ88960.1| conserved hypothetical protein [Xenorhabdus nematophila ATCC 19061]
          Length = 114

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K +V +       +R+ +  GGC+G +Y      D   +GD  I+K GV
Sbjct: 9   LQFTDAAANKVKVLVADEDNPNLRLRVYITGGGCSGFQYGFTFD-DQMNEGDLTIQKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ ID  SL Y++G  +D+      S F+  NPN  + CGCG S  +
Sbjct: 68  ELVIDPMSLQYLVGGCVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSV 114


>gi|83312125|ref|YP_422389.1| hypothetical protein amb3026 [Magnetospirillum magneticum AMB-1]
 gi|82946966|dbj|BAE51830.1| Uncharacterized conserved protein [Magnetospirillum magneticum
           AMB-1]
          Length = 111

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA  R+K ++      + GIRI ++  GC+G+ Y ++   +     D+++E  GV
Sbjct: 6   MTITDAAAERVKVLLEKRGKPSVGIRIGVRSKGCSGMSYTLEYADEK-TQFDEILEDKGV 64

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V ID  + +++LGTE+DF  +K+ SGFVF NPN+   CGCG+S  +
Sbjct: 65  TVLIDPKATMFILGTEMDFVEDKMQSGFVFKNPNEKGRCGCGESFHV 111


>gi|290476637|ref|YP_003469542.1| hypothetical protein XBJ1_3660 [Xenorhabdus bovienii SS-2004]
 gi|289175975|emb|CBJ82778.1| conserved hypothetical protein [Xenorhabdus bovienii SS-2004]
          Length = 114

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K +V +       +R+ +  GGC+G +Y      D   +GD  I+K GV
Sbjct: 9   LQFTDAAANKVKVLVADEDNPNLRLRVYITGGGCSGFQYGFTFD-DQMNEGDLTIQKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G  +D+      S F+  NPN  + CGCG S  +
Sbjct: 68  ELVVDPMSLQYLVGGCVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSV 114


>gi|297567115|ref|YP_003686087.1| iron-sulfur cluster assembly accessory protein [Meiothermus
           silvanus DSM 9946]
 gi|296851564|gb|ADH64579.1| iron-sulfur cluster assembly accessory protein [Meiothermus
           silvanus DSM 9946]
          Length = 139

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 59/115 (51%), Gaps = 1/115 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T+TE A  + +EI+         IR+ +K GGC+G +Y + +          +   
Sbjct: 16  PPVLTITENAAAKAQEILQKYNKPQAAIRVFIKSGGCSGYQYGMAVDERELEGDTFVEM- 74

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            GV++ +D  SL  ++G+++D+    +  GF  +NPN  S+CGCG S     A +
Sbjct: 75  HGVRLVVDRMSLPLLIGSQVDWVESMMGGGFTVNNPNATSSCGCGHSFRTDGAKV 129


>gi|157369028|ref|YP_001477017.1| iron-sulfur cluster assembly accessory protein [Serratia
           proteamaculans 568]
 gi|226694570|sp|A8G9U9|ERPA_SERP5 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|157320792|gb|ABV39889.1| iron-sulfur cluster assembly accessory protein [Serratia
           proteamaculans 568]
          Length = 114

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ + +     +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 9   LQFTEAAASKVKVLIADEENPDLKLRVYITGGGCSGFQYGFTFD-DKVNDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  + CGCG S  +
Sbjct: 68  ALVVDPMSLQYLVGGSVDYTEGLEGSRFVVTNPNAKTTCGCGSSFSV 114


>gi|77461322|ref|YP_350829.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas fluorescens
           Pf0-1]
 gi|123603090|sp|Q3K5W6|ERPA_PSEPF RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|77385325|gb|ABA76838.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 116

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+ A +++K +V         +R+ +  GGC+G +Y      ++  + D ++E++GV
Sbjct: 11  LQFTQGAAHKVKSLVDEEGNDRLKLRVFVTGGGCSGFQYGFTFD-EDVAEDDTIVEREGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S  Y+ G E+D++     S FV  NPN  + CGCG S  I
Sbjct: 70  SLVVDPMSFQYLAGAEVDYQEGLEGSRFVIKNPNATTTCGCGSSFSI 116


>gi|303252466|ref|ZP_07338630.1| iron-sulfur cluster insertion protein ErpA [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307248502|ref|ZP_07530520.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|302648667|gb|EFL78859.1| iron-sulfur cluster insertion protein ErpA [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|306854978|gb|EFM87163.1| Iron-sulfur cluster insertion protein erpA [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
          Length = 113

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 53/114 (46%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           M DI   +  T+AA  ++K ++         +R+ +  GGC+G +Y              
Sbjct: 1   MDDIQIPLIFTDAAAKKVKSLIEGEDNPNLRLRVYITGGGCSGFQYGFTFDDQINEGDLT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +  ++ V + +D  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 61  IENQN-VGLVVDPMSLQYLIGGTVDYTEGLDGSRFVVQNPNASSTCGCGSSFSI 113


>gi|209695988|ref|YP_002263918.1| iron-sulfur cluster insertion protein ErpA [Aliivibrio salmonicida
           LFI1238]
 gi|226694523|sp|B6EL03|ERPA_ALISL RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|208009941|emb|CAQ80255.1| putative iron-sulphur cluster biosynthesis protein [Aliivibrio
           salmonicida LFI1238]
          Length = 113

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/114 (28%), Positives = 57/114 (50%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSD+   +T ++ A  ++K ++   +     +R+ +  GGC+G +Y      +       
Sbjct: 1   MSDVSVPLTFSDVAAAKVKTLIAEEENPNLKLRVYITGGGCSGFQYGFTFDEEVNEGDMT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           L+  DGV + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 61  LVN-DGVTLVVDPMSLQYLIGGIVDYTEGLEGSRFFINNPNATTTCGCGASFSV 113


>gi|146310360|ref|YP_001175434.1| iron-sulfur cluster assembly accessory protein [Enterobacter sp.
           638]
 gi|226694546|sp|A4W6Q3|ERPA_ENT38 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|145317236|gb|ABP59383.1| iron-sulfur cluster assembly accessory protein [Enterobacter sp.
           638]
          Length = 114

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ +       +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 9   LQFTEAAAKKVKVLIADENNPELKLRVYITGGGCSGFQYGFTFD-DQINDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 68  ALVVDPMSLQYLVGGAVDYTEGLEGSRFVVTNPNAKSTCGCGSSFSI 114


>gi|297171888|gb|ADI22876.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF0500_32L01]
          Length = 112

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 65/109 (59%), Gaps = 1/109 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            +V+MT+ AV R++ ++   +     +R+ ++ GGC+G +Y      +   + D   E+D
Sbjct: 5   PMVSMTQNAVQRLERLISAKEQSNLMLRVYVQGGGCSGFQYGFQFE-EQREEDDLEFERD 63

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVK+ +DS SL Y++G+EIDF  + + + FV  NPN  + CGCG S  +
Sbjct: 64  GVKLLVDSMSLQYLMGSEIDFVDDLMGTRFVVSNPNAATTCGCGSSFAV 112


>gi|163853381|ref|YP_001641424.1| FeS assembly scaffold SufA [Methylobacterium extorquens PA1]
 gi|218532239|ref|YP_002423055.1| FeS assembly scaffold SufA [Methylobacterium chloromethanicum CM4]
 gi|240140798|ref|YP_002965278.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           extorquens AM1]
 gi|254563308|ref|YP_003070403.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           extorquens DM4]
 gi|163664986|gb|ABY32353.1| FeS assembly scaffold SufA [Methylobacterium extorquens PA1]
 gi|218524542|gb|ACK85127.1| FeS assembly scaffold SufA [Methylobacterium chloromethanicum CM4]
 gi|240010775|gb|ACS42001.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           extorquens AM1]
 gi|254270586|emb|CAX26589.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           extorquens DM4]
          Length = 126

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 80/115 (69%), Gaps = 3/115 (2%)

Query: 1   MS--DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MS   ++T+T+ A  R+K I+ +++    G+R+ +K GGCAG+ Y ++   +    G+D+
Sbjct: 1   MSSFKVITLTDRAADRLKAIMADAETPIAGLRVGVKNGGCAGMSYTMEYA-EERKAGEDV 59

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
           IE  GV V+ID  ++L++LGTE+DF+T KL S FVF+NPNQ SACGCG+SV I  
Sbjct: 60  IEDRGVTVFIDPKAVLFLLGTEMDFQTTKLSSQFVFNNPNQTSACGCGESVAITP 114


>gi|126173402|ref|YP_001049551.1| iron-sulfur cluster insertion protein ErpA [Shewanella baltica
           OS155]
 gi|152999741|ref|YP_001365422.1| iron-sulfur cluster insertion protein ErpA [Shewanella baltica
           OS185]
 gi|160874360|ref|YP_001553676.1| iron-sulfur cluster insertion protein ErpA [Shewanella baltica
           OS195]
 gi|217974306|ref|YP_002359057.1| iron-sulfur cluster insertion protein ErpA [Shewanella baltica
           OS223]
 gi|304409326|ref|ZP_07390946.1| iron-sulfur cluster assembly accessory protein [Shewanella baltica
           OS183]
 gi|307303684|ref|ZP_07583437.1| iron-sulfur cluster assembly accessory protein [Shewanella baltica
           BA175]
 gi|160385730|sp|A3D1R9|ERPA_SHEB5 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160385731|sp|A6WKM0|ERPA_SHEB8 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|189037865|sp|A9L5J9|ERPA_SHEB9 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|254783677|sp|B8EBT9|ERPA_SHEB2 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|125996607|gb|ABN60682.1| iron-sulfur cluster assembly accessory protein [Shewanella baltica
           OS155]
 gi|151364359|gb|ABS07359.1| iron-sulfur cluster assembly accessory protein [Shewanella baltica
           OS185]
 gi|160859882|gb|ABX48416.1| iron-sulfur cluster assembly accessory protein [Shewanella baltica
           OS195]
 gi|217499441|gb|ACK47634.1| iron-sulfur cluster assembly accessory protein [Shewanella baltica
           OS223]
 gi|304351844|gb|EFM16242.1| iron-sulfur cluster assembly accessory protein [Shewanella baltica
           OS183]
 gi|306912582|gb|EFN43005.1| iron-sulfur cluster assembly accessory protein [Shewanella baltica
           BA175]
 gi|315266595|gb|ADT93448.1| iron-sulfur cluster assembly accessory protein [Shewanella baltica
           OS678]
          Length = 116

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++   Q  A  +R+ +  GGC+G +Y      +   DGD  IEK GV
Sbjct: 11  IQFTDAAAAKVKGLLEEEQNPALKLRVYVTGGGCSGFQYGFTFD-EKVNDGDFTIEKQGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G E+D+ +    S F   NPN  + CGCG S  +
Sbjct: 70  LLVVDPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV 116


>gi|293392837|ref|ZP_06637155.1| iron-sulfur cluster insertion protein ErpA [Serratia odorifera DSM
           4582]
 gi|291424696|gb|EFE97907.1| iron-sulfur cluster insertion protein ErpA [Serratia odorifera DSM
           4582]
          Length = 120

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 52/107 (48%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ + +     +R+ +  GGC+G +Y              +  K GV
Sbjct: 15  LQFTEAAAKKVKFLIADEENPDLKLRVYITGGGCSGFQYGFTFDDKINEGDMTIE-KQGV 73

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  + CGCG S  I
Sbjct: 74  ALVVDPMSLQYLVGGSVDYTEGLEGSRFVVTNPNAKTTCGCGSSFSI 120


>gi|238759914|ref|ZP_04621069.1| Iron-sulfur cluster insertion protein erpA [Yersinia aldovae ATCC
           35236]
 gi|238701898|gb|EEP94460.1| Iron-sulfur cluster insertion protein erpA [Yersinia aldovae ATCC
           35236]
          Length = 114

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ + +     +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 9   LQFTEAAAKKVKLLISDEENPNLKLRVYITGGGCSGFQYGFTFD-DQINDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G  +D+      S F+  NPN  S CGCG S  +
Sbjct: 68  ELVVDPMSLQYLVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSV 114


>gi|197105178|ref|YP_002130555.1| HesB/YadR/YfhF family protein [Phenylobacterium zucineum HLK1]
 gi|196478598|gb|ACG78126.1| HesB/YadR/YfhF family protein [Phenylobacterium zucineum HLK1]
          Length = 131

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 46/114 (40%), Positives = 76/114 (66%), Gaps = 1/114 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            +VT+TE A  R++EI+  +     G+R+ +K GGCAG EY+++         D+++E  
Sbjct: 18  KVVTLTERAAERVREIMGKADKPYAGLRVGVKNGGCAGQEYVLEYAETAD-PMDEVVEDK 76

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           GV + ++  ++L+++G+EID++  KL + FVFHNPN+  ACGCG+SV I+ A L
Sbjct: 77  GVTILVEPKAVLFLIGSEIDYEVSKLSAKFVFHNPNETDACGCGESVTIQPAKL 130


>gi|117620034|ref|YP_857987.1| iron-sulfur cluster insertion protein ErpA [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117561441|gb|ABK38389.1| HesB family protein [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 134

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + MT+AA  ++K ++   +     +R+ +  GGC+G +Y              +  K GV
Sbjct: 29  IQMTDAAANKVKTLITEEENPELKLRVYITGGGCSGFQYGFTFDEKINEGDTVVE-KSGV 87

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + ID  SL Y++G  +D+      S F   NPN  + CGCG S  I
Sbjct: 88  TMVIDPMSLQYLVGGSVDYTEGLEGSRFTVTNPNATTTCGCGSSFSI 134


>gi|325579027|ref|ZP_08148983.1| iron-sulfur cluster assembly protein IscA [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325159262|gb|EGC71396.1| iron-sulfur cluster assembly protein IscA [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 122

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 70/110 (63%), Gaps = 3/110 (2%)

Query: 3   DI-VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           ++ +T+TE A  R++  + N +GK  G+R+ +K  GC+GL Y+++ V     D D + E+
Sbjct: 15  NMSITLTEKAAQRVRTFLEN-RGKGIGLRLGVKTSGCSGLGYVLEFVDVL-NDDDLVFEQ 72

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GVKV +D  SL+Y+ G E+D+  E L  GF ++NPN   +CGCG+S  +
Sbjct: 73  HGVKVVVDPKSLVYLDGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV 122


>gi|317490883|ref|ZP_07949319.1| iron-sulfur cluster assembly accessory protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316920430|gb|EFV41753.1| iron-sulfur cluster assembly accessory protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 114

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/111 (28%), Positives = 54/111 (48%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +  TEAA  ++K ++ + +     +R+ +  GGC+G +Y              +  
Sbjct: 5   MALPLQFTEAAANKVKVLIADEENPDLKLRVYITGGGCSGFQYGFTFDDKVNEGDMTIE- 63

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV + +D  SL Y++G  +D+      S F+  NPN  + CGCG S  I
Sbjct: 64  KQGVMLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSI 114


>gi|51595094|ref|YP_069285.1| iron-sulfur cluster insertion protein ErpA [Yersinia
           pseudotuberculosis IP 32953]
 gi|108808878|ref|YP_652794.1| iron-sulfur cluster insertion protein ErpA [Yersinia pestis
           Antiqua]
 gi|108810868|ref|YP_646635.1| iron-sulfur cluster insertion protein ErpA [Yersinia pestis
           Nepal516]
 gi|145600227|ref|YP_001164303.1| iron-sulfur cluster insertion protein ErpA [Yersinia pestis
           Pestoides F]
 gi|153947889|ref|YP_001402285.1| iron-sulfur cluster insertion protein ErpA [Yersinia
           pseudotuberculosis IP 31758]
 gi|153997570|ref|ZP_02022670.1| hypothetical protein YPE_4029 [Yersinia pestis CA88-4125]
 gi|162420454|ref|YP_001605553.1| iron-sulfur cluster insertion protein ErpA [Yersinia pestis Angola]
 gi|165925675|ref|ZP_02221507.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165936811|ref|ZP_02225378.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166010051|ref|ZP_02230949.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166214073|ref|ZP_02240108.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167399189|ref|ZP_02304713.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167420645|ref|ZP_02312398.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167423265|ref|ZP_02315018.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|170025672|ref|YP_001722177.1| iron-sulfur cluster insertion protein ErpA [Yersinia
           pseudotuberculosis YPIII]
 gi|186894106|ref|YP_001871218.1| iron-sulfur cluster insertion protein ErpA [Yersinia
           pseudotuberculosis PB1/+]
 gi|218930404|ref|YP_002348279.1| iron-sulfur cluster insertion protein ErpA [Yersinia pestis CO92]
 gi|229839023|ref|ZP_04459182.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229896502|ref|ZP_04511670.1| conserved protein [Yersinia pestis Pestoides A]
 gi|229899589|ref|ZP_04514730.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229901077|ref|ZP_04516200.1| conserved protein [Yersinia pestis Nepal516]
 gi|270489257|ref|ZP_06206331.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis KIM
           D27]
 gi|294505093|ref|YP_003569155.1| hypothetical protein YPZ3_2984 [Yersinia pestis Z176003]
 gi|81640360|sp|Q66EE9|ERPA_YERPS RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|122382862|sp|Q1C3X3|ERPA_YERPA RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|122385161|sp|Q1CLU5|ERPA_YERPN RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|123050987|sp|Q0WBQ9|ERPA_YERPE RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160385726|sp|A4TPW8|ERPA_YERPP RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|226694588|sp|A7FM07|ERPA_YERP3 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694589|sp|B2K550|ERPA_YERPB RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694590|sp|A9R1E3|ERPA_YERPG RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226694591|sp|B1JK20|ERPA_YERPY RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|51588376|emb|CAH19984.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108774516|gb|ABG17035.1| hypothetical protein YPN_0703 [Yersinia pestis Nepal516]
 gi|108780791|gb|ABG14849.1| hypothetical protein YPA_2887 [Yersinia pestis Antiqua]
 gi|115349015|emb|CAL21976.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145211923|gb|ABP41330.1| hypothetical protein YPDSF_2970 [Yersinia pestis Pestoides F]
 gi|149289207|gb|EDM39287.1| hypothetical protein YPE_4029 [Yersinia pestis CA88-4125]
 gi|152959384|gb|ABS46845.1| iron-sulfur cluster assembly accessory protein [Yersinia
           pseudotuberculosis IP 31758]
 gi|162353269|gb|ABX87217.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis
           Angola]
 gi|165915460|gb|EDR34070.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165922287|gb|EDR39464.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165990958|gb|EDR43259.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166204704|gb|EDR49184.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166961451|gb|EDR57472.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167051693|gb|EDR63101.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167057435|gb|EDR67181.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|169752206|gb|ACA69724.1| iron-sulfur cluster assembly accessory protein [Yersinia
           pseudotuberculosis YPIII]
 gi|186697132|gb|ACC87761.1| iron-sulfur cluster assembly accessory protein [Yersinia
           pseudotuberculosis PB1/+]
 gi|229681802|gb|EEO77895.1| conserved protein [Yersinia pestis Nepal516]
 gi|229687081|gb|EEO79156.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229695389|gb|EEO85436.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229700576|gb|EEO88607.1| conserved protein [Yersinia pestis Pestoides A]
 gi|262363154|gb|ACY59875.1| hypothetical protein YPD4_2971 [Yersinia pestis D106004]
 gi|270337761|gb|EFA48538.1| iron-sulfur cluster assembly accessory protein [Yersinia pestis KIM
           D27]
 gi|294355552|gb|ADE65893.1| hypothetical protein YPZ3_2984 [Yersinia pestis Z176003]
 gi|320016588|gb|ADW00160.1| conserved protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 114

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 61/115 (53%), Gaps = 5/115 (4%)

Query: 1   MSD----IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGD 56
           MS+     +  TEAA  ++K ++ + +     +R+ +  GGC+G +Y      D   DGD
Sbjct: 1   MSNETVLPLQFTEAAAKKVKLLISDEENPNLKLRVYITGGGCSGFQYGFTFD-DQVNDGD 59

Query: 57  DLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             IEK GV++ +D  SL Y++G  +D+      S F+  NPN  S CGCG S  I
Sbjct: 60  MTIEKQGVELVVDPMSLQYLVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI 114


>gi|270263982|ref|ZP_06192250.1| iron-sulfur cluster insertion protein ErpA [Serratia odorifera
           4Rx13]
 gi|270042175|gb|EFA15271.1| iron-sulfur cluster insertion protein ErpA [Serratia odorifera
           4Rx13]
          Length = 114

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ + +     +R+ +  GGC+G +Y          DGD  IEK GV
Sbjct: 9   LQFTEAAASKVKVLIADEENPNLKLRVYITGGGCSGFQYGFTFDDKV-NDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  + CGCG S  +
Sbjct: 68  ALVVDPMSLQYLVGGSVDYTEGLEGSRFVVTNPNAKTTCGCGSSFSV 114


>gi|85058479|ref|YP_454181.1| hypothetical protein SG0501 [Sodalis glossinidius str. 'morsitans']
 gi|123520044|sp|Q2NVP9|ERPA_SODGM RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|84778999|dbj|BAE73776.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 114

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T++A  ++K ++ + +     +R+ +  GGC+G +Y          D   +  K GV
Sbjct: 9   LRFTDSAASKVKNLIADEENPNLKLRVYITGGGCSGFQYGFTFDDKVNEDDFTIE-KQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  + CGCG S  I
Sbjct: 68  ALVVDPMSLQYLVGGSVDYSEGLEGSRFIVTNPNAKTTCGCGSSFSI 114


>gi|332969114|gb|EGK08151.1| iron-sulfur cluster assembly protein IscA [Kingella kingae ATCC
           23330]
          Length = 106

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/108 (38%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+ A   I+  +   +GK +GIRI +K  GC+G+ Y ++ V +   +      +DG
Sbjct: 1   MITVTQNAAQHIQNFLAK-RGKGEGIRIGVKTSGCSGMAYTLEFVDEVQAEDTVFE-QDG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV+ID  SL+Y+ GT++D++ E L  GF F NPN   +CGCG+S  +
Sbjct: 59  VKVFIDPKSLVYLDGTQVDYQKEGLQEGFKFENPNVKESCGCGESFHV 106


>gi|221133492|ref|ZP_03559797.1| HesB protein family [Glaciecola sp. HTCC2999]
          Length = 114

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 53/111 (47%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +  +E+A  ++K ++         +R+ +  GGC+G +Y              +  
Sbjct: 5   MALPIEFSESAATKVKSLIEEENNPELKLRVYVTGGGCSGFQYGFTFDEKVNEGDMTIE- 63

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ V + +D  SL Y++G  +D+      S F+ +NPN  + CGCG S  I
Sbjct: 64  KNEVTLVVDPMSLQYLVGGVVDYIEGLEGSRFLVNNPNATTTCGCGSSFSI 114


>gi|242240227|ref|YP_002988408.1| iron-sulfur cluster assembly accessory protein [Dickeya dadantii
           Ech703]
 gi|242132284|gb|ACS86586.1| iron-sulfur cluster assembly accessory protein [Dickeya dadantii
           Ech703]
          Length = 114

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ + +     +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 9   LQFTDAAANKVKLLIADEENPELKLRVYITGGGCSGFQYGFTFD-DKVNDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y+LG  +D+      + FV HNPN  + CGCG S  +
Sbjct: 68  SLVVDPMSLQYLLGGSVDYTEGLEGARFVVHNPNAKTTCGCGSSFSV 114


>gi|171057730|ref|YP_001790079.1| iron-sulfur cluster assembly protein IscA [Leptothrix cholodnii
           SP-6]
 gi|170775175|gb|ACB33314.1| iron-sulfur cluster assembly protein IscA [Leptothrix cholodnii
           SP-6]
          Length = 110

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 46/112 (41%), Positives = 65/112 (58%), Gaps = 3/112 (2%)

Query: 1   MSDI-VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M+ + VT+TEAA   +   +   +GK  G+R+ +K  GC+GL Y ++   D     D + 
Sbjct: 1   MTTMAVTLTEAAAKHVSRYIA-RRGKGVGVRLGVKTTGCSGLAYKLEYA-DEITPDDHVF 58

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           E  GVKV +D  SL Y+ GTE+DF  E L  GF FHNP +   CGCG+S  +
Sbjct: 59  EGHGVKVLVDPKSLPYIDGTELDFVREGLNEGFKFHNPREKDRCGCGESFRV 110


>gi|70732898|ref|YP_262669.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas fluorescens
           Pf-5]
 gi|123652544|sp|Q4K514|ERPA_PSEF5 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|68347197|gb|AAY94803.1| HesB/YadR/YfhF family protein [Pseudomonas fluorescens Pf-5]
          Length = 116

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+ A +++K +V         +R+ +  GGC+G +Y      +   + D ++E++GV
Sbjct: 11  LQFTQGAAHKVKTLVDEEGNDRLKLRVFVTGGGCSGFQYGFTFD-EEVAEDDTIVEREGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S  Y+ G E+D++     S FV  NPN  + CGCG S  I
Sbjct: 70  SLVVDPMSFQYLAGAEVDYQEGLEGSRFVIKNPNATTTCGCGSSFSI 116


>gi|26246102|ref|NP_752141.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli
           CFT073]
 gi|91209227|ref|YP_539213.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli UTI89]
 gi|26106499|gb|AAN78685.1|AE016755_185 Hypothetical protein yadR [Escherichia coli CFT073]
 gi|91070801|gb|ABE05682.1| conserved hypothetical protein YadR [Escherichia coli UTI89]
          Length = 125

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ +       +R+ +  GGC+G +Y              +  K GV
Sbjct: 20  LEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIE-KQGV 78

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  S CGCG S  I
Sbjct: 79  GLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI 125


>gi|33151861|ref|NP_873214.1| iron-sulfur cluster insertion protein ErpA [Haemophilus ducreyi
           35000HP]
 gi|8134816|sp|Q9X4A0|ERPA_HAEDU RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|4741792|gb|AAD28701.1|AF101047_2 YadR [Haemophilus ducreyi]
 gi|33148082|gb|AAP95603.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP]
          Length = 114

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 35/115 (30%), Positives = 55/115 (47%), Gaps = 5/115 (4%)

Query: 1   MSDI----VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGD 56
           MSDI    +T T+AA  ++K ++         +R+ +  GGC+G +Y             
Sbjct: 1   MSDIDQIPLTFTDAAAKKVKSLIEGEDNPNLRLRVYITGGGCSGFQYGFTFDDKINEGDL 60

Query: 57  DLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +  ++ V + +D  SL Y++G  +D+      S FV  NPN  S CGCG S  I
Sbjct: 61  TIENQN-VGLIVDPMSLQYLIGGSVDYTEGLDGSRFVVQNPNASSTCGCGSSFSI 114


>gi|157693629|ref|YP_001488091.1| iron sulfur assembly protein [Bacillus pumilus SAFR-032]
 gi|157682387|gb|ABV63531.1| possible iron sulfur assembly protein [Bacillus pumilus SAFR-032]
          Length = 120

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 63/109 (57%), Gaps = 1/109 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  VT+TEAA  +IK+++   + +   +R+ +K GGC+GL Y +    +         +
Sbjct: 1   MSTPVTITEAAALQIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFDHEVSEKDTQFEQ 60

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           + G++V +DS SL  M GT IDFK   +  GF   NPN +++CGCG S 
Sbjct: 61  Q-GIQVLVDSESLDIMNGTIIDFKQSLMGGGFTIDNPNAIASCGCGSSF 108


>gi|332305000|ref|YP_004432851.1| iron-sulfur cluster assembly accessory protein [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332172329|gb|AEE21583.1| iron-sulfur cluster assembly accessory protein [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 114

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  ++AA  ++K +V   +     +R+ +  GGC+G +Y              +  KD V
Sbjct: 9   IEFSDAAARKVKALVDEEENPNLKLRVYVTGGGCSGFQYGFTFDEKVNEGDTTID-KDQV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G E+D+      S F+ +NPN  + CGCG S  +
Sbjct: 68  TLVVDPMSLQYLVGGEVDYTEGLEGSRFLVNNPNATTTCGCGASFTV 114


>gi|320583425|gb|EFW97638.1| iron sulfur assembly-related protein [Pichia angusta DL-1]
          Length = 190

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 72/110 (65%), Gaps = 3/110 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T+T  A+  +K+++   Q   + IRIS++  GC+GL Y ++ V  +P   D+ +E+
Sbjct: 84  KSVITLTPNAILHLKQLM--QQPDPKLIRISVRNRGCSGLSYHLEYV-SHPEKFDEQVEQ 140

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGVKV IDS +L  ++G+E+D+  +KL S FVF NPN   +CGCG+S  +
Sbjct: 141 DGVKVLIDSKALFSIIGSEMDWIDDKLSSKFVFKNPNSKGSCGCGESFMV 190


>gi|271501646|ref|YP_003334672.1| iron-sulfur cluster assembly accessory protein [Dickeya dadantii
           Ech586]
 gi|270345201|gb|ACZ77966.1| iron-sulfur cluster assembly accessory protein [Dickeya dadantii
           Ech586]
          Length = 114

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ + +     +R+ +  GGC+G +Y          DGD  IEK GV
Sbjct: 9   LQFTDAAANKVKLLIADEENPELKLRVYITGGGCSGFQYGFTFDDKV-NDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  + CGCG S  I
Sbjct: 68  SLVVDPMSLQYLIGGSVDYTEGLEGSRFVVTNPNAKTTCGCGSSFSI 114


>gi|75675851|ref|YP_318272.1| HesB/YadR/YfhF [Nitrobacter winogradskyi Nb-255]
 gi|74420721|gb|ABA04920.1| HesB/YadR/YfhF [Nitrobacter winogradskyi Nb-255]
          Length = 134

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 49/115 (42%), Positives = 78/115 (67%), Gaps = 1/115 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++ +T+AA  R+KE+   +  +  G+R+ +K GGCAG  Y V+   D     + + +K
Sbjct: 19  PQVMRLTDAAATRVKELAARADSEIVGLRVGIKNGGCAGQSYTVEYAHDIRPTDEVVEDK 78

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            GVK+ +D  ++LY+LGTE+D+K EK+ + FVF+NPNQVSACGCG+SV++  A +
Sbjct: 79  -GVKILVDPKAVLYLLGTEMDYKAEKMQAQFVFNNPNQVSACGCGESVQLTPAKI 132


>gi|307132145|ref|YP_003884161.1| hypothetical protein Dda3937_00501 [Dickeya dadantii 3937]
 gi|306529674|gb|ADM99604.1| conserved protein [Dickeya dadantii 3937]
          Length = 114

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ +       +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 9   LQFTDAAANKVKLLIADEDNPELKLRVYITGGGCSGFQYGFTFD-DQVNDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  + CGCG S  I
Sbjct: 68  SLVVDPMSLQYLIGGSVDYSEGLEGSRFVVTNPNAKTTCGCGSSFSI 114


>gi|254282516|ref|ZP_04957484.1| iron-sulfur cluster assembly accessory protein [gamma
           proteobacterium NOR51-B]
 gi|219678719|gb|EED35068.1| iron-sulfur cluster assembly accessory protein [gamma
           proteobacterium NOR51-B]
          Length = 117

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 63/110 (57%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            + + +T+ AV +++ +V + +     +R+ +  GGC+G +Y      +N  D D ++EK
Sbjct: 9   PNEIRLTDNAVRKVRTLVEDEENPNLKLRVFISGGGCSGFQYGFTFD-ENTADDDMVVEK 67

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GV   IDS S  Y++G+E+D+      S F+ +NPN V+ CGCG S  +
Sbjct: 68  GGVVAVIDSMSFQYLVGSEVDYTEGLEGSRFIINNPNAVTTCGCGASFSV 117


>gi|254428209|ref|ZP_05041916.1| hypothetical protein ADG881_1439 [Alcanivorax sp. DG881]
 gi|196194378|gb|EDX89337.1| hypothetical protein ADG881_1439 [Alcanivorax sp. DG881]
          Length = 112

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++ T+AA  ++KE+  +       +R+ +  GGCAG  Y          D   +  K+GV
Sbjct: 7   ISFTDAAATKVKELRDDEGNPNLKLRVYITGGGCAGFSYGFTFDEAVNEDDTSVE-KEGV 65

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D+ S+ Y+ G+++D++   + S FV  NPN  + CGCG S  +
Sbjct: 66  TLLVDAMSIQYLDGSQVDYEKGLMGSRFVVSNPNAATTCGCGSSFSV 112


>gi|149910494|ref|ZP_01899134.1| HesB family protein [Moritella sp. PE36]
 gi|149806454|gb|EDM66426.1| HesB family protein [Moritella sp. PE36]
          Length = 143

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  ++AA  R+KE++   +  A  +R+ +  GGC+G  Y      +    GD +IE
Sbjct: 34  MVLPIHFSDAAAARVKELITEEENLALKLRVYVTGGGCSGFSYGFTFD-EKINFGDTVIE 92

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+GV + +DS SL Y++   +D+      S F+ +NPN  + CGCG S  I
Sbjct: 93  KNGVTMVVDSMSLQYLVDGTVDYIDGLEGSRFLVNNPNATTTCGCGSSFSI 143


>gi|114570465|ref|YP_757145.1| iron-sulfur cluster assembly accessory protein [Maricaulis maris
           MCS10]
 gi|114340927|gb|ABI66207.1| iron-sulfur cluster assembly accessory protein [Maricaulis maris
           MCS10]
          Length = 109

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/111 (38%), Positives = 60/111 (54%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  VT++ +A  +IK I+         +RI +  GGC+G  Y  DL      D   +  
Sbjct: 1   MSANVTLSASAAKQIKTIIAAQAAAGL-LRIGVVGGGCSGFSYTFDLDDAVNGDDMIIER 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            DG KV ID ASL ++ G+EID+  E + + F  HNPN  +ACGCG S  +
Sbjct: 60  -DGAKVVIDEASLPFLDGSEIDYVDELIGASFKIHNPNATAACGCGTSFSV 109


>gi|237807355|ref|YP_002891795.1| iron-sulfur cluster insertion protein ErpA [Tolumonas auensis DSM
           9187]
 gi|237499616|gb|ACQ92209.1| iron-sulfur cluster assembly accessory protein [Tolumonas auensis
           DSM 9187]
          Length = 115

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 6/116 (5%)

Query: 1   MSDI-----VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDG 55
           MSD+     + MT+AA  ++K ++   +     +R+ +  GGC+G +Y            
Sbjct: 1   MSDVAVQFPIEMTDAAAAKVKTLITEEENPELKLRVYITGGGCSGFQYGFTFDEKINEGD 60

Query: 56  DDLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             +  KDGV + +D  SL Y++G  +D+      S F   NPN  + CGCG S  +
Sbjct: 61  TVVE-KDGVIMVVDGMSLQYLVGGVVDYIDGLEGSRFTVTNPNATTTCGCGSSFSV 115


>gi|229505751|ref|ZP_04395261.1| hypothetical protein VCF_000962 [Vibrio cholerae BX 330286]
 gi|229509216|ref|ZP_04398701.1| hypothetical protein VCE_000616 [Vibrio cholerae B33]
 gi|229512889|ref|ZP_04402356.1| hypothetical protein VCB_000531 [Vibrio cholerae TMA 21]
 gi|229519575|ref|ZP_04409018.1| hypothetical protein VCC_003607 [Vibrio cholerae RC9]
 gi|229520918|ref|ZP_04410340.1| hypothetical protein VIF_001442 [Vibrio cholerae TM 11079-80]
 gi|229530432|ref|ZP_04419820.1| hypothetical protein VCG_003552 [Vibrio cholerae 12129(1)]
 gi|229608862|ref|YP_002879510.1| iron-sulfur cluster insertion protein ErpA [Vibrio cholerae
           MJ-1236]
 gi|229332205|gb|EEN97693.1| hypothetical protein VCG_003552 [Vibrio cholerae 12129(1)]
 gi|229342151|gb|EEO07147.1| hypothetical protein VIF_001442 [Vibrio cholerae TM 11079-80]
 gi|229344264|gb|EEO09239.1| hypothetical protein VCC_003607 [Vibrio cholerae RC9]
 gi|229350138|gb|EEO15091.1| hypothetical protein VCB_000531 [Vibrio cholerae TMA 21]
 gi|229353788|gb|EEO18724.1| hypothetical protein VCE_000616 [Vibrio cholerae B33]
 gi|229357974|gb|EEO22891.1| hypothetical protein VCF_000962 [Vibrio cholerae BX 330286]
 gi|229371517|gb|ACQ61940.1| hypothetical protein VCD_003784 [Vibrio cholerae MJ-1236]
          Length = 123

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 52/107 (48%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++ ++AA  R+K ++   +  +  +R+ +  GGC+G +Y              +    GV
Sbjct: 18  LSFSDAAAKRVKALIAEEENPSLMLRVYITGGGCSGFQYGFTFDETVNEGDTKIEN-SGV 76

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 77  ILVVDPMSLQYLIGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 123


>gi|123441091|ref|YP_001005080.1| iron-sulfur cluster insertion protein ErpA [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|238786785|ref|ZP_04630586.1| Iron-sulfur cluster insertion protein erpA [Yersinia frederiksenii
           ATCC 33641]
 gi|238791229|ref|ZP_04634868.1| Iron-sulfur cluster insertion protein erpA [Yersinia intermedia
           ATCC 29909]
 gi|238797171|ref|ZP_04640673.1| Iron-sulfur cluster insertion protein erpA [Yersinia mollaretii
           ATCC 43969]
 gi|332160473|ref|YP_004297050.1| iron-sulfur cluster insertion protein ErpA [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|160385725|sp|A1JJQ3|ERPA_YERE8 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|122088052|emb|CAL10840.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238719018|gb|EEQ10832.1| Iron-sulfur cluster insertion protein erpA [Yersinia mollaretii
           ATCC 43969]
 gi|238725153|gb|EEQ16792.1| Iron-sulfur cluster insertion protein erpA [Yersinia frederiksenii
           ATCC 33641]
 gi|238729362|gb|EEQ20877.1| Iron-sulfur cluster insertion protein erpA [Yersinia intermedia
           ATCC 29909]
 gi|318607063|emb|CBY28561.1| putative iron binding protein from the HesB_IscA_SufA family
           [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325664703|gb|ADZ41347.1| iron-sulfur cluster insertion protein ErpA [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330859206|emb|CBX69557.1| iron-sulfur cluster insertion protein erpA [Yersinia enterocolitica
           W22703]
          Length = 114

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ + +     +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 9   LQFTEAAAKKVKLLISDEENPNLKLRVYITGGGCSGFQYGFTFD-DQINDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G  +D+      S F+  NPN  S CGCG S  I
Sbjct: 68  ELVVDPMSLQYLVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI 114


>gi|110833223|ref|YP_692082.1| HesB/YadR/YfhF family protein [Alcanivorax borkumensis SK2]
 gi|110646334|emb|CAL15810.1| HesB/YadR/YfhF family protein [Alcanivorax borkumensis SK2]
          Length = 150

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++ T+AA  ++KE+  +       +R+ +  GGCAG  Y          D   +  K+GV
Sbjct: 45  ISFTDAAAAKVKELRDDEGNPNLKLRVYITGGGCAGFSYGFTFDETVNEDDTSVE-KEGV 103

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D+ S+ Y+ G+ +D++   + S FV  NPN  + CGCG S  +
Sbjct: 104 ILLVDAMSIQYLDGSVVDYEKGLMGSRFVVSNPNAATTCGCGSSFSV 150


>gi|146281149|ref|YP_001171302.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas stutzeri
           A1501]
 gi|160385716|sp|A4VHK9|ERPA_PSEU5 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|145569354|gb|ABP78460.1| iron-sulfur cluster assembly accessory protein, putative
           [Pseudomonas stutzeri A1501]
 gi|327479304|gb|AEA82614.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas stutzeri
           DSM 4166]
          Length = 116

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  ++ A  ++K +V         +R+ +  GGC+G +Y      ++  D D +IE++GV
Sbjct: 11  IQFSQGAASKVKSLVDEEGNPRLKLRVFVTGGGCSGFQYGFTFD-EDVADDDTVIEREGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S  Y+ G E+D++     S FV  NPN  + CGCGQS  I
Sbjct: 70  SLVVDPMSYQYLAGAEVDYQEGLEGSRFVIKNPNATTTCGCGQSFSI 116


>gi|194015328|ref|ZP_03053944.1| YutM [Bacillus pumilus ATCC 7061]
 gi|194012732|gb|EDW22298.1| YutM [Bacillus pumilus ATCC 7061]
          Length = 120

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 63/109 (57%), Gaps = 1/109 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  VT+TEAA  +IK+++   + +   +R+ +K GGC+GL Y +    +         +
Sbjct: 1   MSTPVTITEAAALQIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFDHEVSEKDTQFEQ 60

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           + G++V +DS SL  M GT IDFK   +  GF   NPN +++CGCG S 
Sbjct: 61  Q-GIQVLVDSESLDIMNGTIIDFKQSLMGGGFTIDNPNAIASCGCGSSF 108


>gi|251788668|ref|YP_003003389.1| iron-sulfur cluster assembly accessory protein [Dickeya zeae
           Ech1591]
 gi|247537289|gb|ACT05910.1| iron-sulfur cluster assembly accessory protein [Dickeya zeae
           Ech1591]
          Length = 114

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ + +     +R+ +  GGC+G +Y          DGD  IEK GV
Sbjct: 9   LQFTDAAASKVKLLIADEENPELKLRVYITGGGCSGFQYGFTFDDKV-NDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S FV  NPN  + CGCG S  I
Sbjct: 68  SLVVDPMSLQYLIGGSVDYTEGLEGSRFVVTNPNAKTTCGCGSSFSI 114


>gi|212711304|ref|ZP_03319432.1| hypothetical protein PROVALCAL_02376 [Providencia alcalifaciens DSM
           30120]
 gi|261345785|ref|ZP_05973429.1| iron-sulfur cluster insertion protein ErpA [Providencia rustigianii
           DSM 4541]
 gi|212686033|gb|EEB45561.1| hypothetical protein PROVALCAL_02376 [Providencia alcalifaciens DSM
           30120]
 gi|282566274|gb|EFB71809.1| iron-sulfur cluster insertion protein ErpA [Providencia rustigianii
           DSM 4541]
          Length = 114

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 52/107 (48%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K++V +       +R+ +  GGC+G +Y              +  K GV
Sbjct: 9   LQFTDAAAIKVKDLVADENNPNLRLRVYITGGGCSGFQYGFTFDDQINEGDMTIE-KQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  S CGCG S  +
Sbjct: 68  ALVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSV 114


>gi|85716310|ref|ZP_01047283.1| HesB/YadR/YfhF [Nitrobacter sp. Nb-311A]
 gi|85696826|gb|EAQ34711.1| HesB/YadR/YfhF [Nitrobacter sp. Nb-311A]
          Length = 131

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 49/115 (42%), Positives = 78/115 (67%), Gaps = 1/115 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++ +T+AA  R+KE+   +  +  G+R+ +K GGCAG  Y V+   D     + + +K
Sbjct: 16  PQVMRLTDAAAARVKELAARADSEIVGLRVGIKNGGCAGQSYTVEYAHDIRPTDEVVEDK 75

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            GVK+ +D  ++LY+LGTE+D+K EK+ + FVF+NPNQVSACGCG+SV++  A +
Sbjct: 76  -GVKILVDPKAVLYLLGTEMDYKAEKMQAQFVFNNPNQVSACGCGESVQLTPAKV 129


>gi|320540388|ref|ZP_08040038.1| putative conserved protein [Serratia symbiotica str. Tucson]
 gi|320029319|gb|EFW11348.1| putative conserved protein [Serratia symbiotica str. Tucson]
          Length = 114

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 60/115 (52%), Gaps = 5/115 (4%)

Query: 1   MSD----IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGD 56
           M+D     +  TEAA  ++K ++ + +     +R+ +  GGC+G +Y      D   DGD
Sbjct: 1   MNDETALPLQFTEAAANKVKFLIADEENPNLKLRVYITGGGCSGFQYGFTFD-DKINDGD 59

Query: 57  DLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             IEK GV + +D  SL Y++G  +D+      S FV  NPN  + CGCG S  I
Sbjct: 60  MTIEKQGVALVVDPMSLQYLVGGAVDYTEGLEGSRFVVTNPNAKTTCGCGSSFSI 114


>gi|254787009|ref|YP_003074438.1| HesB/YadR/YfhF-like iron-sulfur cluster assembly accessory family
           protein [Teredinibacter turnerae T7901]
 gi|237686862|gb|ACR14126.1| HesB/YadR/YfhF-like iron-sulfur cluster assembly accessory family
           protein [Teredinibacter turnerae T7901]
          Length = 118

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            + + +T+ AV ++K+++         +R+ +  GGC+G +Y       +  D D  IEK
Sbjct: 10  PEPLLVTQNAVSKVKDLIDEEGNPELKLRVYVTGGGCSGFQYGFAFDEVS-GDDDAQIEK 68

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GV V +DS S  Y++G  +D++     S F   NPN  S CGCG S  I
Sbjct: 69  SGVTVLVDSMSYPYLVGATLDYQEGLQGSRFTVENPNASSTCGCGSSFSI 118


>gi|92117846|ref|YP_577575.1| HesB/YadR/YfhF [Nitrobacter hamburgensis X14]
 gi|91800740|gb|ABE63115.1| HesB/YadR/YfhF [Nitrobacter hamburgensis X14]
          Length = 134

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 51/115 (44%), Positives = 80/115 (69%), Gaps = 1/115 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++ +T+AA  R+KE+   +  +  G+R+ +KKGGCAG  Y V+   D     D+++E 
Sbjct: 19  PQVMRLTDAAAARVKELAARADSEIVGLRVGIKKGGCAGQSYTVEYAHD-IKSTDEVVED 77

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            GVKV +D  ++LY+LGTE+D+K EK+ + F+F+NPNQVSACGCG+SV++  A +
Sbjct: 78  KGVKVLVDPKAVLYLLGTEMDYKAEKMQAQFIFNNPNQVSACGCGESVQLTPAKI 132


>gi|59712741|ref|YP_205517.1| iron-sulfur cluster insertion protein ErpA [Vibrio fischeri ES114]
 gi|197334736|ref|YP_002156933.1| iron-binding protein ErpA [Vibrio fischeri MJ11]
 gi|75353432|sp|Q5E2W7|ERPA_VIBF1 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|226694575|sp|B5FAL7|ERPA_VIBFM RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|59480842|gb|AAW86629.1| conserved protein [Vibrio fischeri ES114]
 gi|197316226|gb|ACH65673.1| iron-binding protein ErpA [Vibrio fischeri MJ11]
          Length = 113

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/114 (28%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSD+   +T ++ A  ++K ++   +     +R+ +  GGC+G +Y      D       
Sbjct: 1   MSDVSVPLTFSDVAAAKVKTLIAEEENPNLKLRVYITGGGCSGFQYGFTFDEDVNEGDMT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +   DGV + +D  SL Y++G ++D+      S F   NPN  + CGCG S  +
Sbjct: 61  IEN-DGVTLVVDPMSLQYLIGGKVDYTEGLEGSRFFIDNPNATTTCGCGASFSV 113


>gi|94502119|ref|ZP_01308621.1| HesB/YadR/YfhF family protein [Oceanobacter sp. RED65]
 gi|94425756|gb|EAT10762.1| HesB/YadR/YfhF family protein [Oceanobacter sp. RED65]
          Length = 109

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 61/111 (54%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS++ ++T AAV +I+ ++ +    +  +R+ +  GGC+G +Y          + D  ++
Sbjct: 1   MSEM-SLTPAAVGKIQALIEDEGDDSLCLRVFVTGGGCSGFQYGFTFD-TEVAEDDAQMQ 58

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +DGVKV +DS S  Y+ G  +D++     S FV  NP   + CGCG S  I
Sbjct: 59  QDGVKVLVDSLSYPYLEGASVDYQENLEGSRFVVSNPQASTTCGCGSSFTI 109


>gi|332142569|ref|YP_004428307.1| HesB protein family [Alteromonas macleodii str. 'Deep ecotype']
 gi|327552591|gb|AEA99309.1| HesB protein family [Alteromonas macleodii str. 'Deep ecotype']
          Length = 114

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  ++AA  ++K +V   +     +R+ +  GGC+G +Y              +  KD V
Sbjct: 9   IEFSDAAAAKVKTLVSEEENPDLKLRVYVTGGGCSGFQYGFTFDEKVNEGDMTIE-KDSV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  + CGCG S  +
Sbjct: 68  TLVVDPMSLQYLVGGVVDYVDGLEGSRFLVQNPNATTTCGCGASFSV 114


>gi|51473669|ref|YP_067426.1| iron-binding protein IscA/HesB [Rickettsia typhi str. Wilmington]
 gi|51459981|gb|AAU03944.1| iron-binding protein IscA/HesB [Rickettsia typhi str. Wilmington]
          Length = 110

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 69/111 (62%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T++A  ++K ++        GIR+ +K GGCAG  Y V+   +     D+++E
Sbjct: 1   MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGIKSGGCAGQTYYVEYADNK-NQFDEVVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+E+D+      S F F NPN+ + CGCG+S  +
Sbjct: 60  EKGVRILIDPKALMYILGSEMDYVETNFKSQFTFTNPNEKANCGCGKSFSV 110


>gi|226946614|ref|YP_002801687.1| iron-sulfur cluster insertion protein ErpA [Azotobacter vinelandii
           DJ]
 gi|259646274|sp|C1DHX9|ERPA_AZOVD RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226721541|gb|ACO80712.1| essential respiratory protein A, ErpA [Azotobacter vinelandii DJ]
          Length = 116

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 56/105 (53%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T+ A  ++K ++         +R+ +  GGC+G +Y      ++  + D ++E++GV +
Sbjct: 13  FTQGAANKVKTLISEEGNPRLKLRVFVTGGGCSGFQYGFTFD-EDVAEDDTIVEREGVSL 71

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  S  Y+ G E+D++     S FV  NPN  + CGCGQS  +
Sbjct: 72  VVDPMSFQYLAGAEVDYQEGLEGSRFVIKNPNAATTCGCGQSFSV 116


>gi|78484694|ref|YP_390619.1| HesB/YadR/YfhF [Thiomicrospira crunogena XCL-2]
 gi|123555991|sp|Q31IS8|ERPA_THICR RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|78362980|gb|ABB40945.1| Iron-sulfur cluster assembly accessory protein [Thiomicrospira
           crunogena XCL-2]
          Length = 113

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   V  TEAA  ++  ++ +       +R+ +  GGC+G +Y      ++  + D ++E
Sbjct: 4   MPTPVNFTEAAASKVSGLIQDEGNPELKLRVYITGGGCSGFQYGFTFD-ESQAEDDTVVE 62

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KDGVK+ ID  S  Y++G +ID+  +   + FV  NPN  + CGCG S  +
Sbjct: 63  KDGVKLMIDPMSFQYLMGAKIDYLEDLQGARFVIENPNASTTCGCGSSFGV 113


>gi|315179203|gb|ADT86117.1| HesB family protein [Vibrio furnissii NCTC 11218]
          Length = 113

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/114 (33%), Positives = 62/114 (54%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSDI   ++ ++AA  R++ ++   +  A  +R+ +  GGC+G +Y      +N  DGD 
Sbjct: 1   MSDINVPLSFSDAAATRVRALIAEEENPALKLRVYITGGGCSGFQYGFTFD-ENVNDGDT 59

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IE  GV + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 60  TIENSGVTLVVDPMSLQYLIGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|188578868|ref|YP_001915797.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188523320|gb|ACD61265.1| HesB/YadR/YfhF [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 102

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 31/102 (30%), Positives = 55/102 (53%), Gaps = 1/102 (0%)

Query: 10  AAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWID 69
           AA  +++E++         +R+ ++ GGC+G +Y  +   +N  + D  +  DGV + +D
Sbjct: 2   AAAAKVRELIQEEGNADLALRVYIQGGGCSGFQYGFEFD-ENRAEDDLAVVTDGVTLLVD 60

Query: 70  SASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             SL Y++G E+D+      + FV  NPN  + CGCG S  +
Sbjct: 61  PLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV 102


>gi|297181136|gb|ADI17333.1| uncharacterized conserved protein [uncultured Oceanospirillales
           bacterium HF0070_21F08]
          Length = 111

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +TE A  +++E+  +       +R+ +  GGCAG  Y          D   +  +D V
Sbjct: 6   IILTERAAAKVRELRDDEGNPELKLRVYITGGGCAGFSYGFTFDEAVNEDDTAVARED-V 64

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D+ S+ Y+ G+++D++   + S F+ +NPN  + CGCG S  +
Sbjct: 65  TLLVDAMSIQYLDGSQVDYEQGLMGSRFIVNNPNAATTCGCGSSFSV 111


>gi|94309972|ref|YP_583182.1| iron-sulfur cluster assembly protein IscA [Cupriavidus
           metallidurans CH34]
 gi|93353824|gb|ABF07913.1| FeS cluster assembly protein [Cupriavidus metallidurans CH34]
          Length = 113

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 61/109 (55%), Gaps = 2/109 (1%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            +++MTE A   +   +   +GK  G+R+ +K  GC+GL Y ++ V +   +        
Sbjct: 7   KMISMTEKAAKHVARYL-ERRGKGVGLRVGVKTTGCSGLAYKLEYVDEVLPEDQVFET-H 64

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G+KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 65  GIKVIVDPKSLPYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 113


>gi|188533027|ref|YP_001906824.1| HesB/YadR/YfhF family protein [Erwinia tasmaniensis Et1/99]
 gi|226694547|sp|B2VE26|ERPA_ERWT9 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|188028069|emb|CAO95926.1| HesB/YadR/YfhF family protein [Erwinia tasmaniensis Et1/99]
          Length = 114

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ +       +R+ +  GGC+G +Y              +  K GV
Sbjct: 9   LQFTDAAASKVKNLISDENNPDLKLRVYITGGGCSGFQYGFTFDDKVNEGDMTIE-KSGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  + CGCG S  I
Sbjct: 68  ALVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSI 114


>gi|330812097|ref|YP_004356559.1| iron-sulfur cluster insertion protein [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327380205|gb|AEA71555.1| putative iron-sulfur cluster insertion protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 116

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T  A +++K +V         +R+ +  GGC+G +Y      +   D D ++E++GV
Sbjct: 11  LQFTHGAAHKVKSLVDEEGNDRLKLRVFVTGGGCSGFQYGFTFD-EEVADDDTIVEREGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S  Y+ G E+D++     S FV  NPN  + CGCG S  I
Sbjct: 70  SLVVDPMSFQYLAGAEVDYQEGLEGSRFVIKNPNATTTCGCGSSFSI 116


>gi|294139671|ref|YP_003555649.1| HesB/YadR/YfhF family protein [Shewanella violacea DSS12]
 gi|293326140|dbj|BAJ00871.1| HesB/YadR/YfhF family protein [Shewanella violacea DSS12]
          Length = 115

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++   +  A  +R+ +  GGC+G +Y              +  K GV
Sbjct: 10  IRFTDAAALKVKTLMDEEENDALKLRVYVTGGGCSGFQYGFTFDEKINEGDFTVE-KQGV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G E+D+ +    S F   NPN  + CGCG S  +
Sbjct: 69  QLVVDPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV 115


>gi|329850530|ref|ZP_08265375.1| iron-sulfur cluster assembly accessory family protein
           [Asticcacaulis biprosthecum C19]
 gi|328840845|gb|EGF90416.1| iron-sulfur cluster assembly accessory family protein
           [Asticcacaulis biprosthecum C19]
          Length = 130

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 73/111 (65%), Gaps = 1/111 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +VT+T+AA  ++K I+  +     G+R+ +K+GGCAG EY++          + + +K G
Sbjct: 18  VVTLTDAAADQVKAIMARADNSYAGLRVGVKQGGCAGQEYVLSYADAIGPLDEVVSDK-G 76

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           V V ID  ++LY++GT ID++T KL S FVF NPN+  ACGCG+SV IK A
Sbjct: 77  VTVLIDPKAVLYLVGTVIDYETTKLASKFVFRNPNETDACGCGESVTIKPA 127


>gi|294637663|ref|ZP_06715942.1| iron-sulfur cluster insertion protein ErpA [Edwardsiella tarda ATCC
           23685]
 gi|291089218|gb|EFE21779.1| iron-sulfur cluster insertion protein ErpA [Edwardsiella tarda ATCC
           23685]
          Length = 114

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 31/111 (27%), Positives = 55/111 (49%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +  T+AA  ++K +V +       +R+ +  GGC+G +Y              +  
Sbjct: 5   MAVPLQFTDAAANKVKSLVADEDNPNLKLRVYITGGGCSGFQYGFTFDDKINDGDMTIEN 64

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV + +D+ SL Y++G  +D+      S F+ +NPN  + CGCG S  I
Sbjct: 65  Q-GVALVVDAMSLQYLVGGSVDYTEGLEGSRFIVNNPNAKTTCGCGSSFSI 114


>gi|161869490|ref|YP_001598657.1| hypothetical protein NMCC_0503 [Neisseria meningitidis 053442]
 gi|161595043|gb|ABX72703.1| conserved hypothetical protein [Neisseria meningitidis 053442]
          Length = 163

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  T++   ++ +++         +R+ +  GGC+G +Y      +   D D  
Sbjct: 52  MSDESPIIFTDSCCAKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFD-EIKNDDDFE 110

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           IEK+G+   +D  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 111 IEKNGLVFLVDPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV 163


>gi|223041532|ref|ZP_03611733.1| iron-sulfur cluster insertion protein erpA [Actinobacillus minor
           202]
 gi|223017627|gb|EEF16037.1| iron-sulfur cluster insertion protein erpA [Actinobacillus minor
           202]
          Length = 113

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 35/114 (30%), Positives = 55/114 (48%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSDI   +T T+AA  ++K ++         +R+ +  GG +G +Y              
Sbjct: 1   MSDIQIPLTFTDAAANKVKSLIEGEDNPNLRLRVYITGGGXSGFQYGFTFDDQINEGDLT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +  ++ V + +D  SL Y++G  +D+      S FV HNPN  S CGCG S  I
Sbjct: 61  IENQN-VGLVVDPMSLQYLIGGTVDYTEGLDGSRFVVHNPNASSTCGCGSSFSI 113


>gi|268591281|ref|ZP_06125502.1| hypothetical protein PROVRETT_07555 [Providencia rettgeri DSM 1131]
 gi|291313257|gb|EFE53710.1| iron-sulfur cluster insertion protein ErpA [Providencia rettgeri
           DSM 1131]
          Length = 114

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 52/107 (48%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K++V +       +R+ +  GGC+G +Y              +  K GV
Sbjct: 9   LQFTDAAAIKVKDLVSDEDNPNLRLRVYITGGGCSGFQYGFTFDDQINEGDMTIE-KQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  S CGCG S  +
Sbjct: 68  ALVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSV 114


>gi|304388213|ref|ZP_07370334.1| HesB/YadR/YfhF family protein [Neisseria meningitidis ATCC 13091]
 gi|304337824|gb|EFM03972.1| HesB/YadR/YfhF family protein [Neisseria meningitidis ATCC 13091]
          Length = 163

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  T++   ++ +++         +R+ +  GGC+G +Y      +   D D  
Sbjct: 52  MSDESPIIFTDSCCAKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFD-EIKNDDDFE 110

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           IEK+G+   +D  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 111 IEKNGLVFLVDPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV 163


>gi|160380683|sp|Q0VSN8|ERPA_ALCBS RecName: Full=Iron-sulfur cluster insertion protein erpA
          Length = 119

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++ T+AA  ++KE+  +       +R+ +  GGCAG  Y          D   +  K+GV
Sbjct: 14  ISFTDAAAAKVKELRDDEGNPNLKLRVYITGGGCAGFSYGFTFDETVNEDDTSVE-KEGV 72

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D+ S+ Y+ G+ +D++   + S FV  NPN  + CGCG S  +
Sbjct: 73  ILLVDAMSIQYLDGSVVDYEKGLMGSRFVVSNPNAATTCGCGSSFSV 119


>gi|309379670|emb|CBX21659.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 106

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V +   D      + G
Sbjct: 1   MITLTENAAKHINDYLAK-RGKGLGVRLGVKTSGCSGMAYNLEFVDEADGDDLIFE-EHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 59  ARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|158425233|ref|YP_001526525.1| HesB protein [Azorhizobium caulinodans ORS 571]
 gi|158332122|dbj|BAF89607.1| HesB protein [Azorhizobium caulinodans ORS 571]
          Length = 142

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 52/112 (46%), Positives = 77/112 (68%), Gaps = 1/112 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TEAA  R+++I+  +      +R+ +K GGCAG+ Y +D      +  D+++E  G
Sbjct: 26  VMRITEAAAARVRQIMARTDPPPVAVRVGVKNGGCAGMSYTMDYA-TEILPTDEVVEDKG 84

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           VKV ID  ++L++LGTE+DFKT+KL S FVF+NPNQ SACGCG+SV I  A 
Sbjct: 85  VKVIIDPKAVLFLLGTEMDFKTDKLASQFVFNNPNQTSACGCGESVAITPAK 136


>gi|22124714|ref|NP_668137.1| iron-sulfur cluster insertion protein ErpA [Yersinia pestis KIM 10]
 gi|45440157|ref|NP_991696.1| iron-sulfur cluster insertion protein ErpA [Yersinia pestis biovar
           Microtus str. 91001]
 gi|21957530|gb|AAM84388.1|AE013683_1 hypothetical protein y0801 [Yersinia pestis KIM 10]
 gi|45435013|gb|AAS60573.1| conserved hypothetical protein [Yersinia pestis biovar Microtus
           str. 91001]
          Length = 119

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 61/115 (53%), Gaps = 5/115 (4%)

Query: 1   MSD----IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGD 56
           MS+     +  TEAA  ++K ++ + +     +R+ +  GGC+G +Y      D   DGD
Sbjct: 6   MSNETVLPLQFTEAAAKKVKLLISDEENPNLKLRVYITGGGCSGFQYGFTFD-DQVNDGD 64

Query: 57  DLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             IEK GV++ +D  SL Y++G  +D+      S F+  NPN  S CGCG S  I
Sbjct: 65  MTIEKQGVELVVDPMSLQYLVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI 119


>gi|297170334|gb|ADI21369.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF0010_20H22]
          Length = 115

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +TE AV ++K ++     K   +R+ +  GGC+G +Y   L      D D +++++ V
Sbjct: 10  LNITENAVLKVKNLIAEENKKNLHLRVFVTGGGCSGFQYGFKLDDIA-EDDDTVLKENDV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V IDS S+ Y+ G+ +D+      S FV  NPN  + CGCG S  I
Sbjct: 69  SVLIDSLSIQYLFGSTLDYVENLEGSKFVIENPNATTTCGCGASFSI 115


>gi|330505228|ref|YP_004382097.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas mendocina
           NK-01]
 gi|328919514|gb|AEB60345.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas mendocina
           NK-01]
          Length = 116

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 59/107 (55%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+ A  ++K +V         +R+ +  GGC+G +Y      ++  + D ++E++GV
Sbjct: 11  LHFTQGAASKVKNLVDEEGNPRLKLRVFVTGGGCSGFQYGFTFD-EDVAEDDTIVEREGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D+ S  Y++G+E+D++     S FV  NPN  + CGCG S  I
Sbjct: 70  SLVVDAMSFQYLVGSEVDYQEGLEGSRFVIKNPNATTTCGCGSSFSI 116


>gi|301155746|emb|CBW15214.1| FeS cluster assembly protein [Haemophilus parainfluenzae T3T1]
          Length = 107

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 45/111 (40%), Positives = 70/111 (63%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  +T+TE A  R++  + N +GK  G+R+ +K  GC+GL Y+++ V     D D + E
Sbjct: 1   MS--ITLTEKAAERVRTFLEN-RGKGIGLRLGVKTSGCSGLGYVLEFVDVL-NDDDLVFE 56

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GVKV +D  SL+Y+ G E+D+  E L  GF ++NPN   +CGCG+S  +
Sbjct: 57  QHGVKVIVDPKSLVYLDGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV 107


>gi|183600080|ref|ZP_02961573.1| hypothetical protein PROSTU_03613 [Providencia stuartii ATCC 25827]
 gi|188022366|gb|EDU60406.1| hypothetical protein PROSTU_03613 [Providencia stuartii ATCC 25827]
          Length = 114

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K++V         +R+ +  GGC+G +Y      D   DGD  IEK GV
Sbjct: 9   LQFTDAAAIKVKDLVSEEDNPNLRLRVYITGGGCSGFQYGFTFD-DQINDGDMTIEKQGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  S CGCG S  I
Sbjct: 68  ALVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI 114


>gi|146308944|ref|YP_001189409.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas mendocina
           ymp]
 gi|166919626|sp|A4XZB1|ERPA_PSEMY RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|145577145|gb|ABP86677.1| iron-sulfur cluster assembly accessory protein [Pseudomonas
           mendocina ymp]
          Length = 116

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 59/107 (55%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+ A  ++K +V         +R+ +  GGC+G +Y      ++  + D ++E++GV
Sbjct: 11  LHFTQGAASKVKTLVDEEGNPRLKLRVFVTGGGCSGFQYGFTFD-EDVAEDDTIVEREGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D+ S  Y++G+E+D++     S FV  NPN  + CGCG S  I
Sbjct: 70  SLVVDAMSFQYLVGSEVDYQEGLEGSRFVIKNPNATTTCGCGSSFSI 116


>gi|259907532|ref|YP_002647888.1| HesB/YadR/YfhF family protein [Erwinia pyrifoliae Ep1/96]
 gi|292489238|ref|YP_003532125.1| hypothetical protein EAMY_2770 [Erwinia amylovora CFBP1430]
 gi|292898530|ref|YP_003537899.1| iron-sulphur cluster biosynthesis protein [Erwinia amylovora ATCC
           49946]
 gi|224963154|emb|CAX54638.1| HesB/YadR/YfhF family protein [Erwinia pyrifoliae Ep1/96]
 gi|283477372|emb|CAY73288.1| Uncharacterized protein HI1723 [Erwinia pyrifoliae DSM 12163]
 gi|291198378|emb|CBJ45485.1| putative iron-sulphur cluster biosynthesis protein [Erwinia
           amylovora ATCC 49946]
 gi|291554672|emb|CBA22377.1| Uncharacterized protein HI1723 [Erwinia amylovora CFBP1430]
 gi|310764959|gb|ADP09909.1| HesB/YadR/YfhF family protein [Erwinia sp. Ejp617]
 gi|312173399|emb|CBX81653.1| Uncharacterized protein HI1723 [Erwinia amylovora ATCC BAA-2158]
          Length = 114

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++ +       +R+ +  GGC+G +Y              +  K GV
Sbjct: 9   LQFTDAAASKVKNLISDENNPDLKLRVYITGGGCSGFQYGFTFDDKINEGDMTIE-KSGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  + CGCG S  I
Sbjct: 68  ALVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSI 114


>gi|238022338|ref|ZP_04602764.1| hypothetical protein GCWU000324_02245 [Kingella oralis ATCC 51147]
 gi|237866952|gb|EEP67994.1| hypothetical protein GCWU000324_02245 [Kingella oralis ATCC 51147]
          Length = 106

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 45/108 (41%), Positives = 71/108 (65%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE AV +I++ + N +GK +GIRI +K  GC+G+ Y ++ V +   +      +DG
Sbjct: 1   MITITENAVKQIRKFLTN-RGKGEGIRIGVKTSGCSGMAYTLEFVDEIQPEDQVFE-QDG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV+ID  S++Y+ GT++DF  E L  GF F NPN   +CGCG+S  +
Sbjct: 59  VKVFIDPKSMVYLDGTQVDFAKEGLQEGFKFENPNAKESCGCGESFHV 106


>gi|115524635|ref|YP_781546.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisA53]
 gi|115518582|gb|ABJ06566.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris BisA53]
          Length = 109

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 42/111 (37%), Positives = 66/111 (59%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+D VT++E A  RI EI+         +RIS++ GGC+G +Y  D V  +  + D +I 
Sbjct: 1   MTDNVTLSERAARRIGEILKGEGN-GAMLRISVEGGGCSGFQYKFD-VDRHQNNDDLVIA 58

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +D   V +DSAS+ ++ G E+DF  + + + F  +NPN  ++CGCG S  I
Sbjct: 59  RDAAVVLVDSASVPFLSGAEVDFVDDLIGASFRVNNPNATASCGCGTSFSI 109


>gi|291296653|ref|YP_003508051.1| iron-sulfur cluster assembly accessory protein [Meiothermus ruber
           DSM 1279]
 gi|290471612|gb|ADD29031.1| iron-sulfur cluster assembly accessory protein [Meiothermus ruber
           DSM 1279]
          Length = 130

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 34/112 (30%), Positives = 57/112 (50%), Gaps = 1/112 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++T  A  R KEI+         IR+ +K GGC+G +Y + +          +    G
Sbjct: 7   VLSITPLAAERAKEILHRYNKPDAAIRVFIKSGGCSGYQYGMAVDERELEGDTVVEM-HG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           V++ +D  SL  ++G+E+D+    +  GF  +NPN  S+CGCG S     A 
Sbjct: 66  VRLVVDRMSLPLLVGSEVDWVENLMGGGFSVNNPNATSSCGCGHSFRTDGAK 117


>gi|238920974|ref|YP_002934489.1| hypothetical protein NT01EI_3104 [Edwardsiella ictaluri 93-146]
 gi|259646276|sp|C5BAP7|ERPA_EDWI9 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|238870543|gb|ACR70254.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 114

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/111 (27%), Positives = 55/111 (49%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +  T+AA  ++K ++ +       +R+ +  GGC+G +Y              + +
Sbjct: 5   MAVPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDKVNDGDMTIEK 64

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GV + +D+ SL Y++G  +D+      S F+ +NPN  + CGCG S  I
Sbjct: 65  L-GVALVVDAMSLQYLVGGSVDYTEGLEGSRFIVNNPNAKTTCGCGSSFSI 114


>gi|53719897|ref|YP_108883.1| HesB family protein [Burkholderia pseudomallei K96243]
 gi|167739343|ref|ZP_02412117.1| HesB family protein [Burkholderia pseudomallei 14]
 gi|167816558|ref|ZP_02448238.1| HesB family protein [Burkholderia pseudomallei 91]
 gi|52210311|emb|CAH36290.1| HesB family protein [Burkholderia pseudomallei K96243]
          Length = 107

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYLA-RRGKGLGLRLGVRTTGCSGLAYKLEYVDEL-TPEDQMFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVFVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|262281572|ref|ZP_06059351.1| iron-sulfur cluster insertion protein erpA [Acinetobacter
           calcoaceticus RUH2202]
 gi|299768261|ref|YP_003730287.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter sp. DR1]
 gi|262257031|gb|EEY75770.1| iron-sulfur cluster insertion protein erpA [Acinetobacter
           calcoaceticus RUH2202]
 gi|298698349|gb|ADI88914.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter sp. DR1]
          Length = 111

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/112 (26%), Positives = 56/112 (50%), Gaps = 2/112 (1%)

Query: 1   MS-DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M+   + +T+ A  +++++  +       +R+ +  GGC+G  Y  +       D  + +
Sbjct: 1   MNAQALVLTDNAANKVRQLRDSEGNDDLMLRVYVTGGGCSGFSYGFNFAESVNEDDAEFV 60

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             D VK+ +DS S  Y++G+ +D+      S F+  NPN  + CGCG S  I
Sbjct: 61  NGD-VKMLVDSLSYQYLIGSVVDYVEGLEGSRFIIQNPNATTTCGCGSSFSI 111


>gi|332525029|ref|ZP_08401210.1| iron-sulfur cluster assembly accessory protein [Rubrivivax
           benzoatilyticus JA2]
 gi|332108319|gb|EGJ09543.1| iron-sulfur cluster assembly accessory protein [Rubrivivax
           benzoatilyticus JA2]
          Length = 136

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              + +++A V ++ E++      +  +RI +  GGC+G +Y      +   D   +  +
Sbjct: 28  EQPIRISDAVVAKVSELLAEEGDPSLQLRIYVTGGGCSGFQYGFAFDDEVKEDDVRVARE 87

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             + V +D+ SL Y++G EID++     + FV  NPN  S CGCG S  +
Sbjct: 88  P-ITVVVDAMSLQYLVGAEIDYEDRLDGARFVIRNPNATSTCGCGSSFSV 136


>gi|53802540|ref|YP_112784.1| HesB/YadR/YfhF family protein [Methylococcus capsulatus str. Bath]
 gi|53756301|gb|AAU90592.1| HesB/YadR/YfhF family protein [Methylococcus capsulatus str. Bath]
          Length = 107

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+ A  ++++ +  ++G   G+R+++K  GC+GL Y ++ V +     D   E  GV
Sbjct: 3   VTLTQKAAAQVQKHLA-ARGTGVGLRVAVKTSGCSGLAYALEFVDEP-APEDQRFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  SL+Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  TVLVDPKSLVYLEGTELDFVREGLNEGFKFNNPNVKNECGCGESFNV 107


>gi|328543976|ref|YP_004304085.1| HesB-like protein [polymorphum gilvum SL003B-26A1]
 gi|326413720|gb|ADZ70783.1| HesB-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 125

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 53/113 (46%), Positives = 85/113 (75%), Gaps = 1/113 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++T+T+AA  R+++++ N+     G+R+ +KKGGCAG+EY + LV +     DD+I+  
Sbjct: 8   QVMTLTKAAAERVRDLIDNADRAVLGLRVGIKKGGCAGMEYTMSLV-EQADPRDDVIDDQ 66

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           G ++++D +++L++LGTE+DF+T K  SGFVF NPN+VSACGCG+SV +K AD
Sbjct: 67  GARIYVDPSAVLFLLGTEMDFETTKFRSGFVFRNPNEVSACGCGESVSLKPAD 119


>gi|332283996|ref|YP_004415907.1| hypothetical protein PT7_0743 [Pusillimonas sp. T7-7]
 gi|330427949|gb|AEC19283.1| hypothetical protein PT7_0743 [Pusillimonas sp. T7-7]
          Length = 107

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+ A   I   +   +GK  G+R+++K  GC+GL Y ++ V +   +     +  GV
Sbjct: 3   ITLTQQAADHINRYIEK-RGKGLGLRLAVKTTGCSGLAYKLEYVDEPNPEDLLCEQL-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+ID  SL ++ GT++D+  E L  GF F NPN+ ++CGCG+S  +
Sbjct: 61  RVYIDQKSLPFVDGTQLDYAREGLNEGFKFSNPNEKASCGCGESFTV 107


>gi|229592923|ref|YP_002875042.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas fluorescens
           SBW25]
 gi|312963387|ref|ZP_07777869.1| iron-sulfur cluster insertion protein [Pseudomonas fluorescens WH6]
 gi|259646278|sp|C3K2Z6|ERPA_PSEFS RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|229364789|emb|CAY52799.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
 gi|311282193|gb|EFQ60792.1| iron-sulfur cluster insertion protein [Pseudomonas fluorescens WH6]
          Length = 116

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T  A +++K +V         +R+ +  GGC+G +Y      ++  D D ++E++GV
Sbjct: 11  LQFTHGAAHKVKSLVDEEGNDRLKLRVFVTGGGCSGFQYGFTFD-EDVADDDTIVEREGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S  Y+ G E+D++     S FV  NPN  + CGCG S  I
Sbjct: 70  SLVVDPMSFQYLAGAEVDYQEGLEGSRFVIKNPNATTTCGCGSSFSI 116


>gi|253988306|ref|YP_003039662.1| hypothetical protein PAU_00825 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253779756|emb|CAQ82917.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 115

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 32/111 (28%), Positives = 55/111 (49%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +  T+AA  ++K +V + +     +R+ +  GGC+G +Y              +  
Sbjct: 6   MALPLQFTDAAANKVKILVSDEENPNLRLRVYITGGGCSGFQYGFTFDDQINEGDMTIE- 64

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV++ +D  SL Y++G  +D+      S F+  NPN  + CGCG S  I
Sbjct: 65  KQGVELVVDPMSLQYLVGGCVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSI 115


>gi|57335889|emb|CAH25346.1| Fe-S assembly protein 1 [Guillardia theta]
          Length = 237

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 66/110 (60%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T+TE A  R+ E++ +      G+R+ ++  GC GL Y ++ V + P   D +   
Sbjct: 128 KAVLTLTERAKERLAELMASKSPSPAGVRLGVRTRGCNGLSYTMNYVDEPPKLDDVVEAG 187

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           D +KV++D  +++Y+LG+ +DF  + + + FVF NPN   +CGCG+S  +
Sbjct: 188 DNIKVYVDPKAVMYLLGSVMDFVEDTVRAEFVFQNPNAKGSCGCGESFNV 237


>gi|241760165|ref|ZP_04758263.1| iron-sulfur cluster assembly protein IscA [Neisseria flavescens
           SK114]
 gi|319638123|ref|ZP_07992886.1| HesB/YadR/YfhF family protein [Neisseria mucosa C102]
 gi|241319619|gb|EER56049.1| iron-sulfur cluster assembly protein IscA [Neisseria flavescens
           SK114]
 gi|317400396|gb|EFV81054.1| HesB/YadR/YfhF family protein [Neisseria mucosa C102]
          Length = 106

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A   I   +   +GK  G+R+ +K  GC+G+ Y ++ V +   D      + G
Sbjct: 1   MITITENAAKHINSYLTK-RGKGLGVRLGVKTSGCSGMAYNLEFVDEVNEDDLIFE-EHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +V+ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 59  ARVYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|161528811|ref|YP_001582637.1| iron-sulfur cluster assembly accessory protein [Nitrosopumilus
           maritimus SCM1]
 gi|160340112|gb|ABX13199.1| iron-sulfur cluster assembly accessory protein [Nitrosopumilus
           maritimus SCM1]
          Length = 116

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 61/108 (56%), Gaps = 1/108 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++T+TE A  +IKE +       + +R+ ++ GGC+GL Y +        + D ++E++
Sbjct: 8   KMITVTEKAAEKIKEFMKEEAESPEYLRVYVQGGGCSGLSYGMGFEKAP-EEDDIVMEEN 66

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           GVK+ +DS S+ ++ G  +D+    + SGF  +NPN   +C CG S  
Sbjct: 67  GVKLLVDSYSVDHLQGANVDYIESLMGSGFKINNPNVTKSCSCGHSFS 114


>gi|145297861|ref|YP_001140702.1| iron-sulfur cluster insertion protein ErpA [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|160380681|sp|A4SJ82|ERPA_AERS4 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|142850633|gb|ABO88954.1| HesB family protein [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 116

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + MT+AA  ++K ++   +     +R+ +  GGC+G +Y              +  K GV
Sbjct: 11  IQMTDAAANKVKNLITEEENPELKLRVYITGGGCSGFQYGFTFDEKINEGDTVVE-KSGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + ID  SL Y++G  +D+      S F   NPN  + CGCG S  I
Sbjct: 70  TMVIDPMSLQYLVGGSVDYTEGLEGSRFTVTNPNASTTCGCGSSFSI 116


>gi|77361174|ref|YP_340749.1| HesB/YadR/YfhF protein [Pseudoalteromonas haloplanktis TAC125]
 gi|123588429|sp|Q3IHQ0|ERPA_PSEHT RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|76876085|emb|CAI87307.1| putative HesB/YadR/YfhF family protein [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 112

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  R+K+++   +     +R+ +  GGC+G +Y             +++ K+GV
Sbjct: 7   IKFTDAAADRVKQLIDEEENPELKLRVYVTGGGCSGFQYGFTFDEKANPGDLEIV-KNGV 65

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++  E+D+      + F   NP+  + CGCG S  I
Sbjct: 66  MLVVDPMSLQYLVDGEVDYTEGLEGARFFVTNPHATTTCGCGSSFTI 112


>gi|298346931|ref|YP_003719618.1| HesB family protein [Mobiluncus curtisii ATCC 43063]
 gi|304389358|ref|ZP_07371323.1| HesB family protein [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315655478|ref|ZP_07908377.1| HesB/YadR/YfhF family protein [Mobiluncus curtisii ATCC 51333]
 gi|298236992|gb|ADI68124.1| HesB family protein [Mobiluncus curtisii ATCC 43063]
 gi|304327476|gb|EFL94709.1| HesB family protein [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315490133|gb|EFU79759.1| HesB/YadR/YfhF family protein [Mobiluncus curtisii ATCC 51333]
          Length = 114

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+AAV +IK ++         +R+ +  GGC+GL Y ++   +   D       DGV
Sbjct: 10  VTLTDAAVAKIKSLLEQEGRDDLRLRVGVAPGGCSGLIYQLEFDDELSEDDAVRD-FDGV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           ++ +D  S+ Y+ G  +DF+     +GFV  NPN  + C CG S  
Sbjct: 69  ELVVDKMSVPYLAGATVDFQDTLAQTGFVIDNPNAANTCSCGGSFH 114


>gi|301093476|ref|XP_002997584.1| iron-sulfur cluster assembly protein, putative [Phytophthora
           infestans T30-4]
 gi|262110547|gb|EEY68599.1| iron-sulfur cluster assembly protein, putative [Phytophthora
           infestans T30-4]
          Length = 146

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 65/110 (59%), Gaps = 2/110 (1%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              + +T+AA  RIKE++ N    A GIR+ +K  GC GL Y ++         ++ + K
Sbjct: 39  PPPLNLTDAAAERIKELLANK-PDAIGIRLGVKTRGCNGLSYTMNYADKKEK-MEEEVSK 96

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +G +V+++  +L +++GT +DF+   + S FVF NPN   +CGCG+S  +
Sbjct: 97  NGARVFVEPKALFHVVGTTMDFQVTPVSSEFVFENPNAKGSCGCGESFNV 146


>gi|68248979|ref|YP_248091.1| hypothetical protein NTHI0496 [Haemophilus influenzae 86-028NP]
 gi|145628732|ref|ZP_01784532.1| co-chaperone HscB [Haemophilus influenzae 22.1-21]
 gi|145631829|ref|ZP_01787588.1| co-chaperone HscB [Haemophilus influenzae R3021]
 gi|145634628|ref|ZP_01790337.1| scaffold protein [Haemophilus influenzae PittAA]
 gi|145636356|ref|ZP_01792025.1| scaffold protein [Haemophilus influenzae PittHH]
 gi|145638715|ref|ZP_01794324.1| scaffold protein [Haemophilus influenzae PittII]
 gi|148825341|ref|YP_001290094.1| hypothetical protein CGSHiEE_01125 [Haemophilus influenzae PittEE]
 gi|148827515|ref|YP_001292268.1| hypothetical protein CGSHiGG_04690 [Haemophilus influenzae PittGG]
 gi|229846463|ref|ZP_04466571.1| hypothetical protein CGSHi7P49H1_07320 [Haemophilus influenzae
           7P49H1]
 gi|260582532|ref|ZP_05850322.1| iron-sulfur cluster assembly protein IscA [Haemophilus influenzae
           NT127]
 gi|68057178|gb|AAX87431.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP]
 gi|144979202|gb|EDJ88888.1| co-chaperone HscB [Haemophilus influenzae 22.1-21]
 gi|144982548|gb|EDJ90102.1| co-chaperone HscB [Haemophilus influenzae R3021]
 gi|145268173|gb|EDK08168.1| scaffold protein [Haemophilus influenzae PittAA]
 gi|145270521|gb|EDK10455.1| scaffold protein [Haemophilus influenzae PittHH]
 gi|145272310|gb|EDK12218.1| scaffold protein [Haemophilus influenzae PittII]
 gi|148715501|gb|ABQ97711.1| scaffold protein [Haemophilus influenzae PittEE]
 gi|148718757|gb|ABQ99884.1| hypothetical protein CGSHiGG_04690 [Haemophilus influenzae PittGG]
 gi|229810556|gb|EEP46274.1| hypothetical protein CGSHi7P49H1_07320 [Haemophilus influenzae
           7P49H1]
 gi|260094343|gb|EEW78241.1| iron-sulfur cluster assembly protein IscA [Haemophilus influenzae
           NT127]
 gi|301169078|emb|CBW28675.1| FeS cluster assembly protein [Haemophilus influenzae 10810]
 gi|309750205|gb|ADO80189.1| iron-sulfur cluster assembly protein IscA [Haemophilus influenzae
           R2866]
 gi|309972465|gb|ADO95666.1| iron-sulfur cluster assembly protein IscA [Haemophilus influenzae
           R2846]
          Length = 107

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+K  + +++GK  G+R+ +K  GC+GL Y+++ V     +      + GV
Sbjct: 3   ITLTEKAAQRVKAFL-DNRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNSEDQVFE-QHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL+Y+ G E+D+  E L  GF ++NPN   +CGCG+S  +
Sbjct: 61  NIIVDPKSLVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV 107


>gi|260771828|ref|ZP_05880746.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio metschnikovii CIP 69.14]
 gi|260613120|gb|EEX38321.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio metschnikovii CIP 69.14]
          Length = 113

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 55/114 (48%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   +T ++AA  R++ ++   +     +R+ +  GGC+G +Y              
Sbjct: 1   MSEVNVPLTFSDAAATRVRTLIEEEENPQLKLRVYITGGGCSGFQYGFTFDESVNEGDTT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +    GV + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 61  IEN-SGVTLVVDPMSLQYLIGGVVDYTDGLDGSRFFINNPNATTTCGCGASFSV 113


>gi|315499754|ref|YP_004088557.1| iron-sulfur cluster assembly accessory protein [Asticcacaulis
           excentricus CB 48]
 gi|315417766|gb|ADU14406.1| iron-sulfur cluster assembly accessory protein [Asticcacaulis
           excentricus CB 48]
          Length = 132

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 74/111 (66%), Gaps = 1/111 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           IV++T+AA  ++K I+  +     G+R+ +K+GGCAG EY++          + + +K G
Sbjct: 18  IVSLTDAAAAQVKTIMSRADKPYVGLRVGVKQGGCAGQEYVLSYAEAADPLDEVVTDK-G 76

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           V + I+  ++LY++GT ID++T KL S FVF+NPN+  ACGCG+SV IK A
Sbjct: 77  VTILIEPKAVLYLVGTVIDYETTKLASKFVFNNPNETDACGCGESVTIKPA 127


>gi|297172366|gb|ADI23341.1| uncharacterized conserved protein [uncultured Oceanospirillales
           bacterium HF0770_27O18]
 gi|297172804|gb|ADI23768.1| uncharacterized conserved protein [uncultured Oceanospirillales
           bacterium HF4000_43P14]
          Length = 112

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +TE A  +++E+  +       +R+ +  GGCAG  Y          D   +  +D V
Sbjct: 7   IILTERAAAKVRELRDDEGNPELKLRVYITGGGCAGFSYGFTFDEAVNEDDTAVARED-V 65

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D+ S+ Y+ G+++D++   + S F+ +NPN  + CGCG S  +
Sbjct: 66  TLLVDAMSIQYLDGSQVDYEQGLMGSRFIVNNPNAATTCGCGSSFSV 112


>gi|229525279|ref|ZP_04414684.1| hypothetical protein VCA_002901 [Vibrio cholerae bv. albensis
           VL426]
 gi|229338860|gb|EEO03877.1| hypothetical protein VCA_002901 [Vibrio cholerae bv. albensis
           VL426]
          Length = 113

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   ++ ++AA  R+K ++   +  +  +R+ +  GGC+G +Y              
Sbjct: 1   MSEVNVPLSFSDAAAQRVKALIAEEENPSLMLRVYITGGGCSGFQYGFTFDETVNEGDTK 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +    GV + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 61  IEN-SGVILVVDPMSLQYLIGGVVDYTEGLEGSRFFINNPNATTTCGCGASFSV 113


>gi|229543326|ref|ZP_04432386.1| iron-sulfur cluster assembly accessory protein [Bacillus coagulans
           36D1]
 gi|229327746|gb|EEN93421.1| iron-sulfur cluster assembly accessory protein [Bacillus coagulans
           36D1]
          Length = 120

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 40/112 (35%), Positives = 67/112 (59%), Gaps = 1/112 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS+++ +TEAA ++IK+++  +  +    R+S+  GGC+GL Y + L  +   +GD + E
Sbjct: 1   MSEVIHLTEAAAFQIKDMMEQNDEQDAYFRVSVNGGGCSGLSYGLSLDHE-IKEGDAVGE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           + G+++ +D  S   + GT ID+K   L  GF   NPN +  CGCG S + K
Sbjct: 60  QHGIRILVDHESAPILTGTVIDYKQSLLGGGFTIDNPNAIVTCGCGSSFKTK 111


>gi|50083307|ref|YP_044817.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter sp. ADP1]
 gi|81394068|sp|Q6FG12|ERPA_ACIAD RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|49529283|emb|CAG66995.1| putative chaperone involved in Fe-S cluster assembly and activation
           (HesB-like) [Acinetobacter sp. ADP1]
          Length = 111

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 2/112 (1%)

Query: 1   MS-DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M+   + +T+ A  +++++  +   +   +R+ +  GGC+G  Y  +       D  + +
Sbjct: 1   MNAQALVITDNAAKKVRQLRDSEGNQDLMLRVYVTGGGCSGFSYGFNFADSPNEDDAEFV 60

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             D VK+ +DS S  Y++G+ +D+      S F+  NPN  + CGCG S  I
Sbjct: 61  NGD-VKMLVDSLSYQYLVGSVVDYIEGLEGSRFIIQNPNATTTCGCGSSFSI 111


>gi|46202563|ref|ZP_00052993.2| COG0316: Uncharacterized conserved protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 106

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA  R+K ++      + GIRI ++  GC+G+ Y ++   +     D+++E  GV
Sbjct: 1   MTITDAAAERVKVLLEKRGKPSVGIRIGVRSKGCSGMSYTLEYADEK-TQFDEILEDKGV 59

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V ID  + +++LGTE+DF  +K+ SGFVF NPN+   CGCG+S  +
Sbjct: 60  TVLIDPKANMFILGTEMDFVEDKMQSGFVFKNPNEKGRCGCGESFHV 106


>gi|258623085|ref|ZP_05718098.1| hesB family protein [Vibrio mimicus VM573]
 gi|258625582|ref|ZP_05720468.1| hesB family protein [Vibrio mimicus VM603]
 gi|258582135|gb|EEW06998.1| hesB family protein [Vibrio mimicus VM603]
 gi|258584698|gb|EEW09434.1| hesB family protein [Vibrio mimicus VM573]
          Length = 118

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 52/107 (48%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++ ++AA  R+K ++   +  +  +R+ +  GGC+G +Y              +    GV
Sbjct: 13  LSFSDAAAKRVKALIAEEENPSLMLRVYITGGGCSGFQYGFTFDETVNEGDTKIEN-SGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 72  VLVVDPMSLQYLIGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 118


>gi|226694524|sp|B4RWS2|ERPA_ALTMD RecName: Full=Iron--sulfur cluster insertion protein erpA
          Length = 116

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  ++AA  ++K +V   +     +R+ +  GGC+G +Y              +  KD V
Sbjct: 11  IEFSDAAAAKVKTLVSEEENPDLKLRVYVTGGGCSGFQYGFTFDEKVNEGDMTIE-KDSV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  + CGCG S  +
Sbjct: 70  TLVVDPMSLQYLVGGVVDYVDGLEGSRFLVQNPNATTTCGCGASFSV 116


>gi|126333881|ref|XP_001362457.1| PREDICTED: similar to HESB like domain containing 2, [Monodelphis
           domestica]
          Length = 129

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK ++ +   +  G+R+ ++  GC GL Y ++         ++++ +DG+
Sbjct: 25  LTLTPSAVNKIKHLLKDK-PENVGLRVGVRTRGCNGLSYTLEYTKTKGDSDEEVV-QDGI 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|220922155|ref|YP_002497456.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           nodulans ORS 2060]
 gi|219946761|gb|ACL57153.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           nodulans ORS 2060]
          Length = 108

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 61/111 (54%), Gaps = 3/111 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M++ +T+T  A  RI EI+  ++     +RIS+  GGC+G +Y  D+  D     D  +E
Sbjct: 1   MTE-ITLTPRAARRINEIM-GAEPPGSMLRISVNGGGCSGFQYAFDIARDR-AGDDIAVE 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +DG  V +D  SL YM G+ IDF  + +   F   NP   ++CGCG S  +
Sbjct: 58  RDGATVLVDPLSLEYMRGSTIDFVNDLIGQSFKIENPQATASCGCGTSFSL 108


>gi|154253695|ref|YP_001414519.1| iron-sulfur cluster assembly accessory protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154157645|gb|ABS64862.1| iron-sulfur cluster assembly accessory protein [Parvibaculum
           lavamentivorans DS-1]
          Length = 119

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 76/115 (66%), Gaps = 1/115 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              +T+TE A  R+KEI+  S GK  G+RI +K GGCAG+EY ++   D     + + ++
Sbjct: 6   PKAITLTEIAAARMKEIMAASSGKYIGVRIGVKNGGCAGMEYTMEYAEDVKPLDEVVEDR 65

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           D VK+ ID  ++L++LGTE+D+  EK  +GF F+NPNQ  ACGCG+SV I  A L
Sbjct: 66  D-VKILIDPKAILFLLGTEMDYSEEKFSAGFRFNNPNQTDACGCGESVSITPATL 119


>gi|15604345|ref|NP_220861.1| HESB protein (hesB2) [Rickettsia prowazekii str. Madrid E]
 gi|6647953|sp|Q9ZD62|Y484_RICPR RecName: Full=Uncharacterized protein RP484
 gi|3861037|emb|CAA14937.1| HESB PROTEIN (hesB2) [Rickettsia prowazekii]
 gi|292572099|gb|ADE30014.1| Iron-sulfur cluster assembly accessory protein [Rickettsia
           prowazekii Rp22]
          Length = 110

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 69/111 (62%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T+AA  ++K ++        GIR+ +K GGCAG  Y V+   +     D+++E
Sbjct: 1   MKNVISLTDAAAKQVKLLIEKRAKPTFGIRVGIKSGGCAGQTYYVEYADNK-NQFDEVVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GV++ ID  +L+Y+LG+E+D+      S F F NPN+ + CGCG+S  +
Sbjct: 60  EKGVRILIDPKTLMYILGSEMDYVETNFKSQFTFTNPNEKANCGCGKSFSV 110


>gi|262377669|ref|ZP_06070889.1| iron-sulfur cluster assembly protein IscA [Acinetobacter lwoffii
           SH145]
 gi|262307428|gb|EEY88571.1| iron-sulfur cluster assembly protein IscA [Acinetobacter lwoffii
           SH145]
          Length = 111

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 32/112 (28%), Positives = 56/112 (50%), Gaps = 2/112 (1%)

Query: 1   MS-DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M+   + +T+ A  +++++  +   +   +R+ +  GGC+G  Y  +       D  +  
Sbjct: 1   MNAQALVLTDNAANKVRQLRDSEGNQDLMLRVYVTGGGCSGFSYGFNFAESQNEDDAEFA 60

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             D VKV +DS S  Y++G+ +D+      S FV  NPN  + CGCG S  I
Sbjct: 61  NGD-VKVLVDSLSYQYLVGSVVDYLEGLEGSRFVVQNPNATTTCGCGSSFSI 111


>gi|315656616|ref|ZP_07909503.1| HesB/YadR/YfhF family protein [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
 gi|315492571|gb|EFU82175.1| HesB/YadR/YfhF family protein [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
          Length = 114

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+AAV +IK ++         +R+ +  GGC+GL Y ++   +   D       DGV
Sbjct: 10  VTLTDAAVAKIKSLLEQEGRDDLRLRVGVAPGGCSGLIYQLEFDDELSEDDAVRD-FDGV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           ++ +D  S+ Y+ G  +DF+     +GFV  NPN  + C CG S  
Sbjct: 69  ELVVDKMSVPYLAGATVDFQDTLAQTGFVIDNPNAANTCSCGGSFH 114


>gi|269140119|ref|YP_003296820.1| iron-sulfur cluster insertion protein [Edwardsiella tarda EIB202]
 gi|267985780|gb|ACY85609.1| iron-sulfur cluster insertion protein [Edwardsiella tarda EIB202]
 gi|304559954|gb|ADM42618.1| essential respiratory protein A ErpA [Edwardsiella tarda FL6-60]
          Length = 114

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 54/111 (48%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +  T+AA  ++K ++ +       +R+ +  GGC+G +Y              +  
Sbjct: 5   MAVPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDKVNDGDMTIEN 64

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + G  + +D+ SL Y++G  +D+      S F+ +NPN  + CGCG S  I
Sbjct: 65  Q-GAALVVDAMSLQYLVGGAVDYTEGLEGSRFIVNNPNAKTTCGCGSSFSI 114


>gi|261420392|ref|YP_003254074.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           Y412MC61]
 gi|319768059|ref|YP_004133560.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           Y412MC52]
 gi|261376849|gb|ACX79592.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           Y412MC61]
 gi|317112925|gb|ADU95417.1| iron-sulfur cluster assembly accessory protein [Geobacillus sp.
           Y412MC52]
          Length = 121

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 60/106 (56%), Gaps = 1/106 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TEAA ++IK+++   + +   +R+ +  GGC+GL Y +    +   D  +   + G
Sbjct: 5   VIMLTEAAAFQIKDMMKEQEEEGAYLRVGVHGGGCSGLSYGMGFDHERRDDDIEFE-QHG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           +K+ +D  S   + GT ID+K   L  GF  +NPN ++ CGCG S 
Sbjct: 64  IKILVDRDSAPILRGTVIDYKQSLLGGGFTINNPNAIATCGCGSSF 109


>gi|325266615|ref|ZP_08133292.1| iron-sulfur cluster assembly protein IscA [Kingella denitrificans
           ATCC 33394]
 gi|324982058|gb|EGC17693.1| iron-sulfur cluster assembly protein IscA [Kingella denitrificans
           ATCC 33394]
          Length = 106

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 66/108 (61%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T  A   I+  +   +GK +GIRI +K  GC+G+ Y ++ V D   +      +DG
Sbjct: 1   MITITSNAADHIRNFIAK-RGKGEGIRIGVKTSGCSGMAYTLEFVDDIQPEDQVFE-QDG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ GT++D+  + L  GF F NPN   +CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLDGTQVDYAKDGLQEGFKFENPNVKESCGCGESFHV 106


>gi|121635087|ref|YP_975332.1| HesB-like protein [Neisseria meningitidis FAM18]
 gi|218768398|ref|YP_002342910.1| HesB-like protein [Neisseria meningitidis Z2491]
 gi|254805177|ref|YP_003083398.1| HesB/YadR/YfhF family protein [Neisseria meningitidis alpha14]
 gi|120866793|emb|CAM10546.1| HesB-like protein [Neisseria meningitidis FAM18]
 gi|121052406|emb|CAM08739.1| HesB-like protein [Neisseria meningitidis Z2491]
 gi|254668719|emb|CBA06517.1| HesB/YadR/YfhF family protein [Neisseria meningitidis alpha14]
 gi|254669833|emb|CBA04217.1| HesB family protein [Neisseria meningitidis alpha153]
 gi|254672260|emb|CBA05277.1| HesB family protein [Neisseria meningitidis alpha275]
 gi|261392345|emb|CAX49881.1| putative IscA-like protein [Neisseria meningitidis 8013]
 gi|319410645|emb|CBY91015.1| putative IscA-like protein [Neisseria meningitidis WUE 2594]
 gi|325128429|gb|EGC51310.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           N1568]
 gi|325132425|gb|EGC55118.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           M6190]
 gi|325134382|gb|EGC57027.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           M13399]
 gi|325136460|gb|EGC59066.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           M0579]
 gi|325138414|gb|EGC60982.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           ES14902]
 gi|325140400|gb|EGC62921.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           CU385]
 gi|325142585|gb|EGC64980.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           961-5945]
 gi|325144684|gb|EGC66982.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           M01-240013]
 gi|325198526|gb|ADY93982.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           G2136]
 gi|325199999|gb|ADY95454.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           H44/76]
 gi|325201908|gb|ADY97362.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           M01-240149]
 gi|325204375|gb|ADY99828.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           M01-240355]
 gi|325205852|gb|ADZ01305.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           M04-240196]
 gi|325208340|gb|ADZ03792.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           NZ-05/33]
          Length = 106

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V +   D        G
Sbjct: 1   MITLTENAAKHINDYLAK-RGKGLGVRLGVKTSGCSGMAYNLEFVDEADGDDLIFEG-HG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 59  ARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|39935536|ref|NP_947812.1| hypothetical protein RPA2470 [Rhodopseudomonas palustris CGA009]
 gi|192291127|ref|YP_001991732.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris TIE-1]
 gi|39649389|emb|CAE27911.1| Protein of unknown function, HesB/YadR/YfhF [Rhodopseudomonas
           palustris CGA009]
 gi|192284876|gb|ACF01257.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 123

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 49/115 (42%), Positives = 81/115 (70%), Gaps = 1/115 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++ +T+AA  R+KE++  +  +  G+R+ +K GGCAG  Y V+   D     D++IE 
Sbjct: 8   PQVMRLTDAAAGRVKELMVRADSEILGLRVGIKNGGCAGQSYTVEYAHD-IKPNDEVIED 66

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            GVK+ +D  ++L++LGTE+D+K +++ + FVF+NPNQ+SACGCG+SVE+K A +
Sbjct: 67  KGVKILVDPKAVLFLLGTEMDYKADRMQAQFVFNNPNQISACGCGESVELKPASI 121


>gi|238754492|ref|ZP_04615847.1| Iron-sulfur cluster insertion protein erpA [Yersinia ruckeri ATCC
           29473]
 gi|238707321|gb|EEP99683.1| Iron-sulfur cluster insertion protein erpA [Yersinia ruckeri ATCC
           29473]
          Length = 114

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 59/107 (55%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TEAA  ++K ++ + +     +R+ +  GGC+G +Y      D   DGD  IEK+GV
Sbjct: 9   LQFTEAAAKKVKLLISDEENPNMKLRVYITGGGCSGFQYGFTFD-DQVNDGDMTIEKEGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G  +D+      S F+  NPN  S CGCG S  I
Sbjct: 68  ELVVDPMSLQYLVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI 114


>gi|315122404|ref|YP_004062893.1| FeS assembly scaffold SufA [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495806|gb|ADR52405.1| FeS assembly scaffold SufA [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 129

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 91/115 (79%), Positives = 102/115 (88%), Gaps = 1/115 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           +D+VTMTEAAV R+K+IV NSQG AQGIRISLKKGGCAGLEYMVDLVT+   + D +  K
Sbjct: 4   NDVVTMTEAAVSRVKDIVKNSQGTAQGIRISLKKGGCAGLEYMVDLVTEPFNEDDLVE-K 62

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           DGVKVWID ++LLY+LG EIDFK EKL+SGFVFHNPNQVSACGCGQSVEIKRADL
Sbjct: 63  DGVKVWIDPSALLYILGMEIDFKIEKLHSGFVFHNPNQVSACGCGQSVEIKRADL 117


>gi|118575337|ref|YP_875080.1| hypothetical protein CENSYa_0131 [Cenarchaeum symbiosum A]
 gi|118193858|gb|ABK76776.1| conserved hypothetical protein [Cenarchaeum symbiosum A]
          Length = 116

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 62/109 (56%), Gaps = 1/109 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           + +VT+TE A  +IKE +     ++Q +R+ ++ GGC+GL Y +        + D +IE+
Sbjct: 7   TKMVTVTEKAAAKIKEFMSEEGEQSQYLRVYVQGGGCSGLSYGMGFEKTA-EEDDTVIEE 65

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            GVK+ +DS S  ++ G  +D+    + SGF  +NPN   +C CG S  
Sbjct: 66  SGVKLLVDSYSQDHLNGASVDYIESLMGSGFKINNPNVTKSCSCGHSFS 114


>gi|114799698|ref|YP_760749.1| iron-sulfur cluster assembly accessory protein [Hyphomonas
           neptunium ATCC 15444]
 gi|114739872|gb|ABI77997.1| iron-sulfur cluster assembly accessory protein [Hyphomonas
           neptunium ATCC 15444]
          Length = 113

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 58/107 (54%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T +A  RI  I+    G A  +R+S++ GGC+G  Y  D       D   +   DG 
Sbjct: 9   VTLTASAAKRINAILAKQDG-AAYLRVSVEGGGCSGFSYKFDFAPAVNADDVVIER-DGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V ID  SL ++ G+EIDF TE + + F   NPN  +ACGCG S  +
Sbjct: 67  SVLIDEMSLEFLQGSEIDFSTELIGAAFKIKNPNATAACGCGTSFSV 113


>gi|326423867|ref|NP_760568.2| putative iron binding protein [Vibrio vulnificus CMCP6]
 gi|319999240|gb|AAO10095.2| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio vulnificus CMCP6]
          Length = 113

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSDI   ++ ++AA  R+K ++   +  A  +R+ +  GGC+G +Y              
Sbjct: 1   MSDINLPLSFSDAAAARVKMLIAEEENPALKLRVYITGGGCSGFQYGFTFDESVNEGDTT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +    GV + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 61  IEN-SGVTLVVDPMSLQYLIGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|316985423|gb|EFV64371.1| iron-sulfur cluster insertion protein erpA [Neisseria meningitidis
           H44/76]
          Length = 157

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  T++   ++ +++         +R+ +  GGC+G +Y      +   D D  
Sbjct: 46  MSDESPIIFTDSCCAKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFD-EIKNDDDFE 104

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           IEK+G+   +D  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 105 IEKNGLVFLVDPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV 157


>gi|325983355|ref|YP_004295757.1| iron-sulfur cluster assembly accessory protein [Nitrosomonas sp.
           AL212]
 gi|325532874|gb|ADZ27595.1| iron-sulfur cluster assembly accessory protein [Nitrosomonas sp.
           AL212]
          Length = 114

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T TE A  ++K+++         +R+ +  GGC+G +Y          D   +   +GV
Sbjct: 9   LTFTENAASKVKQLIEEEGNDHLNLRVFISGGGCSGFQYGFTFDESISEDDTVMER-NGV 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  S  Y++G EID++     + F+  NP   S CGCG S  +
Sbjct: 68  KLLVDPMSFQYLIGAEIDYQENIQGAQFIIKNPGATSTCGCGSSFSV 114


>gi|311069710|ref|YP_003974633.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           atrophaeus 1942]
 gi|310870227|gb|ADP33702.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           atrophaeus 1942]
          Length = 120

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 61/109 (55%), Gaps = 1/109 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS+ VT+TEAA   IK+++   + +   +R+ +K GGC+GL Y +    +          
Sbjct: 1   MSNPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKGEQDSAFE- 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           + G+ V +D+ S+  M GT IDFK   +  GF   NPN +++CGCG S 
Sbjct: 60  QHGITVLVDNESMDIMNGTIIDFKQSMMGGGFTIDNPNAIASCGCGSSF 108


>gi|156975681|ref|YP_001446588.1| iron-sulfur cluster insertion protein ErpA [Vibrio harveyi ATCC
           BAA-1116]
 gi|156527275|gb|ABU72361.1| hypothetical protein VIBHAR_03416 [Vibrio harveyi ATCC BAA-1116]
          Length = 118

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++ ++AA  R+K ++   +  A  +R+ +  GGC+G +Y              ++   GV
Sbjct: 13  LSFSDAAASRVKALIAEEENPALKLRVYITGGGCSGFQYGFTFDERVNEGDTTIVN-SGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      + F  +NPN  + CGCG S  +
Sbjct: 72  TLVVDPMSLQYLIGGVVDYTEGLEGARFFVNNPNATTTCGCGASFSV 118


>gi|160387075|sp|A7MUU6|ERPA_VIBHB RecName: Full=Iron-sulfur cluster insertion protein erpA
          Length = 113

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 57/114 (50%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   ++ ++AA  R+K ++   +  A  +R+ +  GGC+G +Y              
Sbjct: 1   MSEVNVPLSFSDAAASRVKALIAEEENPALKLRVYITGGGCSGFQYGFTFDERVNEGDTT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++   GV + +D  SL Y++G  +D+      + F  +NPN  + CGCG S  +
Sbjct: 61  IVN-SGVTLVVDPMSLQYLIGGVVDYTEGLEGARFFVNNPNATTTCGCGASFSV 113


>gi|319775757|ref|YP_004138245.1| hypothetical protein HICON_11010 [Haemophilus influenzae F3047]
 gi|317450348|emb|CBY86564.1| conserved hypothetical protein [Haemophilus influenzae F3047]
          Length = 107

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+K  + +++GK  G+R+ +K  GC+GL Y+++ V     +      + GV
Sbjct: 3   ITLTEKAAQRVKAFL-DNRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNAEDQVFE-QHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL+Y+ G E+D+  E L  GF ++NPN   +CGCG+S  +
Sbjct: 61  NIIVDPKSLVYLNGIELDYVKEGLNEGFRYNNPNVKESCGCGESFHV 107


>gi|262172297|ref|ZP_06039975.1| HesB family protein [Vibrio mimicus MB-451]
 gi|261893373|gb|EEY39359.1| HesB family protein [Vibrio mimicus MB-451]
          Length = 113

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   ++ ++AA  R+K ++   +  +  +R+ +  GGC+G +Y              
Sbjct: 1   MSEVNVPLSFSDAAAKRVKALIAEEENPSLMLRVYITGGGCSGFQYGFTFDETVNEGDTK 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +    GV + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 61  IEN-SGVVLVVDPMSLQYLIGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|32034039|ref|ZP_00134283.1| COG0316: Uncharacterized conserved protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208405|ref|YP_001053630.1| iron-binding protein IscA [Actinobacillus pleuropneumoniae L20]
 gi|165976348|ref|YP_001651941.1| iron-binding protein [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|190150256|ref|YP_001968781.1| iron-binding protein IscA [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|303251400|ref|ZP_07337577.1| iron-binding protein [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|303252972|ref|ZP_07339127.1| iron-binding protein [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|307245840|ref|ZP_07527925.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307247916|ref|ZP_07529950.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|307250171|ref|ZP_07532130.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|307252554|ref|ZP_07534449.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307254813|ref|ZP_07536639.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307256982|ref|ZP_07538758.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307259255|ref|ZP_07540984.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307261416|ref|ZP_07543089.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307263594|ref|ZP_07545208.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|126097197|gb|ABN74025.1| iron-binding protein IscA [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|165876449|gb|ABY69497.1| iron-binding protein [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|189915387|gb|ACE61639.1| iron-binding protein IscA [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|302648163|gb|EFL78364.1| iron-binding protein [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|302649754|gb|EFL79933.1| iron-binding protein [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306853200|gb|EFM85420.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306855566|gb|EFM87735.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306857802|gb|EFM89899.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306859959|gb|EFM91977.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306862184|gb|EFM94152.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306864466|gb|EFM96373.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306866622|gb|EFM98481.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306868873|gb|EFN00677.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306871057|gb|EFN02787.1| Iron-binding protein iscA [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 107

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R++  + N +GK  G+R+ +K  GC+GL Y+++ V     D      + GV
Sbjct: 3   ITLTETAANRVRTFLEN-RGKGIGLRLGVKTSGCSGLAYVLEFVDVLNEDDHVFE-QHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF ++NPN   +CGCG+S  +
Sbjct: 61  KVIVDEKSLTYLDGTELDFVKEGLNEGFKYNNPNVKDSCGCGESFNV 107


>gi|114564140|ref|YP_751654.1| iron-sulfur cluster insertion protein ErpA [Shewanella
           frigidimarina NCIMB 400]
 gi|122299002|sp|Q07YU9|ERPA_SHEFN RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|114335433|gb|ABI72815.1| iron-sulfur cluster assembly accessory protein [Shewanella
           frigidimarina NCIMB 400]
          Length = 116

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++   Q     +R+ +  GGC+G +Y              +  K GV
Sbjct: 11  IQFTDAAAIKVKGLLEEEQNPELKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTIE-KQGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G E+D+ +    S F   NPN  + CGCG S  +
Sbjct: 70  QLVVDPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV 116


>gi|316934374|ref|YP_004109356.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris DX-1]
 gi|315602088|gb|ADU44623.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris DX-1]
          Length = 123

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 49/115 (42%), Positives = 81/115 (70%), Gaps = 1/115 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++ +T+AA  R+KE++  +  +  G+R+ +K GGCAG  Y V+   D     D++IE 
Sbjct: 8   PQVMRLTDAAAGRVKELMGRADSEILGLRVGIKNGGCAGQSYTVEYAHD-IKPNDEVIED 66

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            GVK+ +D  ++L++LGTE+D+K +++ + FVF+NPNQ+SACGCG+SVE+K A +
Sbjct: 67  KGVKILVDPKAVLFLLGTEMDYKADRMQAQFVFNNPNQISACGCGESVELKPASI 121


>gi|89095109|ref|ZP_01168035.1| HesB/YadR/YfhF protein [Oceanospirillum sp. MED92]
 gi|89080604|gb|EAR59850.1| HesB/YadR/YfhF protein [Oceanospirillum sp. MED92]
          Length = 118

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T +A  ++K ++   +  +  +R+ +  GGCAG  Y          D D +IE+DGV
Sbjct: 13  MAFTASAAAKVKSLIEEEENDSLKLRVFITGGGCAGFSYGFTFDESA-ADDDTVIERDGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S  Y++G+E+DFK     S FV +NPN  + CGCG S  I
Sbjct: 72  TMVVDPMSFQYLVGSEVDFKEGLQGSQFVINNPNATTTCGCGSSFSI 118


>gi|119502750|ref|ZP_01624835.1| hypothetical protein MGP2080_05577 [marine gamma proteobacterium
           HTCC2080]
 gi|119461096|gb|EAW42186.1| hypothetical protein MGP2080_05577 [marine gamma proteobacterium
           HTCC2080]
          Length = 117

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 63/110 (57%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            + + ++E AV ++ ++V +    A  +R+ +  GGC+G +Y      +   + D +IE+
Sbjct: 9   PNEIRLSENAVRKVSDLVTDEGNPALQLRVYITGGGCSGFQYGFTFD-EVRAEDDWVIER 67

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGV   +D+ S  Y++G+E+D+      + FV +NPN V+ CGCG S  I
Sbjct: 68  DGVVAVVDAMSYQYLVGSEVDYTEGLEGARFVVNNPNAVTTCGCGASFSI 117


>gi|150396676|ref|YP_001327143.1| FeS assembly scaffold SufA [Sinorhizobium medicae WSM419]
 gi|150028191|gb|ABR60308.1| FeS assembly scaffold SufA [Sinorhizobium medicae WSM419]
          Length = 130

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 62/113 (54%), Positives = 88/113 (77%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I+++T+AA  R++ IV N+ G+A+GIR+S+KKGGCAG+EY +DLVT+     D +   +G
Sbjct: 5   IMSLTDAAANRVRSIVENAGGEAKGIRVSIKKGGCAGMEYAIDLVTEPSSKDDLVEH-EG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            KVW+   ++LY+LGT++DF+T  L SGF F+NPNQ SACGCG+SVE+K ADL
Sbjct: 64  AKVWVAPEAVLYLLGTQMDFETTTLRSGFTFNNPNQTSACGCGESVELKPADL 116


>gi|169794217|ref|YP_001712010.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter baumannii
           AYE]
 gi|184159982|ref|YP_001848321.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter baumannii
           ACICU]
 gi|213155374|ref|YP_002317419.1| iron-sulfur cluster assembly accessory protein [Acinetobacter
           baumannii AB0057]
 gi|215481772|ref|YP_002323954.1| Hypothetical protein yadR [Acinetobacter baumannii AB307-0294]
 gi|239503899|ref|ZP_04663209.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter baumannii
           AB900]
 gi|260553761|ref|ZP_05826031.1| iron-sulfur cluster insertion protein erpA [Acinetobacter sp.
           RUH2624]
 gi|260558103|ref|ZP_05830314.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           ATCC 19606]
 gi|301347695|ref|ZP_07228436.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter baumannii
           AB056]
 gi|301512844|ref|ZP_07238081.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter baumannii
           AB058]
 gi|301597544|ref|ZP_07242552.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter baumannii
           AB059]
 gi|332854723|ref|ZP_08435510.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter baumannii
           6013150]
 gi|332867410|ref|ZP_08437588.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter baumannii
           6013113]
 gi|332873317|ref|ZP_08441272.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter baumannii
           6014059]
 gi|160380689|sp|A3M0R4|ERPA_ACIBT RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|226736756|sp|B0VAE9|ERPA_ACIBY RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226741413|sp|B7GUY5|ERPA_ACIB3 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226741414|sp|B7IAZ8|ERPA_ACIB5 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|226741415|sp|B2I2I7|ERPA_ACIBC RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|169147144|emb|CAM85003.1| putative chaperone involved in Fe-S cluster assembly and activation
           (HesB-like) [Acinetobacter baumannii AYE]
 gi|183211576|gb|ACC58974.1| uncharacterized conserved protein [Acinetobacter baumannii ACICU]
 gi|193075931|gb|ABO10508.2| hypothetical protein A1S_0011 [Acinetobacter baumannii ATCC 17978]
 gi|213054534|gb|ACJ39436.1| iron-sulfur cluster assembly accessory protein [Acinetobacter
           baumannii AB0057]
 gi|213987335|gb|ACJ57634.1| Hypothetical protein yadR [Acinetobacter baumannii AB307-0294]
 gi|260405065|gb|EEW98565.1| iron-sulfur cluster insertion protein erpA [Acinetobacter sp.
           RUH2624]
 gi|260408457|gb|EEX01764.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           ATCC 19606]
 gi|322506184|gb|ADX01638.1| Iron-sulfur cluster insertion protein erpA [Acinetobacter baumannii
           1656-2]
 gi|323516060|gb|ADX90441.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332727880|gb|EGJ59282.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter baumannii
           6013150]
 gi|332734006|gb|EGJ65148.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter baumannii
           6013113]
 gi|332738523|gb|EGJ69395.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter baumannii
           6014059]
          Length = 111

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 30/112 (26%), Positives = 56/112 (50%), Gaps = 2/112 (1%)

Query: 1   MS-DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M+   + +T+ A  +++++  +       +R+ +  GGC+G  Y  +       D  + +
Sbjct: 1   MNAQALVLTDNAANKVRQLRDSEGNDDLMLRVYVTGGGCSGFSYGFNFAESVNEDDAEFV 60

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             D VK+ +DS S  Y++G+ +D+      S F+  NPN  + CGCG S  I
Sbjct: 61  NGD-VKMLVDSLSYQYLVGSVVDYVEGLEGSRFIVQNPNATTTCGCGSSFSI 111


>gi|297182710|gb|ADI18866.1| uncharacterized conserved protein [uncultured Pseudomonadales
           bacterium HF0010_05E14]
          Length = 118

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 60/110 (54%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T+TE AV +++++      +   +R+ +  GGC+G +Y          + D  I+K
Sbjct: 9   PSVLTITERAVEKVRDLKTEENNENIKLRVYVTGGGCSGFQYGFSFDEKKAAEDDTSIQK 68

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             + V +D+ S+ Y+ G+ +D++ + + S F   NPN V+ CGCG S  I
Sbjct: 69  GDITVLVDALSIQYLAGSVVDYEIDLMGSRFTVANPNAVTTCGCGASFSI 118


>gi|293611374|ref|ZP_06693670.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826246|gb|EFF84615.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325123505|gb|ADY83028.1| methionine aminopeptidase [Acinetobacter calcoaceticus PHEA-2]
          Length = 111

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 30/112 (26%), Positives = 56/112 (50%), Gaps = 2/112 (1%)

Query: 1   MS-DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M+   + +T+ A  +++++  +       +R+ +  GGC+G  Y  +       D  + +
Sbjct: 1   MNAQALVLTDNAANKVRQLRDSEGNDDLMLRVYVTGGGCSGFSYGFNFAESVNEDDAEFV 60

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             D VK+ +DS S  Y++G+ +D+      S F+  NPN  + CGCG S  I
Sbjct: 61  NGD-VKMLVDSLSYQYLIGSVVDYVEGLEGSRFIVQNPNATTTCGCGSSFSI 111


>gi|238750554|ref|ZP_04612054.1| Iron-sulfur cluster insertion protein erpA [Yersinia rohdei ATCC
           43380]
 gi|238761625|ref|ZP_04622600.1| Iron-sulfur cluster insertion protein erpA [Yersinia kristensenii
           ATCC 33638]
 gi|238700139|gb|EEP92881.1| Iron-sulfur cluster insertion protein erpA [Yersinia kristensenii
           ATCC 33638]
 gi|238711202|gb|EEQ03420.1| Iron-sulfur cluster insertion protein erpA [Yersinia rohdei ATCC
           43380]
          Length = 117

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 39/118 (33%), Positives = 60/118 (50%), Gaps = 8/118 (6%)

Query: 1   MSDI-------VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV 53
           M  +       +  TEAA  ++K ++ + +     +R+ +  GGC+G +Y      D   
Sbjct: 1   MMSMSDETVLPLQFTEAAAKKVKLLISDEENPNLKLRVYITGGGCSGFQYGFTFD-DQIN 59

Query: 54  DGDDLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGD  IEK GV++ +D  SL Y++G  +D+      S F+  NPN  S CGCG S  I
Sbjct: 60  DGDMTIEKQGVELVVDPMSLQYLVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI 117


>gi|37678941|ref|NP_933550.1| hypothetical protein VV0757 [Vibrio vulnificus YJ016]
 gi|37197683|dbj|BAC93521.1| uncharacterized conserved protein [Vibrio vulnificus YJ016]
          Length = 107

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T++A  R++  + +++GK  G+R+ +K  GC+G+ Y+++ V +   + +      GV
Sbjct: 3   VTLTDSAANRVRAFL-DNRGKGIGLRLGVKTTGCSGMAYVLEFVDELNEEDEVFEH-SGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GT++D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDKKSLVYLDGTQLDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|261856723|ref|YP_003264006.1| iron-sulfur cluster assembly accessory protein [Halothiobacillus
           neapolitanus c2]
 gi|261837192|gb|ACX96959.1| iron-sulfur cluster assembly accessory protein [Halothiobacillus
           neapolitanus c2]
          Length = 120

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 50/107 (46%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TE A  +++ ++         +R+ +  GGC+G +Y          D   +    GV
Sbjct: 15  LIFTENAANKVRSLIEEEGNPDLKLRVFITGGGCSGFQYGFMFEEAAQEDDAQVER-GGV 73

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S+ Y+ G EID+K +   + FV  NP   + CGCG S  I
Sbjct: 74  TLLVDPMSIQYLEGAEIDYKEDITGAQFVIRNPMASTTCGCGSSFSI 120


>gi|91976933|ref|YP_569592.1| FeS assembly scaffold SufA [Rhodopseudomonas palustris BisB5]
 gi|91683389|gb|ABE39691.1| FeS assembly scaffold SufA [Rhodopseudomonas palustris BisB5]
          Length = 134

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 50/115 (43%), Positives = 81/115 (70%), Gaps = 1/115 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++ +TEAA  R+K+++  +  +  G+R+ +K GGCAG  Y V+   D     D++IE 
Sbjct: 19  PQVMRLTEAAATRVKDLMSRADSEIVGLRVGIKNGGCAGQSYTVEYAHD-IKSNDEMIED 77

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            GVK+ ID  +++++LGTE+D+K+EK+ + FVF+NPNQ+SACGCG+SVE+  A +
Sbjct: 78  KGVKILIDPKAVMFLLGTEMDYKSEKMQAQFVFNNPNQISACGCGESVELVPAKI 132


>gi|288575701|ref|ZP_06393902.1| iron-sulfur cluster assembly protein IscA [Neisseria mucosa ATCC
           25996]
 gi|288567127|gb|EFC88687.1| iron-sulfur cluster assembly protein IscA [Neisseria mucosa ATCC
           25996]
          Length = 114

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 66/109 (60%), Gaps = 2/109 (1%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++T+TE A   I   +   +GK  G+R+ +K  GC+G+ Y ++ V +   D D + E+ 
Sbjct: 8   SMITITENAAKHINSYLTK-RGKGLGVRLGVKTSGCSGMAYNLEFVDEV-NDDDLIFEEH 65

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G +V+ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 66  GARVYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 114


>gi|330447449|ref|ZP_08311098.1| essential respiratory protein A [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491640|dbj|GAA05595.1| essential respiratory protein A [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 113

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 35/114 (30%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 1   MSD---IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSD    +T ++ A  ++K ++   +     +R+ +  GGC+G +Y      +   DGD 
Sbjct: 1   MSDANLPLTFSDVAANKVKTLIAEEENPDLKLRVYITGGGCSGFQYGFTFD-EKVNDGDM 59

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IE  GV + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 60  TIENSGVTLVVDPMSLQYLIGGTVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|15640647|ref|NP_230276.1| iron-sulfur cluster insertion protein ErpA [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121587960|ref|ZP_01677714.1| HesB/YadR/YfhF family protein [Vibrio cholerae 2740-80]
 gi|121728256|ref|ZP_01681288.1| HesB/YadR/YfhF family protein [Vibrio cholerae V52]
 gi|147673412|ref|YP_001216121.1| iron-sulfur cluster insertion protein ErpA [Vibrio cholerae O395]
 gi|153801749|ref|ZP_01956335.1| HesB/YadR/YfhF family protein [Vibrio cholerae MZO-3]
 gi|153818918|ref|ZP_01971585.1| HesB/YadR/YfhF family protein [Vibrio cholerae NCTC 8457]
 gi|153822993|ref|ZP_01975660.1| HesB/YadR/YfhF family protein [Vibrio cholerae B33]
 gi|153825702|ref|ZP_01978369.1| HesB/YadR/YfhF family protein [Vibrio cholerae MZO-2]
 gi|153829130|ref|ZP_01981797.1| HesB/YadR/YfhF family protein [Vibrio cholerae 623-39]
 gi|227080808|ref|YP_002809359.1| hesB family protein [Vibrio cholerae M66-2]
 gi|254226736|ref|ZP_04920312.1| HesB/YadR/YfhF family protein [Vibrio cholerae V51]
 gi|254291236|ref|ZP_04962031.1| HesB/YadR/YfhF family protein [Vibrio cholerae AM-19226]
 gi|254850861|ref|ZP_05240211.1| hesB family protein [Vibrio cholerae MO10]
 gi|255744156|ref|ZP_05418109.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio cholera CIRS 101]
 gi|262155730|ref|ZP_06028854.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio cholerae INDRE 91/1]
 gi|262169928|ref|ZP_06037618.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio cholerae RC27]
 gi|262191801|ref|ZP_06049973.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio cholerae CT 5369-93]
 gi|297580753|ref|ZP_06942679.1| HesB/YadR/YfhF family protein [Vibrio cholerae RC385]
 gi|298500743|ref|ZP_07010546.1| iron-sulfur cluster insertion protein ErpA [Vibrio cholerae MAK
           757]
 gi|81545371|sp|Q9KU96|ERPA_VIBCH RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|172047719|sp|A5F947|ERPA_VIBC3 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|254783678|sp|C3LSN2|ERPA_VIBCM RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|9655061|gb|AAF93793.1| hesB family protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121547807|gb|EAX57895.1| HesB/YadR/YfhF family protein [Vibrio cholerae 2740-80]
 gi|121629450|gb|EAX61877.1| HesB/YadR/YfhF family protein [Vibrio cholerae V52]
 gi|124122714|gb|EAY41457.1| HesB/YadR/YfhF family protein [Vibrio cholerae MZO-3]
 gi|125620753|gb|EAZ49111.1| HesB/YadR/YfhF family protein [Vibrio cholerae V51]
 gi|126510535|gb|EAZ73129.1| HesB/YadR/YfhF family protein [Vibrio cholerae NCTC 8457]
 gi|126519500|gb|EAZ76723.1| HesB/YadR/YfhF family protein [Vibrio cholerae B33]
 gi|146315295|gb|ABQ19834.1| HesB/YadR/YfhF family protein [Vibrio cholerae O395]
 gi|148875388|gb|EDL73523.1| HesB/YadR/YfhF family protein [Vibrio cholerae 623-39]
 gi|149740639|gb|EDM54748.1| HesB/YadR/YfhF family protein [Vibrio cholerae MZO-2]
 gi|150422800|gb|EDN14752.1| HesB/YadR/YfhF family protein [Vibrio cholerae AM-19226]
 gi|227008696|gb|ACP04908.1| hesB family protein [Vibrio cholerae M66-2]
 gi|227012452|gb|ACP08662.1| hesB family protein [Vibrio cholerae O395]
 gi|254846566|gb|EET24980.1| hesB family protein [Vibrio cholerae MO10]
 gi|255738096|gb|EET93488.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio cholera CIRS 101]
 gi|262021662|gb|EEY40373.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio cholerae RC27]
 gi|262030441|gb|EEY49081.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio cholerae INDRE 91/1]
 gi|262032335|gb|EEY50901.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio cholerae CT 5369-93]
 gi|297535169|gb|EFH74004.1| HesB/YadR/YfhF family protein [Vibrio cholerae RC385]
 gi|297540524|gb|EFH76582.1| iron-sulfur cluster insertion protein ErpA [Vibrio cholerae MAK
           757]
 gi|327483431|gb|AEA77838.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio cholerae LMA3894-4]
          Length = 113

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   ++ ++AA  R+K ++   +  +  +R+ +  GGC+G +Y              
Sbjct: 1   MSEVNVPLSFSDAAAKRVKALIAEEENPSLMLRVYITGGGCSGFQYGFTFDETVNEGDTK 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +    GV + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 61  IEN-SGVILVVDPMSLQYLIGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|330984019|gb|EGH82122.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas syringae
           pv. lachrymans str. M301315]
          Length = 136

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           SD+V ++ AA  ++   +         +R+ +  GGC+G +Y      +   + D +  +
Sbjct: 28  SDVVQISPAAAEKVASFLKEEGNPNLLLRVFVTGGGCSGFQYGFMFD-EQQNEDDSVYTQ 86

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            G+K+ IDS S  Y+ G  ++++     S F  +NPN  + CGCG S  +
Sbjct: 87  HGIKMAIDSMSYQYLAGATVEYEETVAGSRFSINNPNATTTCGCGSSFSV 136


>gi|269103473|ref|ZP_06156170.1| probable iron binding protein from the HesB_IscA_SufA family
           [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268163371|gb|EEZ41867.1| probable iron binding protein from the HesB_IscA_SufA family
           [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 113

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 50/107 (46%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  ++AA  R+K ++   +     +R+ +  GGC+G +Y              +    GV
Sbjct: 8   LNFSDAAASRVKTLIAEEENPDLKLRVYITGGGCSGFQYGFTFDEKVNEGDMVIENC-GV 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 67  TLVVDPMSLQYLIGGTVDYTDGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|253575297|ref|ZP_04852635.1| iron-sulfur cluster assembly accessory protein [Paenibacillus sp.
           oral taxon 786 str. D14]
 gi|251845294|gb|EES73304.1| iron-sulfur cluster assembly accessory protein [Paenibacillus sp.
           oral taxon 786 str. D14]
          Length = 118

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 38/112 (33%), Positives = 62/112 (55%), Gaps = 1/112 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ ++++A+ RIK+++   +     +R+ +  GGC+G  Y + L          +  K G
Sbjct: 1   MINISDSALARIKDMIAQEETPNMFLRVGVNPGGCSGFSYGMGLDDQESEQDVYMDIK-G 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           +KV +D  S+ Y+ G EIDFK   L  GF  HNPN ++ CGCGQS   K  +
Sbjct: 60  LKVVVDKDSIRYLNGLEIDFKESGLSGGFTIHNPNAIATCGCGQSFRFKDEE 111


>gi|260771191|ref|ZP_05880118.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio furnissii CIP 102972]
 gi|260613788|gb|EEX38980.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio furnissii CIP 102972]
          Length = 113

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 38/114 (33%), Positives = 61/114 (53%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSDI   ++ ++AA  R++ ++   +  A  +R+ +  GGC+G +Y      +N  DGD 
Sbjct: 1   MSDINVPLSFSDAAATRVRALIAEEENPALKLRVYITGGGCSGFQYGFTFD-ENVNDGDT 59

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IE  GV + +D  SL Y++G  +D+      S F   NPN  + CGCG S  +
Sbjct: 60  TIENSGVTLVVDPMSLQYLIGGVVDYTEGLEGSRFFVSNPNATTTCGCGASFSV 113


>gi|160386980|sp|Q7MHZ0|ERPA_VIBVY RecName: Full=Iron-sulfur cluster insertion protein erpA
          Length = 113

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSDI   ++ ++AA  R+K ++   +  A  +R+ +  GGC+G +Y              
Sbjct: 1   MSDINLPLSFSDAAATRVKMLIAEEENPALKLRVYITGGGCSGFQYGFTFDESVNEGDTT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +    GV + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 61  IEN-SGVTLVVDPMSLQYLIGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|262163959|ref|ZP_06031698.1| HesB family protein [Vibrio mimicus VM223]
 gi|262027487|gb|EEY46153.1| HesB family protein [Vibrio mimicus VM223]
          Length = 113

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   ++ ++AA  R+K ++   +  +  +R+ +  GGC+G +Y              
Sbjct: 1   MSEVNVPLSFSDAAAKRVKALIAEEENPSLMLRVYITGGGCSGFQYGFTFDETINEGDTK 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +    GV + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 61  IEN-SGVVLVVDPMSLQYLIGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|53723801|ref|YP_103326.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           ATCC 23344]
 gi|76810479|ref|YP_334117.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1710b]
 gi|83719700|ref|YP_442407.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           thailandensis E264]
 gi|121600391|ref|YP_993527.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei
           SAVP1]
 gi|124384395|ref|YP_001029046.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei NCTC
           10229]
 gi|126441573|ref|YP_001059623.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 668]
 gi|126448283|ref|YP_001081034.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei NCTC
           10247]
 gi|126452485|ref|YP_001066906.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1106a]
 gi|134277980|ref|ZP_01764695.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 305]
 gi|167000651|ref|ZP_02266462.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei
           PRL-20]
 gi|167581328|ref|ZP_02374202.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           thailandensis TXDOH]
 gi|167720351|ref|ZP_02403587.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei DM98]
 gi|167824953|ref|ZP_02456424.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 9]
 gi|167846471|ref|ZP_02471979.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei B7210]
 gi|167895049|ref|ZP_02482451.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 7894]
 gi|167903436|ref|ZP_02490641.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei NCTC 13177]
 gi|167911684|ref|ZP_02498775.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 112]
 gi|167919684|ref|ZP_02506775.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei BCC215]
 gi|217420992|ref|ZP_03452497.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 576]
 gi|226195463|ref|ZP_03791051.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei Pakistan 9]
 gi|237813017|ref|YP_002897468.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei MSHR346]
 gi|238561627|ref|ZP_00441748.2| iron-sulfur cluster assembly protein IscA [Burkholderia mallei GB8
           horse 4]
 gi|242317210|ref|ZP_04816226.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1106b]
 gi|254177525|ref|ZP_04884180.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei ATCC
           10399]
 gi|254184368|ref|ZP_04890958.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1655]
 gi|254191402|ref|ZP_04897906.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254195801|ref|ZP_04902227.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei S13]
 gi|254200284|ref|ZP_04906650.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei FMH]
 gi|254209360|ref|ZP_04915706.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei JHU]
 gi|254259198|ref|ZP_04950252.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1710a]
 gi|254297032|ref|ZP_04964485.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 406e]
 gi|254357969|ref|ZP_04974242.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei
           2002721280]
 gi|257138609|ref|ZP_05586871.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           thailandensis E264]
 gi|52427224|gb|AAU47817.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei
           ATCC 23344]
 gi|76579932|gb|ABA49407.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1710b]
 gi|83653525|gb|ABC37588.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           thailandensis E264]
 gi|121229201|gb|ABM51719.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei
           SAVP1]
 gi|124292415|gb|ABN01684.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei NCTC
           10229]
 gi|126221066|gb|ABN84572.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 668]
 gi|126226127|gb|ABN89667.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1106a]
 gi|126241153|gb|ABO04246.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei NCTC
           10247]
 gi|134251630|gb|EBA51709.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 305]
 gi|147749880|gb|EDK56954.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei FMH]
 gi|147750133|gb|EDK57204.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei JHU]
 gi|148027096|gb|EDK85117.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei
           2002721280]
 gi|157806842|gb|EDO84012.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 406e]
 gi|157939074|gb|EDO94744.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160698564|gb|EDP88534.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei ATCC
           10399]
 gi|169652546|gb|EDS85239.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei S13]
 gi|184214899|gb|EDU11942.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1655]
 gi|217396404|gb|EEC36421.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 576]
 gi|225932423|gb|EEH28422.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei Pakistan 9]
 gi|237506489|gb|ACQ98807.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei MSHR346]
 gi|238524235|gb|EEP87669.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei GB8
           horse 4]
 gi|242140449|gb|EES26851.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1106b]
 gi|243063459|gb|EES45645.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei
           PRL-20]
 gi|254217887|gb|EET07271.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           pseudomallei 1710a]
          Length = 107

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGLGLRLGVRTTGCSGLAYKLEYVDEL-TPEDQMFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVFVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|254418453|ref|ZP_05032177.1| hypothetical protein BBAL3_763 [Brevundimonas sp. BAL3]
 gi|196184630|gb|EDX79606.1| hypothetical protein BBAL3_763 [Brevundimonas sp. BAL3]
          Length = 129

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 74/113 (65%), Gaps = 1/113 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              VT+T+AA  R++EI+ N++    G+RI +K GGCAG EY      +     + + +K
Sbjct: 15  PKAVTLTDAAAERVREILDNAENDHIGLRIGVKNGGCAGQEYTFAYADEIGPLDEVVEDK 74

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            GV + I+  ++L+++GTEID++T +L S FVF+NPNQ  ACGCG+SV I  A
Sbjct: 75  -GVTILIEPKAVLFLIGTEIDYETTRLASKFVFNNPNQTDACGCGESVTIIPA 126


>gi|169632040|ref|YP_001705776.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter baumannii
           SDF]
 gi|226741416|sp|B0VML0|ERPA_ACIBS RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|169150832|emb|CAO99432.1| putative chaperone involved in Fe-S cluster assembly and activation
           (HesB-like) [Acinetobacter baumannii]
          Length = 111

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 30/112 (26%), Positives = 56/112 (50%), Gaps = 2/112 (1%)

Query: 1   MS-DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M+   + +T+ A  +++++  +       +R+ +  GGC+G  Y  +       D  + +
Sbjct: 1   MNAQALVLTDNAANKVRQLRDSEGNDDLMLRVYVTGGGCSGFSYGFNFAESINEDDAEFV 60

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             D VK+ +DS S  Y++G+ +D+      S F+  NPN  + CGCG S  I
Sbjct: 61  NGD-VKMLVDSLSYQYLVGSVVDYVEGLEGSRFIVQNPNATTTCGCGSSFSI 111


>gi|90417686|ref|ZP_01225598.1| iron-sulfur cluster assembly accessory protein [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337358|gb|EAS51009.1| iron-sulfur cluster assembly accessory protein [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 125

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 57/113 (50%), Positives = 83/113 (73%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +++MT+AA  R+K I  +    A G+R+ +KKGGCAG+EY +DL T+     +D+IEKDG
Sbjct: 6   VMSMTDAAAERVKAITSSKGEDALGLRVGIKKGGCAGMEYTIDLATEA-NPNEDMIEKDG 64

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            +V +   ++L++LGTE+D++   L SGF F NPNQ SACGCG+SVE+K+ADL
Sbjct: 65  ARVLVAPEAVLFLLGTEMDYEETVLRSGFTFRNPNQTSACGCGESVELKQADL 117


>gi|89095326|ref|ZP_01168244.1| Putative hesB family protein [Oceanospirillum sp. MED92]
 gi|89080401|gb|EAR59655.1| Putative hesB family protein [Oceanospirillum sp. MED92]
          Length = 108

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 62/107 (57%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT+AA   +   +        GIR+ ++  GC+G+ Y+++ V D   + +  +    V
Sbjct: 3   ITMTDAAASHVARYLETRGH-GAGIRLGVRTSGCSGMAYVLEFVDDVQDEDEIFVGPQDV 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SLLY+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 62  KIVIDPKSLLYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFNV 108


>gi|240949681|ref|ZP_04754016.1| hesB family protein [Actinobacillus minor NM305]
 gi|257465485|ref|ZP_05629856.1| hesB family protein [Actinobacillus minor 202]
 gi|240295939|gb|EER46615.1| hesB family protein [Actinobacillus minor NM305]
 gi|257451145|gb|EEV25188.1| hesB family protein [Actinobacillus minor 202]
          Length = 107

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA  R+K  + N +GK  G+R+ +K  GC+GL Y+++ V     D      + GV
Sbjct: 3   ITLTEAAANRVKTFLEN-RGKGIGLRLGVKTSGCSGLAYVLEFVDVLNEDDHVFE-QHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GT++DF  E L  GF + NPN  + CGCG+S  +
Sbjct: 61  KVIVDEKSLTYLDGTQLDFVKEGLNEGFKYTNPNVKNECGCGESFSV 107


>gi|221198429|ref|ZP_03571475.1| iron-sulfur cluster assembly protein IscA [Burkholderia multivorans
           CGD2M]
 gi|221208894|ref|ZP_03581891.1| iron-sulfur cluster assembly protein IscA [Burkholderia multivorans
           CGD2]
 gi|221214775|ref|ZP_03587744.1| iron-sulfur cluster assembly protein IscA [Burkholderia multivorans
           CGD1]
 gi|221165314|gb|EED97791.1| iron-sulfur cluster assembly protein IscA [Burkholderia multivorans
           CGD1]
 gi|221171177|gb|EEE03627.1| iron-sulfur cluster assembly protein IscA [Burkholderia multivorans
           CGD2]
 gi|221182361|gb|EEE14762.1| iron-sulfur cluster assembly protein IscA [Burkholderia multivorans
           CGD2M]
          Length = 117

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +     D + E  GV
Sbjct: 13  ITLTEKAAQHVQKYLV-RRGKGLGLRLGVRTTGCSGLAYKLEYVDEL-APEDQVFESHGV 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 71  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 117


>gi|37524896|ref|NP_928240.1| hypothetical protein plu0904 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|81420183|sp|Q7N843|ERPA_PHOLL RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|36784321|emb|CAE13199.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 115

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K +V + +     +R+ +  GGC+G +Y              +  K GV
Sbjct: 10  LQFTDAAANKVKILVSDEENPNLRLRVYITGGGCSGFQYGFTFDDQINEGDMTIE-KQGV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D  SL Y++G  +D+      S F+  NPN  + CGCG S  I
Sbjct: 69  ELVVDPMSLQYLVGGCVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSI 115


>gi|299133791|ref|ZP_07026985.1| iron-sulfur cluster assembly accessory protein [Afipia sp. 1NLS2]
 gi|298591627|gb|EFI51828.1| iron-sulfur cluster assembly accessory protein [Afipia sp. 1NLS2]
          Length = 135

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 47/115 (40%), Positives = 79/115 (68%), Gaps = 1/115 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++ +TEAA  R++E+   +  +  G+R+ +K GGCAG+EY V+   D     + + +K
Sbjct: 20  PQVMRLTEAAANRVRELSSRADSEIIGLRVGIKNGGCAGMEYTVEYAHDVRPTDEVVEDK 79

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            GVK+ +D  +++++LGTE+DFK +K+ + FVF+NPNQ SACGCG+SV++  A +
Sbjct: 80  -GVKILVDPKAVMFLLGTEMDFKVDKMAAQFVFNNPNQTSACGCGESVQLTPAKI 133


>gi|161524321|ref|YP_001579333.1| iron-sulfur cluster assembly protein IscA [Burkholderia multivorans
           ATCC 17616]
 gi|189350923|ref|YP_001946551.1| HesB-like protein [Burkholderia multivorans ATCC 17616]
 gi|160341750|gb|ABX14836.1| iron-sulfur cluster assembly protein IscA [Burkholderia multivorans
           ATCC 17616]
 gi|189334945|dbj|BAG44015.1| HesB-like protein [Burkholderia multivorans ATCC 17616]
          Length = 107

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYLV-RRGKGLGLRLGVRTTGCSGLAYKLEYVDEL-APEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|297180581|gb|ADI16792.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF0010_11K06]
          Length = 115

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +TE AV ++K ++     K   +R+ +  GGC+G +Y   L  +   D D ++ +D V
Sbjct: 10  LNITENAVLKVKNLIAEENKKNLHLRVFVTGGGCSGFQYGFKLDDNA-EDDDTVLIEDEV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V IDS S+ Y+ G+ +D+      S F+  NPN  + CGCG S  I
Sbjct: 69  SVLIDSLSIQYLFGSTLDYVENLEGSKFIIENPNATTTCGCGASFSI 115


>gi|167586744|ref|ZP_02379132.1| iron-sulfur cluster assembly protein IscA [Burkholderia ubonensis
           Bu]
          Length = 107

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYLV-RRGKGLGLRLGVRTTGCSGLAYKLEYVDDL-APEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|302039298|ref|YP_003799620.1| iron-sulfur cluster assembly protein IscA [Candidatus Nitrospira
           defluvii]
 gi|300607362|emb|CBK43695.1| Iron-sulfur cluster assembly protein IscA [Candidatus Nitrospira
           defluvii]
          Length = 119

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 65/108 (60%), Gaps = 1/108 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++T+++AA+  +K ++     +  G+R+ +K GGC+GL Y ++   +     D + E D
Sbjct: 12  PVITLSDAALKEVKRLINVQGIEEGGLRLGVKGGGCSGLSYTINFD-EKIGQYDQVYEFD 70

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           GVKV +D+ S +Y+ GT++DF+ + +   F F NPN    CGCG+S  
Sbjct: 71  GVKVIVDAKSAIYLQGTQLDFQKDLMGGNFKFVNPNANKTCGCGESFS 118


>gi|300312442|ref|YP_003776534.1| hypothetical protein Hsero_3142 [Herbaspirillum seropedicae SmR1]
 gi|300075227|gb|ADJ64626.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 107

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   I   +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAKHISRYM-ERRGKGIGLRLGVRTTGCSGLAYKLEYV-DEQSSEDTVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V++D  SL Y+ GTE+DF  E L  GF F NPN    CGCG+S  I
Sbjct: 61  RVFVDPKSLPYIDGTELDFAREGLNEGFKFQNPNVKDECGCGESFRI 107


>gi|288960180|ref|YP_003450520.1| iron-sulfur cluster assembly accessory protein [Azospirillum sp.
           B510]
 gi|288912488|dbj|BAI73976.1| iron-sulfur cluster assembly accessory protein [Azospirillum sp.
           B510]
          Length = 118

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 31/108 (28%), Positives = 55/108 (50%), Gaps = 1/108 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I+ ++E+A  R+  ++         +R+++  GGC+G +Y            D + EKDG
Sbjct: 12  ILAVSESAAKRVAFLIEQEGNPKLMLRLTVSGGGCSGFQYGFSFDETA-TGEDHVFEKDG 70

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +V  D ASL  + G  +D+  + + + F   NPN  ++CGCG S  +
Sbjct: 71  TRVVTDDASLDLLAGATLDYVEDLMGAAFQIKNPNATASCGCGNSFAV 118


>gi|261212262|ref|ZP_05926548.1| HesB family protein [Vibrio sp. RC341]
 gi|260838870|gb|EEX65521.1| HesB family protein [Vibrio sp. RC341]
          Length = 113

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   ++ ++AA  R+K ++   +  +  +R+ +  GGC+G +Y              
Sbjct: 1   MSEVNVPLSFSDAAATRVKALIAEEENPSLMLRVYITGGGCSGFQYGFTFDETVNEGDTT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +    GV + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 61  IEN-SGVVLVVDPMSLQYLIGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|328951140|ref|YP_004368475.1| iron-sulfur cluster assembly accessory protein [Marinithermus
           hydrothermalis DSM 14884]
 gi|328451464|gb|AEB12365.1| iron-sulfur cluster assembly accessory protein [Marinithermus
           hydrothermalis DSM 14884]
          Length = 128

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 36/112 (32%), Positives = 56/112 (50%), Gaps = 1/112 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++TE A  R +EI+         IR+ +K GGC+G +Y + +          +    G
Sbjct: 7   VISITETAAARAREILERHNKPNAAIRVFIKSGGCSGYQYGMAIDERELEGDTFVEM-HG 65

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           VK+ +D  SL  ++G+ ID+    +  GF  HNPN  S CGCG S     A 
Sbjct: 66  VKLVVDRMSLPLLVGSTIDWVESMMGGGFTVHNPNATSTCGCGHSFRTDGAK 117


>gi|256821635|ref|YP_003145598.1| iron-sulfur cluster assembly accessory protein [Kangiella koreensis
           DSM 16069]
 gi|256795174|gb|ACV25830.1| iron-sulfur cluster assembly accessory protein [Kangiella koreensis
           DSM 16069]
          Length = 108

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 61/107 (57%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA  ++K+++   Q     +R+ +  GGC+G +Y      +   D D  IE+DGV
Sbjct: 3   ITVTEAASRKVKQLIDEEQNDQLKLRVFVTGGGCSGFQYGFTFD-EKQNDNDMAIEQDGV 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D+ S  Y++G+E+D+      S F+  NP   + CGCG S  +
Sbjct: 62  KILVDALSFQYLMGSEVDYTEGLQGSRFLISNPQAKTTCGCGSSFSL 108


>gi|153835388|ref|ZP_01988055.1| HesB family protein [Vibrio harveyi HY01]
 gi|148868090|gb|EDL67259.1| HesB family protein [Vibrio harveyi HY01]
          Length = 113

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 57/114 (50%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   ++ ++AA  R+K ++   +  A  +R+ +  GGC+G +Y              
Sbjct: 1   MSEVNVPLSFSDAAASRVKALIAEEENPALKLRVYITGGGCSGFQYGFTFDESVNEGDTT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++   GV + +D  SL Y++G  +D+      + F  +NPN  + CGCG S  +
Sbjct: 61  IVN-SGVTLVVDPMSLQYLIGGVVDYTEGLEGARFFVNNPNATTTCGCGASFSV 113


>gi|90580614|ref|ZP_01236419.1| putative HesB family protein [Vibrio angustum S14]
 gi|90438272|gb|EAS63458.1| putative HesB family protein [Photobacterium angustum S14]
          Length = 113

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 35/114 (30%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 1   MSD---IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSD    +T ++ A  ++K ++   +     +R+ +  GGC+G +Y      +   DGD 
Sbjct: 1   MSDANLPLTFSDVAANKVKTLIAEEENPNLKLRVYITGGGCSGFQYGFTFD-EKVNDGDM 59

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IE  GV + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 60  TIENSGVTLVVDPMSLQYLMGGTVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|90424006|ref|YP_532376.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisB18]
 gi|90106020|gb|ABD88057.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisB18]
          Length = 109

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 42/111 (37%), Positives = 65/111 (58%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  VT++E A  RI EI+         +RIS++ GGC+G +Y  D V  N  + D +I 
Sbjct: 1   MTASVTISERAARRIGEILSKEG-TGAMLRISVEGGGCSGFQYKFD-VERNQNNDDTVIA 58

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +D   V +DSAS+ ++ G E+DF  + + + F  +NPN  ++CGCG S  I
Sbjct: 59  RDSAVVLVDSASVPFLEGAELDFVDDLIGASFRVNNPNATASCGCGTSFSI 109


>gi|315125931|ref|YP_004067934.1| HesB/YadR/YfhF protein [Pseudoalteromonas sp. SM9913]
 gi|332532826|ref|ZP_08408699.1| putative iron binding protein from the HesB_IscA_SufA family
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|315014445|gb|ADT67783.1| HesB/YadR/YfhF protein [Pseudoalteromonas sp. SM9913]
 gi|332037672|gb|EGI74123.1| putative iron binding protein from the HesB_IscA_SufA family
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 112

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  ++AA  R+K+++   +     +R+ +  GGC+G +Y             +++ K+GV
Sbjct: 7   IKFSDAAAVRVKQLIDEEENPDLKLRVYVTGGGCSGFQYGFTFDEKANPGDLEIV-KNGV 65

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + ID  S+ Y++  E+D+      + F   NPN  + CGCG S  +
Sbjct: 66  TLVIDPMSIQYLVDGEVDYTEGLEGARFFVSNPNATTTCGCGASFSV 112


>gi|260771405|ref|ZP_05880330.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           furnissii CIP 102972]
 gi|260613531|gb|EEX38725.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           furnissii CIP 102972]
 gi|315180986|gb|ADT87900.1| HesB family protein [Vibrio furnissii NCTC 11218]
          Length = 107

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+K  + +++GK  G+R+ +K  GC+G+ Y+++ V +   + +      GV
Sbjct: 3   ITLTETAASRVKSYL-DNRGKGVGLRLGVKTTGCSGMAYVLEFVDELNEEDEVFE-DHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS SL+Y+ GT++D+K E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDSKSLVYLDGTQLDYKKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|330817659|ref|YP_004361364.1| Iron-sulfur cluster assembly protein IscA [Burkholderia gladioli
           BSR3]
 gi|327370052|gb|AEA61408.1| Iron-sulfur cluster assembly protein IscA [Burkholderia gladioli
           BSR3]
          Length = 107

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGLGLRLGVRTTGCSGLAYKLEYVDDV-ATEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|294668743|ref|ZP_06733836.1| iron-sulfur cluster assembly protein IscA [Neisseria elongata
           subsp. glycolytica ATCC 29315]
 gi|291309260|gb|EFE50503.1| iron-sulfur cluster assembly protein IscA [Neisseria elongata
           subsp. glycolytica ATCC 29315]
          Length = 106

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A   IK  +   +GK  G+R+ +K  GC+G+ Y ++ V +   +      ++G
Sbjct: 1   MITITENAANYIKNFLEK-RGKGIGVRLGVKTSGCSGMAYNLEFVDEADPEDLVFE-QNG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            KV+ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 59  AKVYIDPKSLVYLDGTQMDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|226952839|ref|ZP_03823303.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter sp. ATCC
           27244]
 gi|226836460|gb|EEH68843.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter sp. ATCC
           27244]
          Length = 111

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 31/112 (27%), Positives = 55/112 (49%), Gaps = 2/112 (1%)

Query: 1   MS-DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M+   + +++ A  +++++  +       +R+ +  GGC+G  Y  +       D  +  
Sbjct: 1   MTAQALELSDNAAKKVRQLRESEGNNDLMLRVYVTGGGCSGFSYGFNFAETVNEDDAEFS 60

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             D VKV +DS S  Y++G+ +D+      S FV  NPN  + CGCG S  I
Sbjct: 61  NGD-VKVLVDSLSYQYLVGSVVDYLEGLEGSRFVVQNPNATTTCGCGSSFSI 111


>gi|149927872|ref|ZP_01916123.1| iron-sulfur cluster assembly protein IscA [Limnobacter sp. MED105]
 gi|149823494|gb|EDM82725.1| iron-sulfur cluster assembly protein IscA [Limnobacter sp. MED105]
          Length = 107

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   I + +   +GK  G+RI ++  GC+G+ Y ++ V     D D++ E  GV
Sbjct: 3   ITLTERAADHISKFLTK-RGKGIGLRIGVRTTGCSGMAYKLEFVDAV-ADEDNVFEAHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++D  S+ Y+ G E+DF  E L  GF F+NPN+ + CGCG+S  +
Sbjct: 61  KLFVDPKSMPYLEGIELDFAREGLNEGFKFNNPNEKARCGCGESFTV 107


>gi|117620083|ref|YP_856285.1| iron-sulfur cluster assembly protein IscA [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117561490|gb|ABK38438.1| iron-sulfur cluster assembly protein IscA [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 107

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT+AA  R+   + N +GK  G+R+ +K  GC+GL Y+++ V +   D D + E+DGV
Sbjct: 3   ITMTDAAAARVSSFLTN-RGKGIGLRLGVKTTGCSGLAYVLEFVDEL-ADEDQVFEQDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D+ SL+++ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIVDAKSLIHLDGTELDFVKEGLNEGFQFNNPNAKGECGCGESFSV 107


>gi|145299541|ref|YP_001142382.1| iron-sulfur cluster assembly protein IscA [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142852313|gb|ABO90634.1| iron-sulfur cluster assembly protein IscA [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 107

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT+AA  R+   + N +GK  G+R+ +K  GC+GL Y+++ V +   D D + E++GV
Sbjct: 3   ITMTDAAAARVSSFLTN-RGKGIGLRLGVKTTGCSGLAYVLEFVDEL-ADEDQVFEQNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ +D+ SL+++ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  RIIVDAKSLIHLDGTELDFVKEGLNEGFQFNNPNAKGECGCGESFSV 107


>gi|16272324|ref|NP_438537.1| hypothetical protein HI0376 [Haemophilus influenzae Rd KW20]
 gi|260580561|ref|ZP_05848389.1| iron-sulfur cluster assembly protein IscA [Haemophilus influenzae
           RdAW]
 gi|1175982|sp|P44672|ISCA_HAEIN RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|1573345|gb|AAC22033.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|260092903|gb|EEW76838.1| iron-sulfur cluster assembly protein IscA [Haemophilus influenzae
           RdAW]
          Length = 107

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+K  + +++GK  G+R+ +K  GC+GL Y+++ V     +     +  GV
Sbjct: 3   ITLTEKAAQRVKAFL-DNRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNSEDQVFEQY-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL+Y+ G E+D+  E L  GF ++NPN   +CGCG+S  +
Sbjct: 61  NIIVDPKSLVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV 107


>gi|330830078|ref|YP_004393030.1| HesB-like protein [Aeromonas veronii B565]
 gi|328805214|gb|AEB50413.1| HesB-like protein [Aeromonas veronii B565]
          Length = 107

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT+AA  R+   + N +GK  G+R+ +K  GC+GL Y+++ V +   D D + E+ GV
Sbjct: 3   ITMTDAAAARVSSFLAN-RGKGIGLRLGVKTTGCSGLAYVLEFVDEL-TDEDQVFEQQGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D+ SL+++ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIVDAKSLIHLDGTELDFVKEGLNEGFQFNNPNAKGECGCGESFSV 107


>gi|262401675|ref|ZP_06078241.1| HesB family protein [Vibrio sp. RC586]
 gi|262352092|gb|EEZ01222.1| HesB family protein [Vibrio sp. RC586]
          Length = 113

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 55/114 (48%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   ++ ++AA  R+K ++      +  +R+ +  GGC+G +Y              
Sbjct: 1   MSEVNVPLSFSDAAAKRVKALIAEEDNPSLMLRVYITGGGCSGFQYGFTFDETINEGDTK 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +    GV + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 61  IEN-SGVILVVDPMSLQYLIGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|262374731|ref|ZP_06068003.1| iron-sulfur cluster assembly protein IscA [Acinetobacter junii
           SH205]
 gi|262310387|gb|EEY91479.1| iron-sulfur cluster assembly protein IscA [Acinetobacter junii
           SH205]
          Length = 111

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 30/112 (26%), Positives = 55/112 (49%), Gaps = 2/112 (1%)

Query: 1   MS-DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M+   + +++ A  +++++  +       +R+ +  GGC+G  Y  +       D  +  
Sbjct: 1   MNAQALELSDNAAKKVRQLRESEGNNDLMLRVYVTGGGCSGFSYGFNFAESANEDDAEFT 60

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             D VK+ +DS S  Y++G+ +D+      S FV  NPN  + CGCG S  I
Sbjct: 61  NGD-VKMLVDSLSYQYLVGSVVDYLEGLEGSRFVVQNPNATTTCGCGSSFSI 111


>gi|238028018|ref|YP_002912249.1| Iron-sulfur cluster assembly protein IscA [Burkholderia glumae
           BGR1]
 gi|237877212|gb|ACR29545.1| Iron-sulfur cluster assembly protein IscA [Burkholderia glumae
           BGR1]
          Length = 107

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGLGLRLGVRTTGCSGLAYKLEYVDDV-AAEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|126668353|ref|ZP_01739311.1| hypothetical protein MELB17_13007 [Marinobacter sp. ELB17]
 gi|126627169|gb|EAZ97808.1| hypothetical protein MELB17_13007 [Marinobacter sp. ELB17]
          Length = 117

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 55/105 (52%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           ++++AV +++E+V     +   +R+ +  GGC+G +Y          +   +  KDG+ +
Sbjct: 14  LSDSAVSKVRELVEEEGNENLKLRVFVTGGGCSGFQYGFSFDKVQDDEDAVIQ-KDGMSM 72

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  S  Y++G  +D++     + FV  NPN  S CGCG S  I
Sbjct: 73  LVDPMSYQYLVGAMVDYQEGLQGAQFVVQNPNASSTCGCGSSFTI 117


>gi|325130464|gb|EGC53224.1| iron-sulfur cluster assembly protein IscA [Neisseria meningitidis
           OX99.30304]
          Length = 106

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V +   D        G
Sbjct: 1   MITLTENAAKHINDYLAK-RGKGLGVRLGVKTSGCSGIAYNLEFVDEADGDDLIFEG-HG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 59  ARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|255066431|ref|ZP_05318286.1| iron-sulfur cluster assembly protein IscA [Neisseria sicca ATCC
           29256]
 gi|255049311|gb|EET44775.1| iron-sulfur cluster assembly protein IscA [Neisseria sicca ATCC
           29256]
          Length = 106

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A   I   +   +GK  G+R+ +K  GC+G+ Y ++ V +   D      + G
Sbjct: 1   MITITENAAKYINSYLTK-RGKGLGVRLGVKTSGCSGMAYNLEFVDEANEDDLVFE-EHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +V+ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 59  ARVYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|254508221|ref|ZP_05120345.1| HesB family protein [Vibrio parahaemolyticus 16]
 gi|219548838|gb|EED25839.1| HesB family protein [Vibrio parahaemolyticus 16]
          Length = 125

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 52/107 (48%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T ++AA  R+  ++   +     +R+ +  GGC+G +Y              ++   GV
Sbjct: 20  LTFSDAAAKRVGALIAEEENPNLKLRVYITGGGCSGFQYGFTFDESVNEGDTTIVN-SGV 78

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G ++D+      S F  +NPN  + CGCG S  +
Sbjct: 79  TLVVDPMSLQYLVGGQVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 125


>gi|17987374|ref|NP_540008.1| HESB protein [Brucella melitensis bv. 1 str. 16M]
 gi|23501761|ref|NP_697888.1| HesB/YadR/YfhF family protein [Brucella suis 1330]
 gi|62289820|ref|YP_221613.1| HesB/YadR/YfhF family protein [Brucella abortus bv. 1 str. 9-941]
 gi|82699745|ref|YP_414319.1| hypothetical protein BAB1_0894 [Brucella melitensis biovar Abortus
           2308]
 gi|148559334|ref|YP_001258849.1| HesB/YadR/YfhF family protein [Brucella ovis ATCC 25840]
 gi|161618835|ref|YP_001592722.1| iron-sulfur cluster assembly accessory protein [Brucella canis ATCC
           23365]
 gi|189024061|ref|YP_001934829.1| hypothetical protein BAbS19_I08340 [Brucella abortus S19]
 gi|225627363|ref|ZP_03785400.1| iron-sulfur cluster assembly accessory protein [Brucella ceti str.
           Cudo]
 gi|225852387|ref|YP_002732620.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           ATCC 23457]
 gi|237815305|ref|ZP_04594303.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           str. 2308 A]
 gi|254689125|ref|ZP_05152379.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 6 str. 870]
 gi|254693608|ref|ZP_05155436.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 3 str. Tulya]
 gi|254697258|ref|ZP_05159086.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254701639|ref|ZP_05163467.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 5
           str. 513]
 gi|254704182|ref|ZP_05166010.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 3
           str. 686]
 gi|254706915|ref|ZP_05168743.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis M163/99/10]
 gi|254709977|ref|ZP_05171788.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis B2/94]
 gi|254713977|ref|ZP_05175788.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M644/93/1]
 gi|254716964|ref|ZP_05178775.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M13/05/1]
 gi|254718979|ref|ZP_05180790.1| iron-sulfur cluster assembly accessory protein [Brucella sp. 83/13]
 gi|254730157|ref|ZP_05188735.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 4 str. 292]
 gi|256031470|ref|ZP_05445084.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis M292/94/1]
 gi|256044548|ref|ZP_05447452.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256060980|ref|ZP_05451138.1| iron-sulfur cluster assembly accessory protein [Brucella neotomae
           5K33]
 gi|256113413|ref|ZP_05454262.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|256159596|ref|ZP_05457358.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M490/95/1]
 gi|256254876|ref|ZP_05460412.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           B1/94]
 gi|256257374|ref|ZP_05462910.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 9 str. C68]
 gi|256264115|ref|ZP_05466647.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 2 str. 63/9]
 gi|256369303|ref|YP_003106811.1| HesB/YadR/YfhF family protein [Brucella microti CCM 4915]
 gi|260168604|ref|ZP_05755415.1| HesB/YadR/YfhF family protein [Brucella sp. F5/99]
 gi|260545433|ref|ZP_05821174.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           NCTC 8038]
 gi|260563901|ref|ZP_05834387.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 1 str. 16M]
 gi|260566568|ref|ZP_05837038.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 4
           str. 40]
 gi|260754624|ref|ZP_05866972.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 6 str. 870]
 gi|260757847|ref|ZP_05870195.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 4 str. 292]
 gi|260761670|ref|ZP_05874013.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260883651|ref|ZP_05895265.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 9 str. C68]
 gi|261213874|ref|ZP_05928155.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 3 str. Tulya]
 gi|261218769|ref|ZP_05933050.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M13/05/1]
 gi|261222060|ref|ZP_05936341.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           B1/94]
 gi|261314379|ref|ZP_05953576.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis M163/99/10]
 gi|261317525|ref|ZP_05956722.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis B2/94]
 gi|261321732|ref|ZP_05960929.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M644/93/1]
 gi|261324982|ref|ZP_05964179.1| iron-sulfur cluster assembly accessory protein [Brucella neotomae
           5K33]
 gi|261752192|ref|ZP_05995901.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 5
           str. 513]
 gi|261754851|ref|ZP_05998560.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 3
           str. 686]
 gi|261758078|ref|ZP_06001787.1| iron-sulfur cluster assembly accessory protein [Brucella sp. F5/99]
 gi|265983969|ref|ZP_06096704.1| iron-sulfur cluster assembly accessory protein [Brucella sp. 83/13]
 gi|265988560|ref|ZP_06101117.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis M292/94/1]
 gi|265990974|ref|ZP_06103531.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|265994811|ref|ZP_06107368.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|265998025|ref|ZP_06110582.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M490/95/1]
 gi|294852227|ref|ZP_06792900.1| HesB/YadR/YfhF family protein [Brucella sp. NVSL 07-0026]
 gi|297248224|ref|ZP_06931942.1| HesB/YadR/YfhF family protein [Brucella abortus bv. 5 str. B3196]
 gi|306837327|ref|ZP_07470208.1| iron-sulfur cluster assembly accessory protein [Brucella sp. NF
           2653]
 gi|306840367|ref|ZP_07473134.1| iron-sulfur cluster assembly accessory protein [Brucella sp. BO2]
 gi|306843772|ref|ZP_07476370.1| iron-sulfur cluster assembly accessory protein [Brucella sp. BO1]
 gi|17983061|gb|AAL52272.1| hesb protein [Brucella melitensis bv. 1 str. 16M]
 gi|23347689|gb|AAN29803.1| HesB/YadR/YfhF family protein [Brucella suis 1330]
 gi|62195952|gb|AAX74252.1| HesB/YadR/YfhF family protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615846|emb|CAJ10850.1| Protein of unknown function, HesB/YadR/YfhF [Brucella melitensis
           biovar Abortus 2308]
 gi|148370591|gb|ABQ60570.1| HesB/YadR/YfhF family protein [Brucella ovis ATCC 25840]
 gi|161335646|gb|ABX61951.1| iron-sulfur cluster assembly accessory protein [Brucella canis ATCC
           23365]
 gi|189019633|gb|ACD72355.1| Protein of unknown function, HesB/YadR/YfhF [Brucella abortus S19]
 gi|225617368|gb|EEH14413.1| iron-sulfur cluster assembly accessory protein [Brucella ceti str.
           Cudo]
 gi|225640752|gb|ACO00666.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           ATCC 23457]
 gi|237790142|gb|EEP64352.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           str. 2308 A]
 gi|255999463|gb|ACU47862.1| HesB/YadR/YfhF family protein [Brucella microti CCM 4915]
 gi|260096840|gb|EEW80715.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           NCTC 8038]
 gi|260153917|gb|EEW89009.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 1 str. 16M]
 gi|260156086|gb|EEW91166.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 4
           str. 40]
 gi|260668165|gb|EEX55105.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 4 str. 292]
 gi|260672102|gb|EEX58923.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260674732|gb|EEX61553.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 6 str. 870]
 gi|260873179|gb|EEX80248.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 9 str. C68]
 gi|260915481|gb|EEX82342.1| iron-sulfur cluster assembly accessory protein [Brucella abortus
           bv. 3 str. Tulya]
 gi|260920644|gb|EEX87297.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           B1/94]
 gi|260923858|gb|EEX90426.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M13/05/1]
 gi|261294422|gb|EEX97918.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M644/93/1]
 gi|261296748|gb|EEY00245.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis B2/94]
 gi|261300962|gb|EEY04459.1| iron-sulfur cluster assembly accessory protein [Brucella neotomae
           5K33]
 gi|261303405|gb|EEY06902.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis M163/99/10]
 gi|261738062|gb|EEY26058.1| iron-sulfur cluster assembly accessory protein [Brucella sp. F5/99]
 gi|261741945|gb|EEY29871.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 5
           str. 513]
 gi|261744604|gb|EEY32530.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 3
           str. 686]
 gi|262552493|gb|EEZ08483.1| iron-sulfur cluster assembly accessory protein [Brucella ceti
           M490/95/1]
 gi|262765924|gb|EEZ11713.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|263001758|gb|EEZ14333.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|263094333|gb|EEZ18178.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           bv. 2 str. 63/9]
 gi|264660757|gb|EEZ31018.1| iron-sulfur cluster assembly accessory protein [Brucella
           pinnipedialis M292/94/1]
 gi|264662561|gb|EEZ32822.1| iron-sulfur cluster assembly accessory protein [Brucella sp. 83/13]
 gi|294820816|gb|EFG37815.1| HesB/YadR/YfhF family protein [Brucella sp. NVSL 07-0026]
 gi|297175393|gb|EFH34740.1| HesB/YadR/YfhF family protein [Brucella abortus bv. 5 str. B3196]
 gi|306275850|gb|EFM57566.1| iron-sulfur cluster assembly accessory protein [Brucella sp. BO1]
 gi|306289652|gb|EFM60852.1| iron-sulfur cluster assembly accessory protein [Brucella sp. BO2]
 gi|306407579|gb|EFM63777.1| iron-sulfur cluster assembly accessory protein [Brucella sp. NF
           2653]
 gi|326408893|gb|ADZ65958.1| HESB protein [Brucella melitensis M28]
 gi|326538611|gb|ADZ86826.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis
           M5-90]
          Length = 108

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  RI +I+ +  GK   +R+S++ GGC+G  Y  DLV     D   + +  G 
Sbjct: 4   ITVSDSAARRIAKILDSEPGKT-ALRVSVEGGGCSGFSYKYDLVDAQTEDDIVIEKL-GA 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V IDS S+ YM G+EIDF  + +   F   NPN  ++CGCG S  I
Sbjct: 62  RVLIDSISVPYMDGSEIDFVDDLMGQSFQIRNPNATASCGCGTSFAI 108


>gi|56707820|ref|YP_169716.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|89256820|ref|YP_514182.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. holarctica LVS]
 gi|110670291|ref|YP_666848.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. tularensis FSC198]
 gi|115315206|ref|YP_763929.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. holarctica OSU18]
 gi|118497209|ref|YP_898259.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. novicida U112]
 gi|134302407|ref|YP_001122377.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|156502986|ref|YP_001429051.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. holarctica FTNF002-00]
 gi|167009859|ref|ZP_02274790.1| HesB/YadR/YfhF family protein [Francisella tularensis subsp.
           holarctica FSC200]
 gi|187932014|ref|YP_001891999.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|194323508|ref|ZP_03057285.1| conserved hypothetical protein, putative [Francisella tularensis
           subsp. novicida FTE]
 gi|208779002|ref|ZP_03246348.1| conserved hypothetical protein [Francisella novicida FTG]
 gi|224456891|ref|ZP_03665364.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|254368102|ref|ZP_04984122.1| hypothetical protein FTHG_01432 [Francisella tularensis subsp.
           holarctica 257]
 gi|254369704|ref|ZP_04985714.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|254370316|ref|ZP_04986321.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254372574|ref|ZP_04988063.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|254374033|ref|ZP_04989515.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|254874634|ref|ZP_05247344.1| iron-binding protein erpA [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|290953516|ref|ZP_06558137.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. holarctica URFT1]
 gi|295313208|ref|ZP_06803867.1| iron-sulfur cluster insertion protein ErpA [Francisella tularensis
           subsp. holarctica URFT1]
 gi|81597692|sp|Q5NGX6|ERPA_FRATT RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|122324797|sp|Q0BKU2|ERPA_FRATO RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|122500401|sp|Q2A270|ERPA_FRATH RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|122970999|sp|Q14IC8|ERPA_FRAT1 RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160380672|sp|A7NDP2|ERPA_FRATF RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160380673|sp|A0Q5J0|ERPA_FRATN RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|160380674|sp|A4IZA5|ERPA_FRATW RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|226694549|sp|B2SDK6|ERPA_FRATM RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|54112963|gb|AAV29115.1| NT02FT0998 [synthetic construct]
 gi|56604312|emb|CAG45333.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|89144651|emb|CAJ79975.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|110320624|emb|CAL08716.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115130105|gb|ABI83292.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica OSU18]
 gi|118423115|gb|ABK89505.1| conserved protein of unknown function [Francisella novicida U112]
 gi|134050184|gb|ABO47255.1| iron-sulfur cluster assembly accessory protein with HesB-like
           domain [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|134253912|gb|EBA53006.1| hypothetical protein FTHG_01432 [Francisella tularensis subsp.
           holarctica 257]
 gi|151568559|gb|EDN34213.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|151570301|gb|EDN35955.1| conserved hypothetical protein [Francisella novicida GA99-3549]
 gi|151571753|gb|EDN37407.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|156253589|gb|ABU62095.1| iron-sulfur cluster assembly accessory protein/HesB-like domain
           [Francisella tularensis subsp. holarctica FTNF002-00]
 gi|157122663|gb|EDO66792.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|187712923|gb|ACD31220.1| conserved hypothetical protein [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|194322363|gb|EDX19844.1| conserved hypothetical protein, putative [Francisella tularensis
           subsp. novicida FTE]
 gi|208744802|gb|EDZ91100.1| conserved hypothetical protein [Francisella novicida FTG]
 gi|254840633|gb|EET19069.1| iron-binding protein erpA [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282158996|gb|ADA78387.1| HesB/YadR/YfhF family protein [Francisella tularensis subsp.
           tularensis NE061598]
 gi|328676681|gb|AEB27551.1| putative iron binding protein from the HesB_IscA_SufA family
           [Francisella cf. novicida Fx1]
          Length = 116

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 62/109 (56%), Gaps = 1/109 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           D +  TEAA  ++KE++      +  +R+ +  GGC+G +Y      +   + D +I K+
Sbjct: 9   DPINFTEAASLKVKELIEEEGDNSLSLRVYITGGGCSGFQYAFAFDNEV-KEDDMVITKN 67

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GV++ +DS S  Y++G ++D+K +   + FV  NPN  + CGCG S  +
Sbjct: 68  GVRLLVDSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV 116


>gi|59801060|ref|YP_207772.1| hypothetical protein NGO0632 [Neisseria gonorrhoeae FA 1090]
 gi|239999131|ref|ZP_04719055.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae 35/02]
 gi|240115866|ref|ZP_04729928.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID18]
 gi|240123712|ref|ZP_04736668.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae PID332]
 gi|59717955|gb|AAW89360.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
          Length = 106

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A   I + +   +GK  G+R+ +K  GC+G+ Y ++ V +   D        G
Sbjct: 1   MITLTENAAKHINDYLAK-RGKGLGVRLGVKTSGCSGMAYNLEFVDEANGDDLIFEG-HG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 59  ARIYIDPKSLVYLDGTQVDYTKEDLQEGFKFENPNVKDSCGCGESFHV 106


>gi|254509345|ref|ZP_05121434.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           16]
 gi|219547741|gb|EED24777.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           16]
          Length = 107

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE A  R+K  + +++GK  G+R+ +K  GC+G+ Y+++ V +   +       DGV
Sbjct: 3   ITMTETAASRVKTFL-DNRGKGIGLRLGVKTTGCSGMAYVLEFVDELNEEDSVFEH-DGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDQKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|321259375|ref|XP_003194408.1| iron ion transport-related protein [Cryptococcus gattii WM276]
 gi|317460879|gb|ADV22621.1| iron ion transport-related protein, putative [Cryptococcus gattii
           WM276]
          Length = 214

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 73/110 (66%), Gaps = 1/110 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           + +TMT  A+  ++E++  S  + + +RIS+K  GCAG+ Y +D V       D+++E+D
Sbjct: 105 NAITMTPTAISHLRELLA-SPTEPRLLRISVKSRGCAGMAYHLDYVPPPGGKFDEVVEQD 163

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           GV+V IDS +L  ++G+ +D++  +L +GFVF NPN V  CGCG+S  I+
Sbjct: 164 GVRVLIDSKALFSIIGSRMDWRDNRLSAGFVFDNPNVVDTCGCGESFNIR 213


>gi|254293756|ref|YP_003059779.1| iron-sulfur cluster assembly accessory protein [Hirschia baltica
           ATCC 49814]
 gi|254042287|gb|ACT59082.1| iron-sulfur cluster assembly accessory protein [Hirschia baltica
           ATCC 49814]
          Length = 109

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 42/111 (37%), Positives = 59/111 (53%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M D VT+T +A  RIK I+ ++   A  +RI +  GGC+G  Y  D   +   D      
Sbjct: 1   MQDKVTITASAADRIKFILKDNGN-ASMLRIGVLGGGCSGFSYTFDFANETNEDDIVFER 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            D  KV ID  S+ ++ G EIDF  E + S F  +NPN  ++CGCG S  +
Sbjct: 60  -DDAKVVIDETSIPFLEGCEIDFVNELIGSSFKINNPNATASCGCGTSFSV 109


>gi|58267804|ref|XP_571058.1| iron ion transport-related protein [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134112309|ref|XP_775130.1| hypothetical protein CNBE4040 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257782|gb|EAL20483.1| hypothetical protein CNBE4040 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57227292|gb|AAW43751.1| iron ion transport-related protein, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 215

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 73/110 (66%), Gaps = 1/110 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           + +TMT  A+  ++E++  S  + + +RIS+K  GCAG+ Y +D V       D+++E+D
Sbjct: 106 NAITMTPTAISHLRELLA-SPTEPRLLRISVKSRGCAGMAYHLDYVPPPGGKFDEVVEQD 164

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           GV+V IDS +L  ++G+ +D++  +L +GFVF NPN V  CGCG+S  I+
Sbjct: 165 GVRVLIDSKALFSIIGSRMDWRDNRLSAGFVFDNPNVVDTCGCGESFNIR 214


>gi|302877887|ref|YP_003846451.1| iron-sulfur cluster assembly protein IscA [Gallionella
           capsiferriformans ES-2]
 gi|302580676|gb|ADL54687.1| iron-sulfur cluster assembly protein IscA [Gallionella
           capsiferriformans ES-2]
          Length = 107

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 57/107 (53%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TEAA   +K  +        G+RI ++  GC+G+ Y ++       D        GV
Sbjct: 3   VTLTEAAAKHVKNFIAKRGR-GIGLRIGVRTSGCSGMAYKLEFADVLEADDLPFDSF-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  SL Y+ G E+D+  E L  GF F+NPN   ACGCG+S ++
Sbjct: 61  TVLVDPKSLPYIDGMELDYTREGLNEGFKFNNPNVKDACGCGESFQV 107


>gi|46201883|ref|ZP_00054147.2| COG0316: Uncharacterized conserved protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 117

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 52/107 (48%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE+A  R++ ++         +R+ +  GGC+G  Y + L      D     E  G+
Sbjct: 12  VTVTESAAERVQTLIKMEGKPNMMLRLGVSGGGCSGFSYGISLDDQVNDDDRLFNEY-GI 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  SL  + G+ +DF  +   S F   NPN  S CGCG S  +
Sbjct: 71  TVVVDQTSLDMLDGSVVDFVEDLSGSSFQVKNPNATSTCGCGSSFSV 117


>gi|307946865|ref|ZP_07662200.1| iron-sulfur cluster insertion protein ErpA [Roseibium sp.
           TrichSKD4]
 gi|307770529|gb|EFO29755.1| iron-sulfur cluster insertion protein ErpA [Roseibium sp.
           TrichSKD4]
          Length = 113

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+++ A  RI +I+ +   +   +R+S++ GGC+GL+Y  DLV     D D  I K GV
Sbjct: 9   VTVSDRAAKRIAKILSSE-PQGSMLRVSVEGGGCSGLQYKYDLVQQR-EDDDLAIGKGGV 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V IDS SL YM G+EIDF  + +   F  +NPN V+ CGCG S  I
Sbjct: 67  TVLIDSISLQYMDGSEIDFVDDLIGQSFQINNPNAVAGCGCGTSFTI 113


>gi|73946570|ref|XP_849435.1| PREDICTED: similar to HESB like domain containing 2 [Canis
           familiaris]
          Length = 260

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK+++ +   +  G+++ ++  GC GL Y ++         ++++ +DGV
Sbjct: 156 LTLTPSAVNKIKQLLKDK-PEHVGLKVGVRTRGCNGLSYTLEYTKTKGDSDEEVV-QDGV 213

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 214 RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 260


>gi|253997042|ref|YP_003049106.1| iron-sulfur cluster assembly protein IscA [Methylotenera mobilis
           JLW8]
 gi|253983721|gb|ACT48579.1| iron-sulfur cluster assembly protein IscA [Methylotenera mobilis
           JLW8]
          Length = 107

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+++ + N +GK  G+R+ +K  GC+G+ Y ++ V +   +        GV
Sbjct: 3   ITLTETAASRVEKFLAN-RGKGVGLRLGVKTTGCSGMAYTLEFVDEMHPEDVAFE-SHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFTKEGLNEGFKFNNPNVKDECGCGESFTV 107


>gi|26987174|ref|NP_742599.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas putida
           KT2440]
 gi|148545718|ref|YP_001265820.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas putida F1]
 gi|167031479|ref|YP_001666710.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas putida
           GB-1]
 gi|24981809|gb|AAN66063.1|AE016235_2 HesB/YadR/YfhF family protein [Pseudomonas putida KT2440]
 gi|148509776|gb|ABQ76636.1| iron-sulfur cluster assembly accessory protein [Pseudomonas putida
           F1]
 gi|166857967|gb|ABY96374.1| iron-sulfur cluster assembly accessory protein [Pseudomonas putida
           GB-1]
          Length = 132

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T  A  ++K +V     +   +R+ +  GGC+G +Y      ++  + D ++E++GV
Sbjct: 27  LEFTHGAAQKVKNLVNEEGNERLKLRVFVTGGGCSGFQYGFTFD-EDVAEDDTIVEREGV 85

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S  Y+ G E+D++     S FV  NPN  + CGCG S  I
Sbjct: 86  SLVVDPMSFQYLAGAEVDYQEGLEGSRFVIKNPNAATTCGCGSSFSI 132


>gi|301758436|ref|XP_002915054.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like, partial [Ailuropoda melanoleuca]
          Length = 126

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK+++ +   +  G+++ ++  GC GL Y ++         ++++ +DGV
Sbjct: 22  LTLTPSAVNKIKQLLKDK-PEHVGLKVGVRTRGCNGLSYTLEYTKTKGDSDEEVV-QDGV 79

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 80  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 126


>gi|154248533|ref|YP_001419491.1| iron-sulfur cluster assembly accessory protein [Xanthobacter
           autotrophicus Py2]
 gi|154162618|gb|ABS69834.1| iron-sulfur cluster assembly accessory protein [Xanthobacter
           autotrophicus Py2]
          Length = 141

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 46/115 (40%), Positives = 78/115 (67%), Gaps = 2/115 (1%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++ +T+AA  +++EI+  ++     +R+ ++ GGCAG+ Y +D         D ++E 
Sbjct: 22  PPVIRITDAAAEQLREILAAAE-PGTALRVGIENGGCAGMSYKMDFT-TEIAPFDSVVED 79

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            GVKV +D+ ++L++LGTE+D+KT+K+ S FVF+NPNQ S+CGCG+SV I   D+
Sbjct: 80  KGVKVVVDTKAVLFLLGTEMDYKTDKVSSQFVFNNPNQTSSCGCGESVAITPVDM 134


>gi|27363904|ref|NP_759432.1| iron-sulfur cluster assembly protein IscA [Vibrio vulnificus CMCP6]
 gi|320157283|ref|YP_004189662.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           vulnificus MO6-24/O]
 gi|27360021|gb|AAO08959.1| iron-sulfur cluster assembly protein IscA [Vibrio vulnificus CMCP6]
 gi|319932595|gb|ADV87459.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           vulnificus MO6-24/O]
          Length = 107

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE A  R+K  + +++GK  G+R+ +K  GC+G+ Y+++ V +   + +      GV
Sbjct: 3   VTLTETAASRVKAFL-DNRGKGVGLRLGVKTTGCSGMAYVLEFVDELNEEDEVFEH-SGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GT++D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDKKSLVYLDGTQLDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|261252069|ref|ZP_05944642.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           orientalis CIP 102891]
 gi|260935460|gb|EEX91449.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           orientalis CIP 102891]
          Length = 107

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE A  R++  + +++GK  G+R+ +K  GC+G+ Y+++ V +   +        GV
Sbjct: 3   ITMTETAASRVRTFL-DNRGKGIGLRLGVKTTGCSGMAYVLEFVDELNEEDSVFEH-SGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|281208989|gb|EFA83164.1| iron-sulfur cluster assembly protein [Polysphondylium pallidum
           PN500]
          Length = 141

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 39/113 (34%), Positives = 69/113 (61%), Gaps = 1/113 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKA-QGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
             I +MT++AV +I+E++     +   G+++ +K+ GC+GL Y +D     P   D+++ 
Sbjct: 15  KAIFSMTDSAVNKIRELMKQEGKENFLGMKLGVKQKGCSGLAYTLDFTNQPPNKLDEVVT 74

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
             GV V +DS +L+ ++GTE+D+  E +   F+F NPN  + CGCG+S  +K 
Sbjct: 75  DKGVTVVVDSKALMSVIGTEMDYIEEPIKKEFIFINPNATNTCGCGESFTVKD 127


>gi|237747465|ref|ZP_04577945.1| iron-binding protein iscA [Oxalobacter formigenes HOxBLS]
 gi|229378816|gb|EEO28907.1| iron-binding protein iscA [Oxalobacter formigenes HOxBLS]
          Length = 107

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 61/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   I   +   +GK  G+R  ++  GC+G+ Y ++ V +   D       +GV
Sbjct: 3   ITLTEKAANHISRFL-ERRGKGIGLRFGVQTTGCSGMSYKLEYVDEPDADDIVYE-SNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG S ++
Sbjct: 61  KIFVDPKSLPYLDGTELDFAREGLNEGFKFNNPNVKDTCGCGNSFKV 107


>gi|237808762|ref|YP_002893202.1| iron-sulfur cluster assembly protein IscA [Tolumonas auensis DSM
           9187]
 gi|237501023|gb|ACQ93616.1| iron-sulfur cluster assembly protein IscA [Tolumonas auensis DSM
           9187]
          Length = 107

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+K  + N +GK  G+R+ +K  GC+G+ Y+++ V +   +     +K GV
Sbjct: 3   ITLSDSAAERVKRFLTN-RGKGVGLRLGVKTSGCSGMAYVLEFVDEVHEEDQVFDDK-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID+ SL Y+ GTE+DF  E L  GF F+NPN   ACGCG+S  +
Sbjct: 61  KVIIDAKSLSYLDGTELDFVKEGLNEGFKFNNPNVKDACGCGESFTV 107


>gi|163843146|ref|YP_001627550.1| iron-sulfur cluster assembly accessory protein [Brucella suis ATCC
           23445]
 gi|163673869|gb|ABY37980.1| iron-sulfur cluster assembly accessory protein [Brucella suis ATCC
           23445]
          Length = 108

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  RI +I+ +  GK   +R+S++ GGC+G  Y  DLV     D   + +  G 
Sbjct: 4   ITVSDSAARRIAKILDSEPGKT-ALRVSVEGGGCSGFSYKYDLVDAQTEDDIVIEKL-GA 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V IDS S+ YM G+EIDF  + +   F   NPN  ++CGCG S  I
Sbjct: 62  RVLIDSISVPYMNGSEIDFVDDLMGQSFQIRNPNATASCGCGTSFAI 108


>gi|322514678|ref|ZP_08067706.1| iron-sulfur cluster assembly protein IscA [Actinobacillus ureae
           ATCC 25976]
 gi|322119376|gb|EFX91485.1| iron-sulfur cluster assembly protein IscA [Actinobacillus ureae
           ATCC 25976]
          Length = 107

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R++  + N +GK  G+R+ +K  GC+GL Y+++ V     D      + GV
Sbjct: 3   ITLTETAANRVRTFLEN-RGKGIGLRLGVKTSGCSGLAYVLEFVDVLNEDDQVFE-QHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF ++NPN   +CGCG+S  +
Sbjct: 61  KVIVDEKSLAYLDGTELDFVKEGLNEGFKYNNPNVKDSCGCGESFNV 107


>gi|325271183|ref|ZP_08137736.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas sp. TJI-51]
 gi|160387145|sp|Q88QQ5|ERPA_PSEPK RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|313496798|gb|ADR58164.1| Iron-sulfur cluster insertion protein erpA [Pseudomonas putida
           BIRD-1]
 gi|324103694|gb|EGC00988.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas sp. TJI-51]
          Length = 116

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T  A  ++K +V     +   +R+ +  GGC+G +Y      ++  + D ++E++GV
Sbjct: 11  LEFTHGAAQKVKNLVNEEGNERLKLRVFVTGGGCSGFQYGFTFD-EDVAEDDTIVEREGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S  Y+ G E+D++     S FV  NPN  + CGCG S  I
Sbjct: 70  SLVVDPMSFQYLAGAEVDYQEGLEGSRFVIKNPNAATTCGCGSSFSI 116


>gi|332374118|gb|AEE62200.1| unknown [Dendroctonus ponderosae]
          Length = 129

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV R+KE++ +      G++I +++ GC GL Y ++         ++++ +DGV
Sbjct: 25  LTLTPAAVGRVKELLKDK-SDYVGLKIGVRQRGCNGLSYTLEYADKKEKLDEEVV-QDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  +
Sbjct: 83  RVFIDKKAQLTLLGTEMDFVENKLSSEFVFNNPNIKGTCGCGESFSV 129


>gi|328675737|gb|AEB28412.1| putative iron binding protein from the HesB_IscA_SufA family
           [Francisella cf. novicida 3523]
          Length = 116

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 62/109 (56%), Gaps = 1/109 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           D +  TEAA  ++KE++      +  +R+ +  GGC+G +Y      +   + D +I K+
Sbjct: 9   DPINFTEAASLKVKELIEEEGDNSLSLRVYITGGGCSGFQYAFAFDNEV-KEDDMIITKN 67

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GV++ +DS S  Y++G ++D+K +   + FV  NPN  + CGCG S  +
Sbjct: 68  GVRLLVDSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV 116


>gi|170723927|ref|YP_001751615.1| iron-sulfur cluster insertion protein ErpA [Pseudomonas putida
           W619]
 gi|169761930|gb|ACA75246.1| iron-sulfur cluster assembly accessory protein [Pseudomonas putida
           W619]
          Length = 132

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T  A  ++K +V         +R+ +  GGC+G +Y      ++  + D ++E++GV
Sbjct: 27  LEFTHGAAQKVKTLVSEEGNDRLKLRVFVTGGGCSGFQYGFTFD-EDVAEDDTIVEREGV 85

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S  Y+ G E+D++     S FV  NPN  + CGCG S  I
Sbjct: 86  SLVVDPMSFQYLAGAEVDYQEGLEGSRFVIKNPNAATTCGCGSSFSI 132


>gi|226314355|ref|YP_002774251.1| hypothetical protein BBR47_47700 [Brevibacillus brevis NBRC 100599]
 gi|226097305|dbj|BAH45747.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 119

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 64/106 (60%), Gaps = 1/106 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE+A  ++KE++         +R+ ++ GGC+G  Y +    +   +GD+  E++G
Sbjct: 1   MITLTESASLKVKEMLAAEGKPDVFLRVGVRTGGCSGFTYGMGWD-EEMKEGDETFEQNG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           VK+ +D  S  Y+ GT+IDFK   +  GF   NPN V++CGCG S 
Sbjct: 60  VKIVVDKDSYPYIKGTQIDFKESMMGGGFSIENPNAVASCGCGSSF 105


>gi|304321538|ref|YP_003855181.1| HesB/YadR/YfhF [Parvularcula bermudensis HTCC2503]
 gi|303300440|gb|ADM10039.1| HesB/YadR/YfhF [Parvularcula bermudensis HTCC2503]
          Length = 121

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 50/113 (44%), Positives = 76/113 (67%), Gaps = 1/113 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              +T+T+AA  R++EI+  +     G++I +K GGCAG+EY +D  TD     + + ++
Sbjct: 6   PKALTLTDAAAERMREIMAAADDAFIGVKIGVKNGGCAGMEYTMDYATDRAPLDEVVEDR 65

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            G+ + ID  ++L++LGTE+D+ TEKL S FVF+NPNQ  ACGCG+SV I  A
Sbjct: 66  -GITILIDPKAILFLLGTEVDYVTEKLSSRFVFNNPNQTDACGCGESVTIVPA 117


>gi|91794166|ref|YP_563817.1| iron-sulfur cluster insertion protein ErpA [Shewanella
           denitrificans OS217]
 gi|123356563|sp|Q12KD2|ERPA_SHEDO RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|91716168|gb|ABE56094.1| HesB/YadR/YfhF [Shewanella denitrificans OS217]
          Length = 116

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++K ++   Q     +R+ +  GGC+G +Y       +  D   +  K GV
Sbjct: 11  IKFTDAAAIKVKGLLEEEQNPELKLRVYVTGGGCSGFQYGFTFDEKSSADDFVIE-KQGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y++G E+D+ +    S F   NPN  S CGCG S  +
Sbjct: 70  KLVVDPMSLQYLVGGEVDYTSGLEGSRFFVKNPNASSTCGCGASFSV 116


>gi|84387616|ref|ZP_00990633.1| HesB family protein [Vibrio splendidus 12B01]
 gi|86145585|ref|ZP_01063915.1| HesB family protein [Vibrio sp. MED222]
 gi|218708631|ref|YP_002416252.1| HesB family protein [Vibrio splendidus LGP32]
 gi|84377461|gb|EAP94327.1| HesB family protein [Vibrio splendidus 12B01]
 gi|85836556|gb|EAQ54682.1| HesB family protein [Vibrio sp. MED222]
 gi|218321650|emb|CAV17602.1| HesB family protein [Vibrio splendidus LGP32]
          Length = 107

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT+ A  R++  + +++GK  G+R+++K  GC+G+ Y+++ V +   + +      GV
Sbjct: 3   ITMTDTAASRVQAFL-DNRGKGLGLRLAVKTTGCSGMAYVLEFVDELNEEDEVFEH-SGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDYVKEGLNEGFEFNNPNAKGECGCGESFNV 107


>gi|170747429|ref|YP_001753689.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653951|gb|ACB23006.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           radiotolerans JCM 2831]
          Length = 125

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 48/111 (43%), Positives = 75/111 (67%), Gaps = 1/111 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++++T+ A  RIK I+  +     G+R+ ++ GGCAG+ Y ++        G+D++E  
Sbjct: 6   KVLSLTDRAADRIKAIMAEADRPIAGLRVGVRNGGCAGMSYTMEYAEAA-KPGEDVVEDR 64

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
           GV+V++D  ++L++LGTE+DF T KL S FVF+NPNQ SACGCG+SV I  
Sbjct: 65  GVRVFVDPKAVLFLLGTEMDFTTNKLASQFVFNNPNQTSACGCGESVAITP 115


>gi|167626448|ref|YP_001676948.1| iron-sulfur cluster insertion protein ErpA [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
 gi|241668880|ref|ZP_04756458.1| iron-sulfur cluster insertion protein ErpA [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254877412|ref|ZP_05250122.1| iron-binding protein erpA [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|189037863|sp|B0TZ08|ERPA_FRAP2 RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|167596449|gb|ABZ86447.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|254843433|gb|EET21847.1| iron-binding protein erpA [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 116

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 62/109 (56%), Gaps = 1/109 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           D +  TE+A  ++KE++      +  +R+ +  GGC+G +Y      +   + D +I K+
Sbjct: 9   DPINFTESASLKVKELIEEEGDNSLSLRVYITGGGCSGFQYAFAFDNE-IKEDDMVITKN 67

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GV++ +DS S  Y++G ++D+K +   + FV  NPN  + CGCG S  +
Sbjct: 68  GVRLLVDSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV 116


>gi|315604565|ref|ZP_07879628.1| HesB/YadR/YfhF family protein [Actinomyces sp. oral taxon 180 str.
           F0310]
 gi|315313577|gb|EFU61631.1| HesB/YadR/YfhF family protein [Actinomyces sp. oral taxon 180 str.
           F0310]
          Length = 123

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 57/106 (53%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+ A  ++K ++         +RI+++ GGC+GL Y +     + +DGD +   DGV
Sbjct: 19  VTLTDVAAAKVKSLLEQEGRDDLRLRIAVQPGGCSGLIYQLYFDDRS-LDGDAVRSFDGV 77

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +V +D  S+ Y+ G  IDF       GF   NPN  + C CG+S  
Sbjct: 78  EVVVDRMSVPYLSGATIDFADTIERQGFTIDNPNAQNTCACGESFH 123


>gi|167837166|ref|ZP_02464049.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           thailandensis MSMB43]
          Length = 107

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGLGLRLGVRTTGCSGLAYKLEYVDEL-APEDQMFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVFVDPKSLAYIDGTELDFAREGLNEGFRFNNPNVKDECGCGESFRV 107


>gi|297571323|ref|YP_003697097.1| iron-sulfur cluster assembly accessory protein [Arcanobacterium
           haemolyticum DSM 20595]
 gi|296931670|gb|ADH92478.1| iron-sulfur cluster assembly accessory protein [Arcanobacterium
           haemolyticum DSM 20595]
          Length = 113

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 60/114 (52%), Gaps = 5/114 (4%)

Query: 1   MSDI----VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGD 56
           MS+I    V +T+ A  ++K ++         +R++++ GGC+GL Y +       +DGD
Sbjct: 1   MSEIATHAVNLTDVAAVKVKSLLEQEGRDDLRLRVAVQPGGCSGLMYQLYFDERL-LDGD 59

Query: 57  DLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            ++  DGV+V +D  S+ Y+ G  IDF       GF   NPN   +C CG+S  
Sbjct: 60  AVVNFDGVEVVVDRMSVPYLDGATIDFADTIERQGFTIDNPNAQGSCACGESFH 113


>gi|294083589|ref|YP_003550346.1| Iron-sulfur cluster assembly protein [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663161|gb|ADE38262.1| Iron-sulfur cluster assembly protein [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 116

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 71/110 (64%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             IVT+T+ A   ++ ++  ++    G+R+ +K  GC+G++Y V          +D +E+
Sbjct: 6   KPIVTLTDKAALHVQSLMNKAESDVIGLRVGIKTTGCSGMQYDVQFA-TEQKPFEDKVEE 64

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GV ++ID  ++++++G+E+D++ +K  + FVF+NPN+++ CGCG+S  +
Sbjct: 65  KGVTLFIDPTAVMFLIGSEMDWQEDKFAARFVFNNPNEIARCGCGESFSV 114


>gi|229844536|ref|ZP_04464676.1| hypothetical protein CGSHi6P18H1_09480 [Haemophilus influenzae
           6P18H1]
 gi|319896705|ref|YP_004134898.1| hypothetical protein HIBPF03230 [Haemophilus influenzae F3031]
 gi|229812785|gb|EEP48474.1| hypothetical protein CGSHi6P18H1_09480 [Haemophilus influenzae
           6P18H1]
 gi|317432207|emb|CBY80559.1| conserved hypothetical protein [Haemophilus influenzae F3031]
          Length = 107

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+K  + +++GK  G+R+ +K  GC+GL Y+++ V     +      + GV
Sbjct: 3   ITLTEKAAQRVKAFL-DNRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNSEDQVFE-QHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S +Y+ G E+D+  E L  GF ++NPN   +CGCG+S  +
Sbjct: 61  NIIVDPKSFVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV 107


>gi|193216384|ref|YP_001997583.1| iron-sulfur cluster assembly accessory protein [Chloroherpeton
           thalassium ATCC 35110]
 gi|193089861|gb|ACF15136.1| iron-sulfur cluster assembly accessory protein [Chloroherpeton
           thalassium ATCC 35110]
          Length = 108

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 62/109 (56%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++T+T+ A  ++K +          G+R+S+K GGC+GL Y +D   +   +GD + E  
Sbjct: 1   MITVTDKAAQQVKRLKTEQNLTDDFGLRVSVKGGGCSGLSYGLDFDNET-KNGDQVFEDK 59

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVKV++D  S LY+ GT +DF       GF F NPN    CGCG+S  +
Sbjct: 60  GVKVFVDMKSFLYLAGTTLDFSDGLNGKGFHFINPNANRTCGCGESFSV 108


>gi|329119441|ref|ZP_08248126.1| iron-sulfur cluster assembly protein IscA [Neisseria bacilliformis
           ATCC BAA-1200]
 gi|327464374|gb|EGF10674.1| iron-sulfur cluster assembly protein IscA [Neisseria bacilliformis
           ATCC BAA-1200]
          Length = 106

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A   I   +   +GK  G+R+ +K  GC+G+ Y ++ V +   +      + G
Sbjct: 1   MITITENAAKYINSYLTK-RGKGLGVRLGVKTSGCSGMAYNLEFVDEPNAEDLVFE-EHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            KV+ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 59  AKVFIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|37521674|ref|NP_925051.1| hypothetical protein gvip289 [Gloeobacter violaceus PCC 7421]
 gi|35212672|dbj|BAC90046.1| ycf57 [Gloeobacter violaceus PCC 7421]
          Length = 116

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 58/111 (52%), Gaps = 1/111 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A+  ++ +   S    Q +R+ +   GC+G+ Y +   T++  D      +DG
Sbjct: 1   MINLTETALQEVRRLQKKSGNDRQFLRLGVVNAGCSGMSYTMKFDTESRADDHLFD-QDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           V+V +D+ASL Y+    +D+  + +  GF FHNP+    CGCG S      
Sbjct: 60  VRVAVDAASLPYLGELTLDWSGDLMGGGFRFHNPSATHTCGCGSSFSTNPE 110


>gi|134296305|ref|YP_001120040.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           vietnamiensis G4]
 gi|134139462|gb|ABO55205.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           vietnamiensis G4]
          Length = 107

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYLV-RRGKGVGLRLGVRTTGCSGLAYKLEYVDEL-APEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|308174910|ref|YP_003921615.1| chaperone involved in Fe-S cluster assembly [Bacillus
           amyloliquefaciens DSM 7]
 gi|307607774|emb|CBI44145.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           amyloliquefaciens DSM 7]
 gi|328554917|gb|AEB25409.1| chaperone involved in Fe-S cluster assembly [Bacillus
           amyloliquefaciens TA208]
 gi|328913228|gb|AEB64824.1| putative chaperone involved in Fe-S cluster assembly [Bacillus
           amyloliquefaciens LL3]
          Length = 120

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  VT+TEAA   IK+++   + +   +R+ +K GGC+GL Y +    +          
Sbjct: 1   MSVPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKGEKDSLFE- 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           + G+ V +DS SL  M GT IDFK   +  GF   NPN +++CGCG S 
Sbjct: 60  QHGINVLVDSESLDIMNGTIIDFKQSMMGGGFTIDNPNAIASCGCGSSF 108


>gi|107028696|ref|YP_625791.1| iron-sulfur cluster assembly protein IscA [Burkholderia cenocepacia
           AU 1054]
 gi|105897860|gb|ABF80818.1| iron-sulfur cluster assembly protein IscA [Burkholderia cenocepacia
           AU 1054]
          Length = 107

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYLV-RRGKGVGLRLGVRTTGCSGLAYKLEYVDDL-APEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|298244865|ref|ZP_06968671.1| iron-sulfur cluster assembly accessory protein [Ktedonobacter
           racemifer DSM 44963]
 gi|297552346|gb|EFH86211.1| iron-sulfur cluster assembly accessory protein [Ktedonobacter
           racemifer DSM 44963]
          Length = 133

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++TMT  A  ++ E++        G+RI +  GGC+GL+Y + L  +   D    +   
Sbjct: 13  QVITMTPTAAVKVNELLQQENDPGLGLRIFVAGGGCSGLQYGMTLDEEQEGDTVINM--S 70

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           G+KV++D  S+ Y+ G+E+D+    + +GF  +NPN VS+CGCG S 
Sbjct: 71  GIKVFVDEMSISYINGSEVDYVDSLMGAGFTVNNPNAVSSCGCGHSF 117


>gi|37680911|ref|NP_935520.1| iron-sulfur cluster insertion protein ErpA [Vibrio vulnificus
           YJ016]
 gi|37199661|dbj|BAC95491.1| HesB family protein [Vibrio vulnificus YJ016]
          Length = 125

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 52/107 (48%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++ ++AA  R+K ++   +  A  +R+ +  GGC+G +Y              +    GV
Sbjct: 20  LSFSDAAATRVKMLIAEEENPALKLRVYITGGGCSGFQYGFTFDESVNEGDTTIEN-SGV 78

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 79  TLVVDPMSLQYLIGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 125


>gi|260775442|ref|ZP_05884339.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608623|gb|EEX34788.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio coralliilyticus ATCC BAA-450]
          Length = 118

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T ++AA  R+  ++   +     +R+ +  GGC+G +Y      ++  DGD  I   GV
Sbjct: 13  LTFSDAAAQRVGALIAEEENPNLKLRVYITGGGCSGFQYGFTFD-ESVNDGDTTIVNSGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G ++D+      S F  +NPN  + CGCG S  +
Sbjct: 72  TLVVDPMSLQYLVGGQVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 118


>gi|194099218|ref|YP_002002309.1| Putative iron-sulfur cluster insertion protein erpA [Neisseria
           gonorrhoeae NCCP11945]
 gi|291043266|ref|ZP_06568989.1| iron-sulfur cluster insertion protein ErpA [Neisseria gonorrhoeae
           DGI2]
 gi|293398585|ref|ZP_06642763.1| iron-sulfur cluster insertion protein ErpA [Neisseria gonorrhoeae
           F62]
 gi|193934508|gb|ACF30332.1| Putative iron-sulfur cluster insertion protein erpA [Neisseria
           gonorrhoeae NCCP11945]
 gi|291012872|gb|EFE04855.1| iron-sulfur cluster insertion protein ErpA [Neisseria gonorrhoeae
           DGI2]
 gi|291611056|gb|EFF40153.1| iron-sulfur cluster insertion protein ErpA [Neisseria gonorrhoeae
           F62]
 gi|317164753|gb|ADV08294.1| Putative iron-sulfur cluster insertion protein erpA [Neisseria
           gonorrhoeae TCDC-NG08107]
          Length = 153

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  T++   ++ +++         +R+ +  GGC+G +Y      +   D D  
Sbjct: 42  MSDESPIIFTDSCCAKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFD-EIKNDDDFE 100

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           IEK+G+   +D  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 101 IEKNGLVFLVDPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV 153


>gi|91205760|ref|YP_538115.1| Iron-sulfur cluster assembly accessory protein [Rickettsia bellii
           RML369-C]
 gi|157827114|ref|YP_001496178.1| Iron-sulfur cluster assembly accessory protein [Rickettsia bellii
           OSU 85-389]
 gi|91069304|gb|ABE05026.1| Iron-sulfur cluster assembly accessory protein [Rickettsia bellii
           RML369-C]
 gi|157802418|gb|ABV79141.1| Iron-sulfur cluster assembly accessory protein [Rickettsia bellii
           OSU 85-389]
          Length = 111

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 68/110 (61%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++++T++A  +++ ++        GIR+ +K GGCAG  Y V+   +     D+++E+
Sbjct: 3   KSVISLTDSAAKQVQLLIEKRNKPTYGIRVGVKSGGCAGQTYYVEYADNK-NQFDEVVEE 61

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GV++ ID  +L+Y+LG+E+D+   K  S F F NPN+ + CGCG+S  +
Sbjct: 62  KGVRILIDPKALMYILGSEMDYVETKFKSQFTFTNPNEKANCGCGKSFSV 111


>gi|154687328|ref|YP_001422489.1| YutM [Bacillus amyloliquefaciens FZB42]
 gi|154353179|gb|ABS75258.1| YutM [Bacillus amyloliquefaciens FZB42]
          Length = 120

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  VT+TEAA   IK+++   + +   +R+ +K GGC+GL Y +    +          
Sbjct: 1   MSVPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKGEKDSMFE- 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           + G+ V +DS SL  M GT IDFK   +  GF   NPN +++CGCG S 
Sbjct: 60  QHGITVLVDSESLDIMTGTIIDFKQSMMGGGFTIDNPNAIASCGCGSSF 108


>gi|162454146|ref|YP_001616513.1| hypothetical protein sce5870 [Sorangium cellulosum 'So ce 56']
 gi|161164728|emb|CAN96033.1| hypothetical protein sce5870 [Sorangium cellulosum 'So ce 56']
          Length = 107

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 59/108 (54%), Gaps = 1/108 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+ A  ++ EI    +   QG+R+ +  GGCAG  Y +          ++  ++ G
Sbjct: 1   MITITQKAAEKVMEIATAEELLGQGLRLRVVGGGCAGFSYDLYFEDKPTEFDEEFEDR-G 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +K++ID  S  Y+ GTEID+      SGF F NP+  S CGCG S  +
Sbjct: 60  IKLYIDPLSFQYLDGTEIDYVEGLHGSGFKFSNPSVKSTCGCGSSFSV 107


>gi|159466490|ref|XP_001691442.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii]
 gi|158279414|gb|EDP05175.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii]
          Length = 162

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 67/111 (60%), Gaps = 4/111 (3%)

Query: 5   VTMTEAAVYRIKEIVF--NSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI--E 60
           +T+T  A+ +++++      Q +A  +R+ +K+GGC+G+ Y++D  + + V  DD +   
Sbjct: 52  ITLTPEALVQLRKLRADFKEQSEAMLLRVGVKQGGCSGMSYVMDFESQDKVTDDDHVISY 111

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            DG ++ +D  SLLY+ G ++ + T  +  GF F NPN   +CGCG+S  +
Sbjct: 112 DDGFRLVVDPKSLLYLFGMQLGYSTALIGGGFQFQNPNATDSCGCGKSFGV 162


>gi|91228321|ref|ZP_01262250.1| HesB family protein [Vibrio alginolyticus 12G01]
 gi|262393365|ref|YP_003285219.1| putative iron binding protein [Vibrio sp. Ex25]
 gi|269966934|ref|ZP_06181006.1| hesB family protein [Vibrio alginolyticus 40B]
 gi|91188137|gb|EAS74440.1| HesB family protein [Vibrio alginolyticus 12G01]
 gi|262336959|gb|ACY50754.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio sp. Ex25]
 gi|269828417|gb|EEZ82679.1| hesB family protein [Vibrio alginolyticus 40B]
          Length = 113

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   ++ ++AA  R+K ++   +  A  +R+ +  GGC+G +Y      +       
Sbjct: 1   MSEVNVPLSFSDAAASRVKALIAEEENPALKLRVYITGGGCSGFQYGFTFDENVNEGDTT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++   GV + +D  SL Y++G  +D+      + F  +NPN  + CGCG S  +
Sbjct: 61  IVN-SGVTLVVDPMSLQYLVGGIVDYTEGLEGARFFVNNPNATTTCGCGASFSV 113


>gi|323492025|ref|ZP_08097190.1| iron-sulfur cluster insertion protein ErpA [Vibrio brasiliensis LMG
           20546]
 gi|323313754|gb|EGA66853.1| iron-sulfur cluster insertion protein ErpA [Vibrio brasiliensis LMG
           20546]
          Length = 113

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 57/114 (50%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   +T ++AA  R+  ++   +     +R+ +  GGC+G +Y      +       
Sbjct: 1   MSEVNIPLTFSDAAAQRVGALIAEEENPNLKLRVYITGGGCSGFQYGFTFDENVNEGDTT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++   GV + +D  SL Y++G ++D+      S F  +NPN  + CGCG S  +
Sbjct: 61  IVN-SGVTLVVDPMSLQYLVGGQVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|30249399|ref|NP_841469.1| iron-sulfur cluster insertion protein ErpA [Nitrosomonas europaea
           ATCC 19718]
 gi|75540519|sp|Q82UQ4|ERPA_NITEU RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|30138762|emb|CAD85339.1| Hypothetical hesB/yadR/yfhF family [Nitrosomonas europaea ATCC
           19718]
          Length = 121

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 1/109 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
             +  T+ A  ++KE++     +A  +R+ +  GGC+G +Y          D   +  K 
Sbjct: 14  PPLNFTDGAASKVKELIEEEDNQALKLRVFVSGGGCSGFQYGFTFDEIVNEDDFVME-KQ 72

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVK+ +DS S  Y++G EID++     + FV  NP+  S CGCG S  +
Sbjct: 73  GVKLLVDSMSFQYLVGAEIDYQESAQGAQFVIKNPSAASTCGCGSSFSV 121


>gi|323494807|ref|ZP_08099905.1| HesB family protein [Vibrio brasiliensis LMG 20546]
 gi|323310947|gb|EGA64113.1| HesB family protein [Vibrio brasiliensis LMG 20546]
          Length = 107

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE A  R++  + N +GK  G+R+ +K  GC+G+ Y+++ V +   +       +GV
Sbjct: 3   ITMTETAASRVRTFLEN-RGKGIGLRLGVKTTGCSGMAYVLEFVDELNEEDSVFEH-EGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDQKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|269961963|ref|ZP_06176318.1| hesB family protein [Vibrio harveyi 1DA3]
 gi|269833286|gb|EEZ87390.1| hesB family protein [Vibrio harveyi 1DA3]
          Length = 113

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   ++ ++AA  R++ ++   +  A  +R+ +  GGC+G +Y      +       
Sbjct: 1   MSEVNVPLSFSDAAASRVQTLIAEEENPALKLRVYITGGGCSGFQYGFTFDENVNEGDTT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++   GV + +D  SL Y++G  +D+      + F  +NPN  + CGCG S  +
Sbjct: 61  IVN-SGVTLVVDPMSLQYLIGGVVDYTEGLEGARFFVNNPNATTTCGCGASFSV 113


>gi|298368421|ref|ZP_06979739.1| iron-sulfur cluster assembly protein IscA [Neisseria sp. oral taxon
           014 str. F0314]
 gi|298282424|gb|EFI23911.1| iron-sulfur cluster assembly protein IscA [Neisseria sp. oral taxon
           014 str. F0314]
          Length = 106

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A   I   +   +GK  G+R+ +K  GC+G+ Y ++ V +   +      + G
Sbjct: 1   MITITENAAKYINNYLTK-RGKGLGVRLGVKTSGCSGMAYNLEFVDEASAEDLVFE-EHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 59  ARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|256079122|ref|XP_002575839.1| hypothetical protein [Schistosoma mansoni]
 gi|238661090|emb|CAZ32074.1| hypothetical protein Smp_045150 [Schistosoma mansoni]
          Length = 168

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 70/107 (65%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T++AV R  +++     KA G+RI ++  GC GL Y +D   +    GD+++E+D V
Sbjct: 63  LTLTKSAVARALQLL-QMNPKATGLRIGVRTRGCNGLSYTLDFCFEGRQPGDEVVEQDNV 121

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +++ID  + L +LGTE+D++ + L S FVF+NPN    CGCG+S  +
Sbjct: 122 RIFIDRRAQLTLLGTEMDYQQDVLSSQFVFNNPNIKGTCGCGESFSV 168


>gi|312883998|ref|ZP_07743715.1| iron-sulfur cluster insertion protein ErpA [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309368456|gb|EFP95991.1| iron-sulfur cluster insertion protein ErpA [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 113

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   +T ++AA  R+  ++   +     +R+ +  GGC+G +Y              
Sbjct: 1   MSEVNIPLTFSDAAAQRVGALIAEEENPNLKLRVYITGGGCSGFQYGFTFDESVNEGDTT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++   GV + +D  SL Y++G ++D+      S F  +NPN  + CGCG S  +
Sbjct: 61  IVN-SGVTLVVDPMSLQYLVGGQVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|225076508|ref|ZP_03719707.1| hypothetical protein NEIFLAOT_01554 [Neisseria flavescens
           NRL30031/H210]
 gi|261380299|ref|ZP_05984872.1| iron-sulfur cluster assembly protein IscA [Neisseria subflava
           NJ9703]
 gi|224952187|gb|EEG33396.1| hypothetical protein NEIFLAOT_01554 [Neisseria flavescens
           NRL30031/H210]
 gi|284796812|gb|EFC52159.1| iron-sulfur cluster assembly protein IscA [Neisseria subflava
           NJ9703]
          Length = 106

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A   I   +   +GK  G+R+ +K  GC+G+ Y ++ V +   D      + G
Sbjct: 1   MITITENAAKYINNYLTK-RGKGLGVRLGVKTSGCSGMAYNLEFVDEANEDDLIFE-EHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 59  ARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|31745170|ref|NP_853657.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Rattus norvegicus]
 gi|81170640|sp|Q80W96|ISCA1_RAT RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|30269948|gb|AAP29778.1| HesB protein [Rattus norvegicus]
 gi|47482102|gb|AAH70929.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Rattus
           norvegicus]
 gi|50926756|gb|AAH78677.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Rattus
           norvegicus]
 gi|149039760|gb|EDL93876.1| rCG24212 [Rattus norvegicus]
          Length = 129

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK+++ +   +  G+++ ++  GC GL Y ++         +++I +DGV
Sbjct: 25  LTLTPSAVNKIKQLLKDK-PEHVGLKVGVRTRGCNGLSYSLEYTKTKGDADEEVI-QDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  +
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNV 129


>gi|167563356|ref|ZP_02356272.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           oklahomensis EO147]
 gi|167570526|ref|ZP_02363400.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           oklahomensis C6786]
          Length = 107

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D+    D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGLGLRLGVRTTGCSGLAYKLEYV-DDCAVEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVFVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|28899248|ref|NP_798853.1| iron-sulfur cluster insertion protein ErpA [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|153838410|ref|ZP_01991077.1| HesB family protein [Vibrio parahaemolyticus AQ3810]
 gi|260362170|ref|ZP_05775160.1| iron-sulfur cluster insertion protein ErpA [Vibrio parahaemolyticus
           K5030]
 gi|260879058|ref|ZP_05891413.1| iron-sulfur cluster insertion protein ErpA [Vibrio parahaemolyticus
           AN-5034]
 gi|260895933|ref|ZP_05904429.1| iron-sulfur cluster insertion protein ErpA [Vibrio parahaemolyticus
           Peru-466]
 gi|260903444|ref|ZP_05911839.1| iron-sulfur cluster insertion protein ErpA [Vibrio parahaemolyticus
           AQ4037]
 gi|81726992|sp|Q87LY4|ERPA_VIBPA RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|28807472|dbj|BAC60737.1| HesB family protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|149748217|gb|EDM59076.1| HesB family protein [Vibrio parahaemolyticus AQ3810]
 gi|308085378|gb|EFO35073.1| iron-sulfur cluster insertion protein ErpA [Vibrio parahaemolyticus
           Peru-466]
 gi|308089629|gb|EFO39324.1| iron-sulfur cluster insertion protein ErpA [Vibrio parahaemolyticus
           AN-5034]
 gi|308106581|gb|EFO44121.1| iron-sulfur cluster insertion protein ErpA [Vibrio parahaemolyticus
           AQ4037]
 gi|308111064|gb|EFO48604.1| iron-sulfur cluster insertion protein ErpA [Vibrio parahaemolyticus
           K5030]
 gi|328474217|gb|EGF45022.1| iron-sulfur cluster insertion protein ErpA [Vibrio parahaemolyticus
           10329]
          Length = 113

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/114 (31%), Positives = 62/114 (54%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   ++ ++AA  R+K ++   +  A  +R+ +  GGC+G +Y      +N  DGD 
Sbjct: 1   MSEVNVPLSFSDAAASRVKALIAEEENPALKLRVYITGGGCSGFQYGFTFD-ENVNDGDT 59

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IE  GV + +D  SL Y++G  +D+      + F  +NPN  + CGCG S  +
Sbjct: 60  TIENSGVTLVVDPMSLQYLIGGIVDYTEGLEGARFFVNNPNATTTCGCGASFSV 113


>gi|326317575|ref|YP_004235247.1| iron-sulfur cluster assembly protein IscA [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323374411|gb|ADX46680.1| iron-sulfur cluster assembly protein IscA [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 107

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA   +   + + +GK  G+R+ +K  GC+GL Y ++ V       D + E  GV
Sbjct: 3   ITLTEAAARHVSRYL-SRRGKGLGVRLGVKTTGCSGLAYKLEYVDAP-EPEDVVFEDHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GT++DF  E L  GF F+NPN+   CGCG+S  +
Sbjct: 61  KVLIDPKSLAYIDGTQLDFVREGLNEGFRFNNPNERDRCGCGESFRV 107


>gi|332260003|ref|XP_003279075.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Nomascus leucogenys]
          Length = 176

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK+++ +   +  G+++ ++  GC GL Y ++         +++I +DGV
Sbjct: 72  LTLTPSAVNKIKQLLKDK-PEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVI-QDGV 129

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 130 RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 176


>gi|332233919|ref|XP_003266153.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Nomascus leucogenys]
          Length = 216

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK+++ +   +  G+++ ++  GC GL Y ++         +++I +DGV
Sbjct: 112 LTLTPSAVNKIKQLLKDK-PEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVI-QDGV 169

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 170 RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 216


>gi|119583117|gb|EAW62713.1| HESB like domain containing 2, isoform CRA_b [Homo sapiens]
 gi|194382184|dbj|BAG58847.1| unnamed protein product [Homo sapiens]
          Length = 176

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK+++ +   +  G+++ ++  GC GL Y ++         +++I +DGV
Sbjct: 72  LTLTPSAVNKIKQLLKDK-PEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVI-QDGV 129

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 130 RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 176


>gi|21740005|emb|CAD39021.1| hypothetical protein [Homo sapiens]
          Length = 149

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK+++ +   +  G+++ ++  GC GL Y ++         +++I +DGV
Sbjct: 45  LTLTPSAVNKIKQLLKDK-PEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVI-QDGV 102

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 103 RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 149


>gi|319943703|ref|ZP_08017984.1| iron-sulfur cluster assembly protein IscA [Lautropia mirabilis ATCC
           51599]
 gi|319742936|gb|EFV95342.1| iron-sulfur cluster assembly protein IscA [Lautropia mirabilis ATCC
           51599]
          Length = 107

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TEAA   I   +   +GK  G+R+ +K  GC+GL Y ++                GV
Sbjct: 3   VTLTEAAARHIDRYIA-RRGKGIGLRLGVKTSGCSGLSYKLEYADSQQESDLVFE-SHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+ID  SL Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  I
Sbjct: 61  RVFIDPKSLAYIDGTELDFVREGLNEGFKFNNPNVRNECGCGESFNI 107


>gi|29841436|gb|AAP06468.1| similar to CG8198 gene product in Drosophila melanogaster
           [Schistosoma japonicum]
 gi|164609131|gb|ABY62788.1| P16 protein [Schistosoma japonicum]
          Length = 168

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 72/107 (67%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T++AV R +E++     KA G+RI ++  GC GL Y +D   + P  GD+++E+D V
Sbjct: 63  LTLTKSAVARAQELLRK-NPKAIGLRIGVRTRGCNGLSYTLDFCFEGPQPGDEVVEQDSV 121

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +++ID  + L +LGTE+D++ + L S FVF+NPN    CGCG+S  +
Sbjct: 122 RIFIDRRAQLTLLGTEMDYQKDVLSSQFVFNNPNIKGTCGCGESFSV 168


>gi|21312189|ref|NP_081197.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Mus musculus]
 gi|81170639|sp|Q9D924|ISCA1_MOUSE RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|12840954|dbj|BAB25025.1| unnamed protein product [Mus musculus]
 gi|17391301|gb|AAH18547.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Mus
           musculus]
 gi|26337127|dbj|BAC32248.1| unnamed protein product [Mus musculus]
 gi|26354821|dbj|BAC41037.1| unnamed protein product [Mus musculus]
 gi|55250324|gb|AAH85482.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Mus
           musculus]
 gi|74139353|dbj|BAE40820.1| unnamed protein product [Mus musculus]
 gi|74149091|dbj|BAE32196.1| unnamed protein product [Mus musculus]
 gi|148709345|gb|EDL41291.1| HESB like domain containing 2 [Mus musculus]
          Length = 129

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK+++ +   +  G+++ ++  GC GL Y ++         +++I +DGV
Sbjct: 25  LTLTPSAVNKIKQLLKDK-PEHVGLKVGVRTRGCNGLSYSLEYTKTKGDSDEEVI-QDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  +
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFHV 129


>gi|148979598|ref|ZP_01815603.1| HesB family protein [Vibrionales bacterium SWAT-3]
 gi|145961683|gb|EDK26980.1| HesB family protein [Vibrionales bacterium SWAT-3]
          Length = 107

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT+ A  R++  + +++GK  G+R+++K  GC+G+ Y+++ V +   +        GV
Sbjct: 3   ITMTDTAASRVQAFL-DNRGKGIGLRLAVKTTGCSGMAYVLEFVDELNEEDQVFEH-SGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDYVKEGLNEGFEFNNPNAKGGCGCGESFNV 107


>gi|241763767|ref|ZP_04761814.1| iron-sulfur cluster assembly protein IscA [Acidovorax delafieldii
           2AN]
 gi|241366986|gb|EER61382.1| iron-sulfur cluster assembly protein IscA [Acidovorax delafieldii
           2AN]
          Length = 107

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA   +   +   +GK  G+R+ +K  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEAAARHVTRYLA-RRGKGLGVRLGVKTTGCSGLAYKLEYVDDA-EPEDIVFENHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+DF  E L  GF F+NPN+   CGCG+S  +
Sbjct: 61  KVLIDPKSLAYIDGTELDFVREGLNEGFRFNNPNERDRCGCGESFRV 107


>gi|114331529|ref|YP_747751.1| iron-sulfur cluster insertion protein ErpA [Nitrosomonas eutropha
           C91]
 gi|122313675|sp|Q0AFU6|ERPA_NITEC RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|114308543|gb|ABI59786.1| iron-sulfur cluster assembly accessory protein [Nitrosomonas
           eutropha C91]
          Length = 121

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 60/105 (57%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T++A  ++KE++     +A  +R+ +  GGC+G +Y      +   + D +IEK GV++
Sbjct: 18  FTDSAASKVKELIEEEANQALKLRVFVSGGGCSGFQYGFTFD-EIINEDDFVIEKQGVRL 76

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +DS S+ Y+LG EID++     + FV  NP   S CGCG S  +
Sbjct: 77  LVDSMSVQYLLGAEIDYQENAQGAQFVIKNPAAASTCGCGSSFSV 121


>gi|319779389|ref|YP_004130302.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Taylorella equigenitalis MCE9]
 gi|317109413|gb|ADU92159.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Taylorella equigenitalis MCE9]
          Length = 107

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE A   + + +   +GK  G+R+ +K  GC+G+ Y ++   +  +          V
Sbjct: 3   VTLTERAAQHVIKSIKK-RGKGIGLRVGVKTSGCSGMAYKLEYADEQDIADSVFE-SHNV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V++D+ SL Y+ GTE+DF  E L  GF F NPN+ ++CGCG+S  +
Sbjct: 61  RVFVDAKSLPYIDGTELDFVREGLNEGFKFKNPNEKASCGCGESFSV 107


>gi|296189815|ref|XP_002742931.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Callithrix jacchus]
          Length = 176

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV +IK+++ +   +  G+++ ++  GC GL Y ++         +++I +DGV
Sbjct: 72  LTLTPAAVNKIKQLLKDK-PEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVI-QDGV 129

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 130 RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 176


>gi|121609332|ref|YP_997139.1| iron-sulfur cluster assembly protein IscA [Verminephrobacter
           eiseniae EF01-2]
 gi|121553972|gb|ABM58121.1| iron-sulfur cluster assembly protein IscA [Verminephrobacter
           eiseniae EF01-2]
          Length = 107

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA   +   +   +GK  G+R+ ++  GC+GL Y ++ V D   +        GV
Sbjct: 3   ITLTQAAARHVSRYLA-RRGKGLGVRLGVRTTGCSGLAYKLEYVDDAAPEDIVFEH-HGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+DF  E L  GF F+NPN+   CGCG+S  +
Sbjct: 61  KVLIDPKSLAYIDGTELDFVREGLNEGFKFNNPNERDRCGCGESFRV 107


>gi|149263924|ref|XP_484225.3| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Mus musculus]
 gi|149264021|ref|XP_985754.2| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Mus musculus]
 gi|56206095|emb|CAI25004.1| HESB like domain containing 2 [Mus musculus]
 gi|148700701|gb|EDL32648.1| mCG50313 [Mus musculus]
          Length = 129

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK+++ +   +  G+++ ++  GC GL Y ++         +++I +DGV
Sbjct: 25  LTLTPSAVNKIKQLLKDK-PEHVGLKVGVRTRGCNGLSYSLEYTKTKGDSDEEVI-QDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  +
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFHV 129


>gi|189503018|gb|ACE06890.1| unknown [Schistosoma japonicum]
          Length = 168

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 72/107 (67%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T++AV R +E++     KA G+RI ++  GC GL Y +D   + P  GD+++E+D V
Sbjct: 63  LTLTKSAVARAQELLRK-NPKAIGLRIGVRTRGCNGLSYTLDFCFEGPQPGDEVVEQDSV 121

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +++ID  + L +LGTE+D++ + L S FVF+NPN    CGCG+S  +
Sbjct: 122 RIFIDRRAQLTLLGTEMDYQKDVLSSQFVFNNPNIKGTCGCGESFSV 168


>gi|254251968|ref|ZP_04945286.1| HesB/YadR/YfhF [Burkholderia dolosa AUO158]
 gi|124894577|gb|EAY68457.1| HesB/YadR/YfhF [Burkholderia dolosa AUO158]
          Length = 115

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +     D + E  GV
Sbjct: 11  ITLTEKAAQHVQKYLV-RRGKGVGLRLGVRTTGCSGLAYKLEYVDEL-APEDQVFESHGV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 69  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 115


>gi|118589102|ref|ZP_01546509.1| hypothetical protein SIAM614_13658 [Stappia aggregata IAM 12614]
 gi|118438431|gb|EAV45065.1| hypothetical protein SIAM614_13658 [Stappia aggregata IAM 12614]
          Length = 125

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 55/114 (48%), Positives = 85/114 (74%), Gaps = 1/114 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++T+T+AA  R+KE+V NS   A G+R+ +KKGGCAG+EY +++V       D + +K 
Sbjct: 8   QVMTLTDAAAERVKELVENSDKNAIGLRVGIKKGGCAGMEYTMEMVDAARPGDDTVEDK- 66

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           G K+++D +++L++LGTE+DF+  K  SGF+F NPN+VSACGCG+SV ++ ADL
Sbjct: 67  GAKLFVDPSAVLFLLGTEMDFEVTKFRSGFIFKNPNEVSACGCGESVSLQAADL 120


>gi|15965483|ref|NP_385836.1| hypothetical protein SMc00301 [Sinorhizobium meliloti 1021]
 gi|307302604|ref|ZP_07582360.1| FeS assembly scaffold SufA [Sinorhizobium meliloti BL225C]
 gi|307318451|ref|ZP_07597885.1| FeS assembly scaffold SufA [Sinorhizobium meliloti AK83]
 gi|15074664|emb|CAC46309.1| Putative FeS assembly scaffold [Sinorhizobium meliloti 1021]
 gi|306895791|gb|EFN26543.1| FeS assembly scaffold SufA [Sinorhizobium meliloti AK83]
 gi|306902968|gb|EFN33559.1| FeS assembly scaffold SufA [Sinorhizobium meliloti BL225C]
          Length = 130

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 67/113 (59%), Positives = 90/113 (79%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++T+AA  R++ IV N+ G+A+GIRIS+KKGGCAG+EY VDLV   P   DDLIE+ G
Sbjct: 5   VMSLTDAAASRVRSIVENAGGEAKGIRISIKKGGCAGMEYAVDLV-SEPNSKDDLIEQQG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            KVW+   ++LY+LGT++DF+T  L SGF F+NPNQ SACGCG+SVE+K ADL
Sbjct: 64  AKVWVAPEAVLYLLGTQMDFETTTLRSGFTFNNPNQTSACGCGESVELKPADL 116


>gi|261377483|ref|ZP_05982056.1| iron-sulfur cluster assembly protein IscA [Neisseria cinerea ATCC
           14685]
 gi|269146212|gb|EEZ72630.1| iron-sulfur cluster assembly protein IscA [Neisseria cinerea ATCC
           14685]
          Length = 106

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A   I   +   +GK  G+R+ +K  GC+G+ Y ++ V +   D      + G
Sbjct: 1   MITITENAAKYINNYL-TRRGKGLGVRLGVKTSGCSGMAYNLEFVDEANEDDLIFE-EHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 59  ARIYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV 106


>gi|120611116|ref|YP_970794.1| iron-sulfur cluster assembly protein IscA [Acidovorax citrulli
           AAC00-1]
 gi|120589580|gb|ABM33020.1| iron-sulfur cluster assembly protein IscA [Acidovorax citrulli
           AAC00-1]
          Length = 107

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA   +   + + +GK  G+R+ +K  GC+GL Y ++ V +     D + E  GV
Sbjct: 3   ITLTEAAARHVSRYL-SRRGKGLGVRLGVKTTGCSGLAYKLEYVDEP-EPEDVIFEDHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GT++DF  E L  GF F+NPN+   CGCG+S  +
Sbjct: 61  KVLIDPKSLAYIDGTQLDFVREGLNEGFRFNNPNERDRCGCGESFRV 107


>gi|41582354|gb|AAS07968.1| iron-sulfur cluster assembly accessory protein, putative
           [uncultured marine bacterium 463]
          Length = 117

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 62/107 (57%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + ++ +AV +++E+V   + KA  +R+ +  GGC+G +Y      ++  + D  IE+ GV
Sbjct: 12  INLSASAVRKVQELVSEEENKALKLRVYITGGGCSGFQYGFSFD-EDVAEDDTAIEEGGV 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S  Y++G+E+D+      S F+ +NPN  + CGCG S  I
Sbjct: 71  TLLVDPMSFQYLVGSEVDYTEGLEGSRFIVNNPNATTTCGCGASFSI 117


>gi|121594491|ref|YP_986387.1| iron-sulfur cluster assembly protein IscA [Acidovorax sp. JS42]
 gi|222110834|ref|YP_002553098.1| iron-sulfur cluster assembly protein isca [Acidovorax ebreus TPSY]
 gi|120606571|gb|ABM42311.1| iron-sulfur cluster assembly protein IscA [Acidovorax sp. JS42]
 gi|221730278|gb|ACM33098.1| iron-sulfur cluster assembly protein IscA [Acidovorax ebreus TPSY]
          Length = 107

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA   +   +   +GK  G+R+ +K  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEAAARHVTRYLA-RRGKGVGVRLGVKTTGCSGLAYKLEYV-DEQAPEDVVFENHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+DF  E L  GF F+NPN+   CGCG+S  +
Sbjct: 61  KVLIDPKSLAYIDGTELDFVREGLNEGFRFNNPNERDRCGCGESFRV 107


>gi|187924554|ref|YP_001896196.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           phytofirmans PsJN]
 gi|187715748|gb|ACD16972.1| iron-sulfur cluster assembly protein IscA [Burkholderia
           phytofirmans PsJN]
          Length = 107

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ + N +GK  G+R+ ++  GC+GL Y ++ V +   + +     +GV
Sbjct: 3   ITLTEKAAQHVQKYL-NRRGKGVGLRVGVRTTGCSGLAYKLEYVDELAPEDEVFEC-NGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KLIVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|301610979|ref|XP_002935018.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Xenopus (Silurana) tropicalis]
          Length = 129

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV ++K+++   +    G++++++  GC GL Y ++         ++++ +DGV
Sbjct: 25  LTLTPAAVNKVKKLL-QDKPDNIGLKVAVRTRGCNGLSYYLEYAKSKGPSDEEVV-QDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|299134948|ref|ZP_07028139.1| iron-sulfur cluster assembly accessory protein [Afipia sp. 1NLS2]
 gi|298589925|gb|EFI50129.1| iron-sulfur cluster assembly accessory protein [Afipia sp. 1NLS2]
          Length = 109

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 61/111 (54%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  VT++E A  RI EI+         +RIS++ GGC+G +Y  D+      D   ++ 
Sbjct: 1   MTANVTISERAARRIGEILKGEG-DGAKLRISVEGGGCSGFQYKFDIDKTQAEDDLVIVR 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + V V +D +S  ++  +E+DF  + + + F  +NPN  ++CGCG S  I
Sbjct: 60  DNAV-VLVDPSSAPFLADSELDFVDDLIGASFRVNNPNATASCGCGTSFSI 109


>gi|31206473|ref|XP_312196.1| AGAP002730-PA [Anopheles gambiae str. PEST]
 gi|21295988|gb|EAA08133.1| AGAP002730-PA [Anopheles gambiae str. PEST]
          Length = 130

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 42/111 (37%), Positives = 66/111 (59%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +++T AAV RIK+++     +  G+++ +++ GC GL Y +D         D+ + 
Sbjct: 22  MRAALSLTPAAVNRIKQLLEGK-NEFIGLKVGVRQRGCNGLSYTLDYAATKDK-MDEEVV 79

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +DGVKV ID  + L +LGTE+D+    L + FVF+NPN    CGCG+S  I
Sbjct: 80  QDGVKVLIDKKAQLSLLGTEMDYVETDLSAEFVFNNPNIKGTCGCGESFSI 130


>gi|145632623|ref|ZP_01788357.1| co-chaperone HscB [Haemophilus influenzae 3655]
 gi|144986818|gb|EDJ93370.1| co-chaperone HscB [Haemophilus influenzae 3655]
          Length = 107

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+K  + +++GK  G+R+ +K  GC+GL Y+++ V     +        GV
Sbjct: 3   ITLTEKAAQRVKAFL-DNRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNSEDQVFEL-HGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S +Y+ G E+D+  E L  GF ++NPN   +CGCG+S  +
Sbjct: 61  NIIVDPKSFVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV 107


>gi|302835421|ref|XP_002949272.1| iron-sulfur cluster assembly protein [Volvox carteri f.
           nagariensis]
 gi|300265574|gb|EFJ49765.1| iron-sulfur cluster assembly protein [Volvox carteri f.
           nagariensis]
          Length = 155

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 63/110 (57%), Gaps = 3/110 (2%)

Query: 5   VTMTEAAVYRIKEIVFN-SQGKAQGIRISLKKGGCAGLEYMVDLVTDNP--VDGDDLIEK 61
           +T+T  A+ +++++       ++  +R+ +K+GGC+GL Y +D  T +    D   +   
Sbjct: 46  ITLTAEALEQLRKLRAEHKNQESLLLRVGVKQGGCSGLSYHMDFETQDKVSEDDHVMSYD 105

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DG ++ +D  SLLY+ G  + + +  +  GF FHNPN   +CGCG+S  +
Sbjct: 106 DGFRLVVDPKSLLYLFGMRLGYSSALIGGGFQFHNPNATDSCGCGKSFGV 155


>gi|110638909|ref|YP_679118.1| iron-sulfur cluster assembly scaffold protein [Cytophaga
           hutchinsonii ATCC 33406]
 gi|110281590|gb|ABG59776.1| scaffold protein for iron-sulfur cluster assembly [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 108

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 58/109 (53%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++++T+ A   + ++       +   IR+S+K GGC+GL Y +D             +K 
Sbjct: 1   MISITDKAKNHVADLRAREGYTEEYNIRVSVKGGGCSGLMYDLDFDNKIDEADQVFEDK- 59

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVK+ +D  SLLY+LGT +DF       GF F NPN    CGCG+S  +
Sbjct: 60  GVKILVDKKSLLYLLGTTLDFTDGLNGKGFHFVNPNASRTCGCGESFSV 108


>gi|325265722|ref|ZP_08132411.1| iron-sulfur cluster assembly accessory protein [Kingella
           denitrificans ATCC 33394]
 gi|324982853|gb|EGC18476.1| iron-sulfur cluster assembly accessory protein [Kingella
           denitrificans ATCC 33394]
          Length = 133

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  T++   ++ +++         +R+ +  GGC+G +Y      +   D D  
Sbjct: 22  MSDESPIIFTDSCCAKVADLIAEENNPDLMLRVFVNGGGCSGFQYGFTFD-EIKNDDDFQ 80

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           IEK+G+   +D  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 81  IEKNGLTFLVDPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV 133


>gi|323499939|ref|ZP_08104898.1| HesB family protein [Vibrio sinaloensis DSM 21326]
 gi|323315180|gb|EGA68232.1| HesB family protein [Vibrio sinaloensis DSM 21326]
          Length = 107

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE A  R++  + N +GK  G+R+ +K  GC+G+ Y+++ V +   +        GV
Sbjct: 3   ITMTETAASRVRTFLEN-RGKGIGLRLGVKTTGCSGMAYVLEFVDELNEEDSVFEHA-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDQKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|304414075|ref|ZP_07395443.1| putative iron-sulfur cluster biosynthesis protein [Candidatus
           Regiella insecticola LSR1]
 gi|304283289|gb|EFL91685.1| putative iron-sulfur cluster biosynthesis protein [Candidatus
           Regiella insecticola LSR1]
          Length = 115

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V  TEAA  ++K ++         +R+ +  GGC+G +Y      +   DGD  IEK GV
Sbjct: 10  VQFTEAAANKVKRLIDYENNPRLKLRVYITGGGCSGFQYGFTFD-EKINDGDMTIEKQGV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F+  NPN  + CGCG S  I
Sbjct: 69  VLVVDPMSLQYLVGGAVDYTEGLEGSRFIVSNPNAKTTCGCGSSFSI 115


>gi|262274961|ref|ZP_06052772.1| probable iron binding protein from the HesB_IscA_SufA family
           [Grimontia hollisae CIP 101886]
 gi|262221524|gb|EEY72838.1| probable iron binding protein from the HesB_IscA_SufA family
           [Grimontia hollisae CIP 101886]
          Length = 125

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TE A  ++K ++   +     +R+ +  GGC+G +Y      +N  DGD  IEK GV
Sbjct: 20  LQFTETAANKVKTLIQEEENPNLKLRVYITGGGCSGFQYGFTFD-ENVNDGDMTIEKCGV 78

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G E+D+      S F  +NPN  + CGCG S  +
Sbjct: 79  TLVVDPMSLQYLIGGEVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 125


>gi|209885132|ref|YP_002288989.1| iron-sulfur cluster assembly accessory protein [Oligotropha
           carboxidovorans OM5]
 gi|209873328|gb|ACI93124.1| iron-sulfur cluster assembly accessory protein [Oligotropha
           carboxidovorans OM5]
          Length = 135

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 77/114 (67%), Gaps = 1/114 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++ +TEAA  R++E+   +  +  G+R+ +K GGCAG+EY V+   D     + + +K
Sbjct: 20  PQVMRLTEAAASRVRELASRADSEIIGLRVGIKNGGCAGMEYTVEYAHDVRPTDEVVEDK 79

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            GVK+ +D  ++L++LGTE+DFK +K+ + FVF+NPNQ  ACGCG+SV++  A 
Sbjct: 80  -GVKILVDPKAVLFLLGTEMDFKVDKMAAQFVFNNPNQTGACGCGESVQLTPAK 132


>gi|329123598|ref|ZP_08252158.1| iron-sulfur cluster assembly protein IscA [Haemophilus aegyptius
           ATCC 11116]
 gi|327469797|gb|EGF15262.1| iron-sulfur cluster assembly protein IscA [Haemophilus aegyptius
           ATCC 11116]
          Length = 107

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +TE A  R+K  + +++GK  G+R+ +K  GC+GL Y+++ V     +      + GV
Sbjct: 3   IALTEKAAQRVKAFL-DNRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNSEDQVFE-QHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL+Y+ G E+D+  E L  GF ++NPN   +CGCG+S  +
Sbjct: 61  NIIVDPKSLVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV 107


>gi|296412404|ref|XP_002835914.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295629711|emb|CAZ80071.1| unnamed protein product [Tuber melanosporum]
          Length = 188

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/113 (34%), Positives = 62/113 (54%), Gaps = 3/113 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   + +++ A  R+KEI          +RI+++ GGC G +Y + L      + D + E
Sbjct: 76  MK--IDISQRAAKRLKEIQLKDSNPNLALRITVESGGCHGFKYTISLSDTFDEEEDTVFE 133

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVF-HNPNQVSACGCGQSVEIK 112
           +DG KV +D  SL  +  + ID+ TE + S F   +NP+  S+CGCG S +IK
Sbjct: 134 EDGAKVVMDEPSLGLLKDSTIDYTTELIGSQFRIANNPHATSSCGCGTSFDIK 186


>gi|262371164|ref|ZP_06064485.1| iron-sulfur cluster assembly accessory protein [Acinetobacter
           johnsonii SH046]
 gi|262313894|gb|EEY94940.1| iron-sulfur cluster assembly accessory protein [Acinetobacter
           johnsonii SH046]
          Length = 111

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 30/112 (26%), Positives = 58/112 (51%), Gaps = 2/112 (1%)

Query: 1   MS-DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M+   + +++ A  +++++  +   +   +R+ +  GGC+G  Y  +   +   D  + I
Sbjct: 1   MNAQALELSDNAANKVRQLRDSEGNQDLMLRVYVTGGGCSGFSYGFNFAENQNEDDAEFI 60

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             D VK+ +DS S  Y++G+ +D+      S F+  NPN  + CGCG S  I
Sbjct: 61  NGD-VKMLVDSLSYQYLVGSVVDYIEGLEGSRFIVQNPNATTTCGCGSSFSI 111


>gi|254361066|ref|ZP_04977211.1| HesB family iron-sulfur (Fe-S) cluster formation protein
           [Mannheimia haemolytica PHL213]
 gi|261493607|ref|ZP_05990127.1| hesB family protein [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261495445|ref|ZP_05991893.1| hesB family protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153092552|gb|EDN73607.1| HesB family iron-sulfur (Fe-S) cluster formation protein
           [Mannheimia haemolytica PHL213]
 gi|261308950|gb|EEY10205.1| hesB family protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261310789|gb|EEY11972.1| hesB family protein [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 107

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 45/111 (40%), Positives = 67/111 (60%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  +T+TEAA  R++  + N +GK  G+R+ +K  GC+GL Y+++ V     D      
Sbjct: 1   MS--ITLTEAAANRVRTFLEN-RGKGIGLRLGVKTSGCSGLAYVLEFVDVLNEDDQVFE- 56

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GVKV +D  SL Y+ GT++DF  E L  GF + NPN  + CGCG+S  +
Sbjct: 57  QHGVKVIVDEKSLTYLNGTQLDFVKEGLNEGFKYTNPNVKNECGCGESFSV 107


>gi|323526614|ref|YP_004228767.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp.
           CCGE1001]
 gi|323383616|gb|ADX55707.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp.
           CCGE1001]
          Length = 107

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +   +       +GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGVGLRLGVRTTGCSGLAYKLEYVDELAPEDQVFEC-NGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|160872205|ref|ZP_02062337.1| HesB/YadR/YfhF family protein [Rickettsiella grylli]
 gi|159121004|gb|EDP46342.1| HesB/YadR/YfhF family protein [Rickettsiella grylli]
          Length = 133

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 60/116 (51%), Gaps = 6/116 (5%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           +  V +TE+A ++I+ ++         +R+ +  GGC+G +Y          D   +I+K
Sbjct: 18  TQPVRITESAAHKIEALITEEGNSQLKLRVFITGGGCSGFQYGFSFEEAMNEDDTLIIQK 77

Query: 62  DG------VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +G      V++ ID  SL Y+ G EID+K++     F+  NPN  + CGCG S  I
Sbjct: 78  NGKDQKREVQLLIDPISLGYLTGAEIDYKSDLTGEQFIIRNPNAKTTCGCGSSFGI 133


>gi|218710462|ref|YP_002418083.1| iron-sulfur cluster insertion protein ErpA [Vibrio splendidus
           LGP32]
 gi|259646279|sp|B7VJJ4|ERPA_VIBSL RecName: Full=Iron--sulfur cluster insertion protein erpA
 gi|218323481|emb|CAV19658.1| Similar to HesB family protein [Vibrio splendidus LGP32]
          Length = 124

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++ ++AA  R++ ++   +     +R+ +  GGC+G +Y      +   DGD  I   GV
Sbjct: 19  LSFSDAAATRVQTLIAEEENPDLKLRVYITGGGCSGFQYGFTFD-EKVNDGDTTIVNSGV 77

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      + F  +NPN  + CGCG S  +
Sbjct: 78  TLVVDPMSLQYLMGGMVDYTEGLEGARFFVNNPNATTTCGCGASFSV 124


>gi|197123953|ref|YP_002135904.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           sp. K]
 gi|196173802|gb|ACG74775.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           sp. K]
          Length = 127

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 58/109 (53%), Gaps = 1/109 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            + V++T  A+  +K+ +        GIR+ +  GGCAG +Y +D   D       L  +
Sbjct: 19  PNFVSLTSKAIEMVKDAIAREGLAGYGIRVGVMGGGCAGFQYSMDFEKDPRDGDLSLE-Q 77

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           DG+K+++D  S +Y+ G  ID+      +GF F+NPN  + CGCG S  
Sbjct: 78  DGIKLYVDPMSSMYLQGVTIDYVVGLQGAGFKFNNPNARTTCGCGSSFS 126


>gi|320108204|ref|YP_004183794.1| iron-sulfur cluster assembly accessory protein [Terriglobus
           saanensis SP1PR4]
 gi|319926725|gb|ADV83800.1| iron-sulfur cluster assembly accessory protein [Terriglobus
           saanensis SP1PR4]
          Length = 126

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 58/110 (52%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           +  V +T +A+ ++KEI+        G+RI +  GGC+G +Y +          D ++  
Sbjct: 18  TQPVNLTASAIVKVKEIMATQDPHPAGLRIGVVGGGCSGFQYSMSFENQQ-GMMDKVVRF 76

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           D +KV++D+ S +Y+ G  +D+      +GF F NP   S CGCG S  +
Sbjct: 77  DDLKVFVDATSAMYLNGCTVDYVETLEAAGFKFENPQVKSTCGCGSSFSV 126


>gi|75676001|ref|YP_318422.1| HesB/YadR/YfhF [Nitrobacter winogradskyi Nb-255]
 gi|74420871|gb|ABA05070.1| HesB/YadR/YfhF [Nitrobacter winogradskyi Nb-255]
          Length = 110

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++E A  RI+EI+ +       +RIS++ GGC+G +Y  D+      D   +     V
Sbjct: 6   ITVSERAARRIREILKSEG-DGAMLRISVEGGGCSGFQYKFDIERAKADDDLVIARDSAV 64

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D AS+ ++ G+E+DF  + + + F   NPN  ++CGCG S  I
Sbjct: 65  -VLVDPASVPFLSGSEVDFVDDLIGASFRVVNPNATASCGCGTSFSI 110


>gi|116690145|ref|YP_835768.1| iron-sulfur cluster assembly protein IscA [Burkholderia cenocepacia
           HI2424]
 gi|170733477|ref|YP_001765424.1| iron-sulfur cluster assembly protein IscA [Burkholderia cenocepacia
           MC0-3]
 gi|254247785|ref|ZP_04941106.1| HesB/YadR/YfhF [Burkholderia cenocepacia PC184]
 gi|116648234|gb|ABK08875.1| iron-sulfur cluster assembly protein IscA [Burkholderia cenocepacia
           HI2424]
 gi|124872561|gb|EAY64277.1| HesB/YadR/YfhF [Burkholderia cenocepacia PC184]
 gi|169816719|gb|ACA91302.1| iron-sulfur cluster assembly protein IscA [Burkholderia cenocepacia
           MC0-3]
          Length = 115

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V D     D + E  GV
Sbjct: 11  ITLTEKAAQHVQKYLV-RRGKGVGLRLGVRTTGCSGLAYKLEYVDDL-APEDQVFESHGV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 69  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 115


>gi|288553985|ref|YP_003425920.1| hypothetical protein BpOF4_04820 [Bacillus pseudofirmus OF4]
 gi|288545145|gb|ADC49028.1| hypothetical protein BpOF4_04820 [Bacillus pseudofirmus OF4]
          Length = 117

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 59/106 (55%), Gaps = 1/106 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TEAAV +IKE++     +   +R+ +K GGC+GL Y +   T+   D   L    G
Sbjct: 1   MITLTEAAVSQIKEMMKAEGQEGLMLRVGVKGGGCSGLSYGMGFDTEKTEDDTKLEI-SG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           + V ID+ S   + G  ID+K   +  GF   NPN ++ CGCG S 
Sbjct: 60  LPVLIDNESAPIIKGVVIDYKQNMMGGGFTIDNPNAIANCGCGSSF 105


>gi|325523673|gb|EGD01944.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp. TJI49]
          Length = 107

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYLV-RRGKGVGLRLGVRTTGCSGLAYKLEYVDEL-APEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTELDFAREGLNEGFRFNNPNVKDECGCGESFRV 107


>gi|323495914|ref|ZP_08100982.1| iron-sulfur cluster insertion protein ErpA [Vibrio sinaloensis DSM
           21326]
 gi|323319130|gb|EGA72073.1| iron-sulfur cluster insertion protein ErpA [Vibrio sinaloensis DSM
           21326]
          Length = 113

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   +T ++AA  R+  ++   +     +R+ +  GGC+G +Y              
Sbjct: 1   MSEVNIPLTFSDAAASRVGALIAEEENPNLKLRVYITGGGCSGFQYGFTFDESVNEGDTT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++   GV + +D  SL Y++G ++D+      S F  +NPN  + CGCG S  +
Sbjct: 61  IVN-SGVTLVVDPMSLQYLVGGQVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|89072501|ref|ZP_01159073.1| putative HesB family protein [Photobacterium sp. SKA34]
 gi|89051605|gb|EAR57058.1| putative HesB family protein [Photobacterium sp. SKA34]
          Length = 113

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T ++ A  ++K ++   +     +R+ +  GGC+G +Y      +   DGD  IE  GV
Sbjct: 8   LTFSDVAANKVKTLIAEEENPNLKLRVYITGGGCSGFQYGFTFD-EKVNDGDMTIENSGV 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 67  TLVVDPMSLQYLMGGIVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|308050468|ref|YP_003914034.1| iron-sulfur cluster assembly protein IscA [Ferrimonas balearica DSM
           9799]
 gi|307632658|gb|ADN76960.1| iron-sulfur cluster assembly protein IscA [Ferrimonas balearica DSM
           9799]
          Length = 107

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TEAA  R+K  + N +GK  G+R+ LK  GC+GL Y+++ V D     + +  + GV
Sbjct: 3   ISLTEAAAERVKTYLKN-RGKGIGLRLGLKTSGCSGLAYVLEFVDDLSPGDEVIEAQ-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + ID+ SL+Y+ G E+D+  E L  GF F NPN    CGCG+S  +
Sbjct: 61  NLIIDAKSLVYLDGLEVDYVKEGLNEGFKFENPNAKGECGCGESFTV 107


>gi|253999557|ref|YP_003051620.1| iron-sulfur cluster assembly protein IscA [Methylovorus sp. SIP3-4]
 gi|313201584|ref|YP_004040242.1| iron-sulfur cluster assembly protein isca [Methylovorus sp. MP688]
 gi|253986236|gb|ACT51093.1| iron-sulfur cluster assembly protein IscA [Methylovorus sp. SIP3-4]
 gi|312440900|gb|ADQ85006.1| iron-sulfur cluster assembly protein IscA [Methylovorus sp. MP688]
          Length = 107

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R+++ + N +GK  G+R+ +K  GC+G+ Y ++ V D   +        GV
Sbjct: 3   ITLTETAASRVQKFLSN-RGKGIGLRLGVKTTGCSGMAYTLEFVDDLNPEDMAFE-SHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  I
Sbjct: 61  KVIVDPKSLVYIDGTELDFTKEGLNEGFKFNNPNVKDECGCGESFTI 107


>gi|74317184|ref|YP_314924.1| Iron-sulfur cluster assembly protein IscA [Thiobacillus
           denitrificans ATCC 25259]
 gi|74056679|gb|AAZ97119.1| Iron-sulphur cluster assembly protein IscA [Thiobacillus
           denitrificans ATCC 25259]
          Length = 107

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 61/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E A   +   +   +GK  GIR+ ++  GC+G+ Y ++   + P   +      GV
Sbjct: 3   VTLSERAAQHVTNFLAK-RGKGVGIRLGVRTSGCSGMAYKLEFADETPEGDEVFT-SHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V++D  SL Y+ GTE+D+  E L  GF F+NPN   ACGCG+S  +
Sbjct: 61  TVFVDPKSLPYIDGTELDYTREGLNEGFKFNNPNVKDACGCGESFNV 107


>gi|302784066|ref|XP_002973805.1| hypothetical protein SELMODRAFT_173619 [Selaginella moellendorffii]
 gi|300158137|gb|EFJ24760.1| hypothetical protein SELMODRAFT_173619 [Selaginella moellendorffii]
          Length = 150

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKDG 63
           +T+++ A+  ++++  + +     +R+ +++GGC+G+ Y++D      V  DD ++E++G
Sbjct: 44  ITLSDKALSHLQKLRADQKRD-LCLRVGVRQGGCSGMSYIMDFEDQGNVRSDDSVMEQEG 102

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             +  D  SLLY+ G ++D+    +  GF F NPN  S CGCG+S  
Sbjct: 103 FTMVCDPKSLLYLFGMQLDYSDALIGGGFSFKNPNATSTCGCGKSFA 149


>gi|124267447|ref|YP_001021451.1| hypothetical protein Mpe_A2260 [Methylibium petroleiphilum PM1]
 gi|124260222|gb|ABM95216.1| conserved hypothetical protein [Methylibium petroleiphilum PM1]
          Length = 107

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T AA   +   +   +GK  G+R+ +K  GC+GL Y ++   +     D + E  GV
Sbjct: 3   VTLTPAAARHVTRYL-GKRGKGVGVRLGVKTTGCSGLAYKLEYADEA-APEDVIFEDQGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GT++DF  E L  GF F+NPN+   CGCG+S  I
Sbjct: 61  KVLVDPKSLPYIEGTQLDFVREGLNEGFKFNNPNERDRCGCGESFRI 107


>gi|329765689|ref|ZP_08257258.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Nitrosoarchaeum limnia SFB1]
 gi|329137755|gb|EGG42022.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Nitrosoarchaeum limnia SFB1]
          Length = 116

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 32/108 (29%), Positives = 56/108 (51%), Gaps = 1/108 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++T++  A  +IKE +       Q +R+ ++ GGC+GL Y +        D   + E  
Sbjct: 8   KMITVSPKAAEKIKEFMKEEADNPQYLRVYVQGGGCSGLSYGMGFEKAPEEDDLVMEET- 66

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           G+K+ +DS S+ ++ G  +D+    + SGF  +NPN   +C CG S  
Sbjct: 67  GIKLLVDSYSVDHLKGANVDYIESLMGSGFKINNPNVTKSCSCGHSFS 114


>gi|31615730|pdb|1NWB|A Chain A, Solution Nmr Structure Of Protein Aq_1857 From Aquifex
           Aeolicus: Northeast Structural Genomics Consortium
           Target Qr6
          Length = 124

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I  +T+ AV  IK++   +  +   +RI +  GGC+G +Y +                DG
Sbjct: 9   IFKVTDKAVEEIKKVAQENNIENPILRIRVVPGGCSGFQYAMGFDDTVEEGDHVFEY-DG 67

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           VKV ID  S+ Y+ G E+D+  + +  GF   NPN   +CGCG S  
Sbjct: 68  VKVVIDPFSMPYVNGAELDYVVDFMGGGFTIRNPNATGSCGCGSSFS 114


>gi|83858690|ref|ZP_00952212.1| hypothetical protein OA2633_04286 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853513|gb|EAP91365.1| hypothetical protein OA2633_04286 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 113

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 58/107 (54%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++ +A  +I EI       ++ +R+S++ GGC+G  Y  DL  +   D   +   DG 
Sbjct: 10  ISLSPSAAAQINEITKAQG--SRYLRLSVEGGGCSGFSYKYDLTDEAREDDLRIER-DGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V ID  S+ ++ G+ ID+  E + + F   NPN  +ACGCG S  I
Sbjct: 67  TVLIDPMSVEFLSGSVIDYVDELIGASFQIKNPNATAACGCGTSFSI 113


>gi|319787277|ref|YP_004146752.1| iron-sulfur cluster assembly accessory protein [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465789|gb|ADV27521.1| iron-sulfur cluster assembly accessory protein [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 121

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 63/110 (57%), Gaps = 2/110 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AA+ R++  +     +A G+R  +++ GC+G  ++ DL  D            GV
Sbjct: 14  ITLTPAALERVQRFL-QRDPQALGLRFGVERTGCSGWGHVADLARDQREGDTVFEHA-GV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           ++++D+ SL  + GTEIDF  + L  GFVF NPN  + CGCG+S   + A
Sbjct: 72  RIYVDATSLPLVDGTEIDFARQGLGEGFVFRNPNAKAECGCGESFTTQPA 121


>gi|119468460|ref|ZP_01611551.1| putative HesB/YadR/YfhF family protein [Alteromonadales bacterium
           TW-7]
 gi|119447968|gb|EAW29233.1| putative HesB/YadR/YfhF family protein [Alteromonadales bacterium
           TW-7]
          Length = 112

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 26/107 (24%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  ++AA  R+K+++   +     +R+ +  GGC+G +Y             +++ K+GV
Sbjct: 7   IQFSDAAAVRVKQLIDEEENPELKLRVYVTGGGCSGFQYGFTFDEKANPGDLEIV-KNGV 65

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S+ Y++   +D+      + F   NPN  + CGCG S  +
Sbjct: 66  TLVVDPMSIQYLVDGVVDYTEGLEGARFFVSNPNATTTCGCGASFSV 112


>gi|262372255|ref|ZP_06065534.1| iron-sulfur cluster assembly protein IscA [Acinetobacter junii
           SH205]
 gi|262312280|gb|EEY93365.1| iron-sulfur cluster assembly protein IscA [Acinetobacter junii
           SH205]
          Length = 106

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   +  ++GK +GIR+ +K  GC+GL Y+++ V D         +  G
Sbjct: 1   MIHLTENAATHISNYL-QNRGKGEGIRVGVKTSGCSGLAYVLEFVDDVDTHDQVFEQF-G 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ G E+D+    L  GF F+NPNQ   CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLEGLEMDYVKNGLNEGFEFNNPNQKGECGCGESFTV 106


>gi|149190148|ref|ZP_01868424.1| HesB family protein [Vibrio shilonii AK1]
 gi|148836037|gb|EDL52998.1| HesB family protein [Vibrio shilonii AK1]
          Length = 113

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSD+   +  ++AA  R++ ++   +     +R+ +  GGC+G +Y      +       
Sbjct: 1   MSDVAIPLDFSDAAATRVQTLIAEEENPQLKLRVYITGGGCSGFQYGFTFDENVNEGDTT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +  K GV + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 61  IE-KCGVTLVVDPMSLQYLVGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|296158333|ref|ZP_06841164.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp. Ch1-1]
 gi|295891277|gb|EFG71064.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp. Ch1-1]
          Length = 107

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ + N +GK  G+R+ ++  GC+GL Y ++ V +   + +     +GV
Sbjct: 3   ITLTEKAAQHVQKYL-NRRGKGVGLRVGVRTTGCSGLAYKLEYVDELAPEDEVFEC-NGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|315499535|ref|YP_004088338.1| iron-sulfur cluster assembly accessory protein [Asticcacaulis
           excentricus CB 48]
 gi|315417547|gb|ADU14187.1| iron-sulfur cluster assembly accessory protein [Asticcacaulis
           excentricus CB 48]
          Length = 108

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 32/111 (28%), Positives = 57/111 (51%), Gaps = 3/111 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +T++ +A   +  +  ++      +R++++ GGC+G +Y +DLV    V    +  
Sbjct: 1   MNP-ITLSASAARHLNRLSADAGHP-ILLRVAVEGGGCSGFQYQLDLVEAPEVGDTVVAY 58

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            DG +  ID  S   + G+ ID+  E + + F   NP   S+CGCG S  I
Sbjct: 59  -DGAQALIDEVSAPLLAGSIIDYVEELVGAQFKILNPQAKSSCGCGVSFSI 108


>gi|255318953|ref|ZP_05360178.1| iron-sulfur cluster assembly protein IscA [Acinetobacter
           radioresistens SK82]
 gi|262378311|ref|ZP_06071468.1| iron-sulfur cluster assembly protein IscA [Acinetobacter
           radioresistens SH164]
 gi|255303970|gb|EET83162.1| iron-sulfur cluster assembly protein IscA [Acinetobacter
           radioresistens SK82]
 gi|262299596|gb|EEY87508.1| iron-sulfur cluster assembly protein IscA [Acinetobacter
           radioresistens SH164]
          Length = 106

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 43/108 (39%), Positives = 70/108 (64%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I+  +  ++GK +GIRI +K  GC+GL Y+++ V D+  + D + ++ G
Sbjct: 1   MIHLTETAATHIRNYL-QNRGKGEGIRIGVKTSGCSGLAYVLEFV-DDINEHDQVFDQAG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ G E+D+    L  GF F+NPNQ   CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLNGLEMDYVKNGLNEGFEFNNPNQKGECGCGESFTV 106


>gi|260776730|ref|ZP_05885625.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607953|gb|EEX34218.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 107

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE A  R++  + N +GK  G+R+ +K  GC+G+ Y+++ V +   +        GV
Sbjct: 3   ITMTETAASRVRTFLEN-RGKGIGLRLGVKTTGCSGMAYVLEFVDELNEEDSVFEH-SGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDQKSLAYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|297250711|ref|ZP_06864871.2| HesB/YadR/YfhF family protein [Neisseria polysaccharea ATCC 43768]
 gi|296838119|gb|EFH22057.1| HesB/YadR/YfhF family protein [Neisseria polysaccharea ATCC 43768]
          Length = 153

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  T++   ++ +++         +R+ +  GGC+G +Y      +   D D  
Sbjct: 42  MSDESPIIFTDSCCVKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFD-EIKNDDDFE 100

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           IEK+G+   +D  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 101 IEKNGLVFLVDPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV 153


>gi|170033040|ref|XP_001844387.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167873501|gb|EDS36884.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 130

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV RIK+++   + +  G+++ +++ GC GL Y +D  T      D+ + +DGV
Sbjct: 26  LTLTPAAVNRIKQLL-QGKSEYIGLKVGVRQRGCNGLSYTLDYATTKDK-MDEEVVQDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  + L +LGTE+DF   KL + FVF+NPN    CGCG+S  I
Sbjct: 84  KVLIDKKAQLSLLGTEMDFVENKLSAEFVFNNPNIKGTCGCGESFSI 130


>gi|91775159|ref|YP_544915.1| iron-sulfur cluster assembly protein IscA [Methylobacillus
           flagellatus KT]
 gi|91709146|gb|ABE49074.1| iron-sulfur cluster assembly protein IscA [Methylobacillus
           flagellatus KT]
          Length = 107

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE A  R+++ + N +GK  G+R+ +K  GC+G+ Y ++ V +  V+        GV
Sbjct: 3   ISLTETAAKRVQKFLAN-RGKGVGLRLGVKTTGCSGMAYTLEFVDEIQVEDLVFE-SHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDPKSLVYIDGTELDFAKEGLNEGFKFNNPNVKDECGCGESFTV 107


>gi|114320403|ref|YP_742086.1| iron-sulfur cluster assembly accessory protein [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114226797|gb|ABI56596.1| iron-sulfur cluster assembly accessory protein [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 108

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 43/111 (38%), Positives = 67/111 (60%), Gaps = 3/111 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M++ + +T+ AV  +K+ +   +G   G+R+ +K  GC+GL Y VD   D     D++IE
Sbjct: 1   MAN-IQLTDKAVRHVKDYLARHEG-GVGLRLGVKTTGCSGLAYTVDYA-DRIEASDEVIE 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +DGVKV ++  SL ++ GTE+DF  + L   F F NPN    CGCG+S  +
Sbjct: 58  QDGVKVLVNRKSLPFLEGTEVDFVRDGLNQRFDFRNPNVKETCGCGESFTV 108


>gi|251792925|ref|YP_003007651.1| iron-sulfur cluster assembly protein IscA [Aggregatibacter
           aphrophilus NJ8700]
 gi|247534318|gb|ACS97564.1| iron-sulfur cluster assembly protein IscA [Aggregatibacter
           aphrophilus NJ8700]
          Length = 107

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE+A  R+K  +   +GK  G+R+ +K  GC+GL YM++ V     D      + GV
Sbjct: 3   ITLTESAADRVKTFLEK-RGKGIGLRLGIKTSGCSGLSYMLEFVDTLNEDDQVFE-QHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D+ SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVIVDTKSLVYLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFNV 107


>gi|300773830|ref|ZP_07083699.1| iron-sulfur cluster assembly protein IscA [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|300760001|gb|EFK56828.1| iron-sulfur cluster assembly protein IscA [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 111

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 38/112 (33%), Positives = 62/112 (55%), Gaps = 2/112 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M  ++T+T+ A  RI+ I+   Q   +  +R++++ GGC+GL Y +D   +         
Sbjct: 1   MDSMITITDKAKERIQSIMKTEQYDDSYFVRVAVESGGCSGLSYKLDFDNEEKKGDQFSE 60

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +K G+K+ +D  S LY+ GTE+D+       GF FHNPN    C CG+S  +
Sbjct: 61  DK-GIKICLDIKSYLYLAGTELDYSDGLNGKGFEFHNPNASRTCACGESFSV 111


>gi|49074414|gb|AAT49402.1| PA0665 [synthetic construct]
          Length = 117

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 55/105 (52%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            T  A  ++K ++         +R+ +  GGC+G +Y      ++  D D +IE+DGV +
Sbjct: 13  FTPGAANKVKTLIDEEGNPRLKLRVFVTGGGCSGFQYGFTFD-EDIADDDTVIERDGVGL 71

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  S  Y+ G+E+D++     S FV  NPN  + CGC QS  I
Sbjct: 72  VVDPMSFQYLAGSEVDYQEGLEGSRFVIKNPNAATTCGCRQSFSI 116


>gi|312113059|ref|YP_004010655.1| iron-sulfur cluster assembly accessory protein [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311218188|gb|ADP69556.1| iron-sulfur cluster assembly accessory protein [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 111

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++++E A  RI+EIV ++QG+   +RIS++ GGC+G  Y  ++V       D +IEK G 
Sbjct: 7   ISVSERAANRIREIVGSAQGEN-ALRISVQGGGCSGFSYNFEIV-LEAAADDIVIEKSGA 64

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V ID  S+ +M G+EIDF  + + S F   NPN  ++CGCG S  I
Sbjct: 65  RVVIDPVSVPFMAGSEIDFIDDLMGSSFKITNPNATASCGCGTSFSI 111


>gi|170702001|ref|ZP_02892921.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria
           IOP40-10]
 gi|171320034|ref|ZP_02909105.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria
           MEX-5]
 gi|172061079|ref|YP_001808731.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria
           MC40-6]
 gi|170133091|gb|EDT01499.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria
           IOP40-10]
 gi|171094727|gb|EDT39770.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria
           MEX-5]
 gi|171993596|gb|ACB64515.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria
           MC40-6]
          Length = 107

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYLV-RRGKGVGLRLGVRTTGCSGLAYKLEYVDEL-APEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GT++DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDPKSLAYIDGTQLDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|33152208|ref|NP_873561.1| hesB family protein [Haemophilus ducreyi 35000HP]
 gi|33148430|gb|AAP95950.1| hesB family protein [Haemophilus ducreyi 35000HP]
          Length = 107

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  R++  + N +GK  G+R+ +K  GC+GL Y+++ V     D      + G+
Sbjct: 3   ITLTETAANRVRTFLEN-RGKGIGLRLGVKTSGCSGLAYVLEFVDVLNEDDHVFE-QHGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF + NPN  + CGCG+S  +
Sbjct: 61  KVIVDEKSLTYLDGTELDFVKEGLNEGFKYSNPNVKNECGCGESFSV 107


>gi|295676939|ref|YP_003605463.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp.
           CCGE1002]
 gi|295436782|gb|ADG15952.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp.
           CCGE1002]
          Length = 107

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGIGLRVGVRTTGCSGLAYKLEYVDEL-APEDQVFETGGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GT++DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTQLDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|296112831|ref|YP_003626769.1| Fe-S cluster assembly protein IscA [Moraxella catarrhalis RH4]
 gi|295920525|gb|ADG60876.1| Fe-S cluster assembly protein IscA [Moraxella catarrhalis RH4]
 gi|326561073|gb|EGE11438.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           7169]
 gi|326561499|gb|EGE11843.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           46P47B1]
 gi|326565367|gb|EGE15545.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           12P80B1]
 gi|326566704|gb|EGE16843.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           103P14B1]
 gi|326567532|gb|EGE17647.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           BC1]
 gi|326569379|gb|EGE19439.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           BC8]
 gi|326571421|gb|EGE21436.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           BC7]
 gi|326575296|gb|EGE25224.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           CO72]
 gi|326576618|gb|EGE26525.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           101P30B1]
 gi|326577515|gb|EGE27395.1| iron-sulfur cluster assembly protein IscA [Moraxella catarrhalis
           O35E]
          Length = 106

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 62/108 (57%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T  A   IK+ + N      GIR+ ++  GC+GL Y+++ V D     +      G
Sbjct: 1   MINLTTQAAQHIKDFLENRGS-GVGIRVGVRTAGCSGLAYVLEFVDDPNNSDERFE-SHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V V+ID  SL+Y+ G ++D+ TE L SGF F NPNQ   CGCG+S  +
Sbjct: 59  VSVFIDPKSLVYLNGLQMDYVTEGLNSGFKFTNPNQTGECGCGESFTV 106


>gi|254480892|ref|ZP_05094138.1| putative HesB-like domain protein [marine gamma proteobacterium
           HTCC2148]
 gi|214038687|gb|EEB79348.1| putative HesB-like domain protein [marine gamma proteobacterium
           HTCC2148]
          Length = 121

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 62/107 (57%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + ++ +AV +++E+V   + KA  +R+ +  GGC+G +Y      ++  + D  IE+ GV
Sbjct: 16  INLSASAVRKVQELVSEEENKALKLRVYITGGGCSGFQYGFSFD-EDVAEDDTAIEEGGV 74

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  S  Y++G+E+D+      S F+ +NPN  + CGCG S  I
Sbjct: 75  TLLVDPMSFQYLVGSEVDYTEGLEGSRFIVNNPNATTTCGCGASFSI 121


>gi|297539153|ref|YP_003674922.1| iron-sulfur cluster assembly protein IscA [Methylotenera sp. 301]
 gi|297258500|gb|ADI30345.1| iron-sulfur cluster assembly protein IscA [Methylotenera sp. 301]
          Length = 107

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE A  R+++ + N +GK  G+R+ +K  GC+G+ Y ++ V +   +        GV
Sbjct: 3   ISLTETAANRVEKFLAN-RGKGIGLRLGVKTTGCSGMAYTLEFVDEMHPEDTAFE-SHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDPKSLVYIDGTELDFTKEGLNEGFKFNNPNVKDECGCGESFTV 107


>gi|153009681|ref|YP_001370896.1| iron-sulfur cluster assembly accessory protein [Ochrobactrum
           anthropi ATCC 49188]
 gi|151561569|gb|ABS15067.1| iron-sulfur cluster assembly accessory protein [Ochrobactrum
           anthropi ATCC 49188]
          Length = 108

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 49/107 (45%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  RI +I+ +  GK   +R+S++ GGC+G  Y  DLV D   D D +IEK G 
Sbjct: 4   ITVSDSAAKRIAKILGSEPGKT-ALRVSVEGGGCSGFSYKYDLV-DEQTDDDIVIEKLGA 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS S+ YM G+EIDF  + +   F   NPN  SACGCG S  I
Sbjct: 62  KVLIDSISVPYMDGSEIDFVDDLMGQSFQIRNPNATSACGCGTSFAI 108


>gi|86749869|ref|YP_486365.1| HesB/YadR/YfhF [Rhodopseudomonas palustris HaA2]
 gi|86572897|gb|ABD07454.1| HesB/YadR/YfhF [Rhodopseudomonas palustris HaA2]
          Length = 110

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E A  RI EI+         +RIS++ GGC+G +Y  D V     D D +I +DG 
Sbjct: 6   VTISERAARRIGEILKGEG-DGAMLRISVEGGGCSGFQYKFD-VDRARTDDDVVIARDGA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +DSAS  ++ G+E+DF  + + + F  +NPN  ++CGCG S  I
Sbjct: 64  VVLVDSASAPFLAGSEVDFVDDLIGASFRVNNPNATASCGCGTSFSI 110


>gi|209519992|ref|ZP_03268771.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp. H160]
 gi|209499589|gb|EDZ99665.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp. H160]
          Length = 107

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +   +        GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGIGLRVGVRTTGCSGLAYKLEYVDEVAAEDQVFET-SGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|56461340|ref|YP_156621.1| HesB/IscA family protein [Idiomarina loihiensis L2TR]
 gi|81362517|sp|Q5QVQ4|ERPA_IDILO RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|56180350|gb|AAV83072.1| HesB/IscA family protein [Idiomarina loihiensis L2TR]
          Length = 116

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  TE A  ++ +++   +     +R+ +  GGC+G +Y      +    GD  IEK+GV
Sbjct: 11  IEFTEQAASKVGKLIAEEENPNLKLRVYVTGGGCSGFQYGFTFD-EKKNPGDMEIEKNGV 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  + ++     S F   NPN  + CGCG S  +
Sbjct: 70  TLLVDPMSLQYLMGGVVSYEEGLQGSRFFVDNPNATTTCGCGSSFSV 116


>gi|261250293|ref|ZP_05942869.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio orientalis CIP 102891]
 gi|260939409|gb|EEX95395.1| probable iron binding protein from the HesB_IscA_SufA family
           [Vibrio orientalis CIP 102891]
          Length = 113

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   +T ++AA  R+  ++   +     +R+ +  GGC+G +Y              
Sbjct: 1   MSEVNIPLTFSDAAANRVGALIAEEENPNLKLRVYITGGGCSGFQYGFTFDESVNEGDTT 60

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++   GV + +D  SL Y++G ++D+      + F  +NPN  + CGCG S  +
Sbjct: 61  IVN-SGVTLVVDPMSLQYLVGGQVDYTEGLEGARFFVNNPNATTTCGCGASFSV 113


>gi|332528390|ref|ZP_08404384.1| iron-sulfur cluster assembly protein IscA [Hylemonella gracilis
           ATCC 19624]
 gi|332042153|gb|EGI78485.1| iron-sulfur cluster assembly protein IscA [Hylemonella gracilis
           ATCC 19624]
          Length = 107

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE+A   +   +   +GK  G+R+ +K  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   VTLTESAARHVSRYLSK-RGKGVGVRLGVKTTGCSGLAYKLEYVDDV-APEDIVFEGHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GT++D+  E L  GF F+NPN+   CGCG+S  +
Sbjct: 61  KVLIDPKSLSYIDGTQLDYVREGLNEGFKFNNPNERDRCGCGESFRV 107


>gi|307729213|ref|YP_003906437.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp.
           CCGE1003]
 gi|307583748|gb|ADN57146.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp.
           CCGE1003]
          Length = 107

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +   +       +GV
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGVGLRLGVRTTGCSGLAYKLEYVDELAPEDQVFEC-NGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|239831754|ref|ZP_04680083.1| iron-sulfur cluster assembly accessory protein [Ochrobactrum
           intermedium LMG 3301]
 gi|239824021|gb|EEQ95589.1| iron-sulfur cluster assembly accessory protein [Ochrobactrum
           intermedium LMG 3301]
          Length = 108

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 49/107 (45%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  RI +I+ +  GK   +R+S++ GGC+G  Y  DLV D   D D +IEK G 
Sbjct: 4   ITVSDSAAKRIAKILGSEPGKT-ALRVSVEGGGCSGFSYKYDLV-DEQADDDIVIEKLGA 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS S+ YM G+EIDF  + +   F   NPN  SACGCG S  I
Sbjct: 62  KVLIDSISVPYMDGSEIDFVDDLMGQSFQIRNPNATSACGCGTSFAI 108


>gi|256371058|ref|YP_003108882.1| iron-sulfur cluster assembly accessory protein [Acidimicrobium
           ferrooxidans DSM 10331]
 gi|256007642|gb|ACU53209.1| iron-sulfur cluster assembly accessory protein [Acidimicrobium
           ferrooxidans DSM 10331]
          Length = 120

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 53/110 (48%), Gaps = 2/110 (1%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKA-QGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
             ++++T++AV ++ E++      A   +R+++  GGC+G  Y +          D   E
Sbjct: 12  PSVISLTDSAVRKVAELIAQEDDAASLFLRVAVAPGGCSGYSYDMFFD-SERASDDIEAE 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             GV+V +D  S   + G+ +DF      +GF   NPN    CGCG S  
Sbjct: 71  FGGVRVVVDPQSAELIRGSVLDFVDGLQGAGFHISNPNATRTCGCGSSFS 120


>gi|282854319|ref|ZP_06263656.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes J139]
 gi|282583772|gb|EFB89152.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes J139]
 gi|314922978|gb|EFS86809.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL001PA1]
 gi|314966335|gb|EFT10434.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL082PA2]
 gi|314980937|gb|EFT25031.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL110PA3]
 gi|315090122|gb|EFT62098.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL110PA4]
 gi|315093580|gb|EFT65556.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL060PA1]
 gi|315103131|gb|EFT75107.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL050PA2]
 gi|327326932|gb|EGE68713.1| HesB/YadR/YfhF family protein [Propionibacterium acnes HL103PA1]
          Length = 117

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 52/106 (49%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AA  ++K ++         +R++++ GGC+GL Y +    +  ++GD +    GV
Sbjct: 13  IILTDAAAAKVKSLLDQEGRDDLALRLAVQPGGCSGLRYQLFFD-ERHLEGDVVKTYGGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            V  D  S  Y+ G  IDF       GF   NPN  S C CG S  
Sbjct: 72  DVVTDRMSAPYLAGATIDFTDTIEKQGFTIDNPNATSTCACGDSFH 117


>gi|86159896|ref|YP_466681.1| HesB/YadR/YfhF [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85776407|gb|ABC83244.1| HesB/YadR/YfhF [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 127

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 1/109 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            + V++T  A+  +K+ +        GIR+ +  GGCAG +Y +D   D       L  +
Sbjct: 19  PNFVSLTSKAIEMVKDAIAREGLAGYGIRVGVMGGGCAGFQYSMDFEKDPRDGDISLE-Q 77

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           DG+K+++D  S +Y+ G  +D+      +GF F+NPN  + CGCG S  
Sbjct: 78  DGIKLYVDPMSSMYLQGVTVDYVVGLQGAGFKFNNPNARTTCGCGSSFS 126


>gi|262395127|ref|YP_003286981.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           sp. Ex25]
 gi|262338721|gb|ACY52516.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           sp. Ex25]
          Length = 107

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE+A  R++  + +++GK  G+R+ +K  GC+G+ Y+++ V +   + +      GV
Sbjct: 3   ITMTESAASRVRAFL-DNRGKGIGLRLGVKTTGCSGMAYVLEFVDELNEEDEVFEL-SGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIIDKKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|146277243|ref|YP_001167402.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145555484|gb|ABP70097.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 108

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 44/111 (39%), Positives = 68/111 (61%), Gaps = 3/111 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+    +T+ A  R+ EI   + G+ + +R++++ GGC+G +Y  ++  D+P   D +IE
Sbjct: 1   MNLPPRVTDRAFARLAEI-AEASGETRALRVAVEGGGCSGFQY--EIKLDDPGSDDLVIE 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KDG KV ID  SL ++   EID+  E + S FV +NPN  S+CGCG S  I
Sbjct: 58  KDGQKVLIDQVSLPFLANAEIDYADELIGSRFVINNPNATSSCGCGTSFSI 108


>gi|86750105|ref|YP_486601.1| HesB/YadR/YfhF [Rhodopseudomonas palustris HaA2]
 gi|86573133|gb|ABD07690.1| HesB/YadR/YfhF [Rhodopseudomonas palustris HaA2]
          Length = 134

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 49/115 (42%), Positives = 81/115 (70%), Gaps = 1/115 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++ +TEAA  R+K+++  + G+  G+R+ +K GGCAG  Y V+   D     + + +K
Sbjct: 19  PQVMRLTEAAATRVKDLMSRADGEIVGLRVGIKNGGCAGQSYTVEYARDLQATDEVIEDK 78

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            GVK+ ID  ++L++LGTE+D+K +K+ + FVF+NPNQ+SACGCG+SVE+  A++
Sbjct: 79  -GVKILIDPKAVLFLLGTEMDYKADKMQAQFVFNNPNQISACGCGESVELVPANV 132


>gi|206560558|ref|YP_002231323.1| HesB family protein [Burkholderia cenocepacia J2315]
 gi|198036600|emb|CAR52497.1| HesB family protein [Burkholderia cenocepacia J2315]
          Length = 107

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +     D + E  GV
Sbjct: 3   ITLTEKAAQHVQKYLV-RRGKGMGLRLGVRTTGCSGLAYKLEYVDEL-APEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|220918722|ref|YP_002494026.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219956576|gb|ACL66960.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 127

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 58/109 (53%), Gaps = 1/109 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            + V++T  A+  +K+ +        GIR+ +  GGCAG +Y +D   D       L  +
Sbjct: 19  PNFVSLTSKAIEMVKDAIAREGLAGYGIRVGVMGGGCAGFQYSMDFEKDPRDGDLSLE-Q 77

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           DG+K+++D  S +Y+ G  ID+      +GF F+NPN  + CGCG S  
Sbjct: 78  DGIKLYVDPMSSMYLQGVTIDYVVGLQGAGFKFNNPNARTTCGCGSSFS 126


>gi|91784246|ref|YP_559452.1| Iron-sulphur cluster assembly protein IscA [Burkholderia xenovorans
           LB400]
 gi|91688200|gb|ABE31400.1| Iron-sulphur cluster assembly protein IscA [Burkholderia xenovorans
           LB400]
          Length = 111

 Score =  124 bits (312), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ + N +GK  G+R+ ++  GC+GL Y ++ V +   + +     +GV
Sbjct: 7   ITLTEKAAQHVQKYL-NRRGKGVGLRVGVRTTGCSGLAYKLEYVDELAPEDEVFEC-NGV 64

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 65  KIIVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 111


>gi|87119804|ref|ZP_01075701.1| HesB/YadR/YfhF family protein [Marinomonas sp. MED121]
 gi|86165280|gb|EAQ66548.1| HesB/YadR/YfhF family protein [Marinomonas sp. MED121]
          Length = 114

 Score =  124 bits (312), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 53/106 (50%), Gaps = 1/106 (0%)

Query: 6   TMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVK 65
             T AA  ++K ++   +     +R+ +  GGC+G +Y      +   D   +   +GVK
Sbjct: 10  EFTFAAAAKLKNLIEEEENNRLMLRVYVTGGGCSGFQYGFTFDEEFQEDDTTVER-EGVK 68

Query: 66  VWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + +D  S  Y++G+E+D++     S F   NPN  S CGCG S  I
Sbjct: 69  MVVDPLSFQYLVGSEVDYQEGLEGSRFTVKNPNASSTCGCGSSFSI 114


>gi|225025119|ref|ZP_03714311.1| hypothetical protein EIKCOROL_02011 [Eikenella corrodens ATCC
           23834]
 gi|224942080|gb|EEG23289.1| hypothetical protein EIKCOROL_02011 [Eikenella corrodens ATCC
           23834]
          Length = 106

 Score =  124 bits (312), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 43/108 (39%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T  A   I+  +   +GK +GIRI +K  GC+G+ Y ++   D  +  D + E  G
Sbjct: 1   MITLTPNAADHIRSFLTK-RGKGEGIRIGVKTSGCSGMAYTLEFA-DEILPDDLVFEGHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV +D  S +Y+ GTE+DF  E L  GF F NPN  + CGCG+S  +
Sbjct: 59  VKVLVDPKSHVYLDGTELDFTKEGLQEGFKFANPNVKNECGCGESFNV 106


>gi|187478012|ref|YP_786036.1| iron-sulfur cluster assembly protein [Bordetella avium 197N]
 gi|115422598|emb|CAJ49123.1| iron-sulfur cluster assembly protein [Bordetella avium 197N]
          Length = 107

 Score =  124 bits (312), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+ A   +   +   +GK  G+R+ ++  GC+G+ Y ++ V D   +        GV
Sbjct: 3   VTLTQQAANHVSRYL-QKRGKGIGLRLGVRTTGCSGMAYKLEYVDDPDAEDVVFESF-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+D+  E L  GF F NPN+ + CGCG+S  +
Sbjct: 61  KVFVDPKSLAYLEGTELDYAREGLNEGFKFSNPNEKATCGCGESFTV 107


>gi|114707220|ref|ZP_01440118.1| hypothetical protein FP2506_04916 [Fulvimarina pelagi HTCC2506]
 gi|114537416|gb|EAU40542.1| hypothetical protein FP2506_04916 [Fulvimarina pelagi HTCC2506]
          Length = 113

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 62/110 (56%), Gaps = 2/110 (1%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              VT+++ A  RI  I+  S G    +R+S++ GGC+G  Y  DL        D ++E+
Sbjct: 6   DQPVTLSDNAAKRIANILAKSPGSNS-LRVSVEGGGCSGFSYKYDLT-SETEADDLVLER 63

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DG +V ID  S++Y+ G+ IDF  + +   F   NPN V++CGCG S  I
Sbjct: 64  DGARVVIDQISVVYLDGSVIDFVDDLMGQSFQIRNPNAVASCGCGTSFSI 113


>gi|312131421|ref|YP_003998761.1| iroN-sulfur cluster assembly accessory protein [Leadbetterella
           byssophila DSM 17132]
 gi|311907967|gb|ADQ18408.1| iron-sulfur cluster assembly accessory protein [Leadbetterella
           byssophila DSM 17132]
          Length = 108

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 61/109 (55%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +VT+++ A  +I E+          GIR++++ GGC+GL Y +          D + E  
Sbjct: 1   MVTVSDIAKEKIFELREKEGKNDNHGIRVAVEGGGCSGLMYNLAFD-AEQQPTDHIFEDK 59

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G+K+++D  SLLY++GTE+DF       GF F NPN    CGCG+S  +
Sbjct: 60  GIKIFVDKKSLLYLMGTELDFSDGLNGKGFHFKNPNATRTCGCGESFSV 108


>gi|319762897|ref|YP_004126834.1| iron-sulfur cluster assembly protein isca [Alicycliphilus
           denitrificans BC]
 gi|330824976|ref|YP_004388279.1| iron-sulfur cluster assembly protein IscA [Alicycliphilus
           denitrificans K601]
 gi|317117458|gb|ADU99946.1| iron-sulfur cluster assembly protein IscA [Alicycliphilus
           denitrificans BC]
 gi|329310348|gb|AEB84763.1| iron-sulfur cluster assembly protein IscA [Alicycliphilus
           denitrificans K601]
          Length = 107

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA   +   +   +GK  G+R+ +K  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   ITLTEAAARHVTRYLA-RRGKGLGVRLGVKTTGCSGLAYKLEYV-DEQAPEDIVFENHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+DF  E L  GF F NPN+   CGCG+S  +
Sbjct: 61  KVLIDPKSLAYIDGTELDFVREGLNEGFRFINPNERDRCGCGESFRV 107


>gi|28897372|ref|NP_796977.1| HesB family protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|260363561|ref|ZP_05776390.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           K5030]
 gi|260876332|ref|ZP_05888687.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           AN-5034]
 gi|260898603|ref|ZP_05907099.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           Peru-466]
 gi|260899297|ref|ZP_05907692.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           AQ4037]
 gi|28805584|dbj|BAC58861.1| HesB family protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308086879|gb|EFO36574.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           Peru-466]
 gi|308093055|gb|EFO42750.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           AN-5034]
 gi|308106606|gb|EFO44146.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           AQ4037]
 gi|308113045|gb|EFO50585.1| iron-sulfur cluster assembly protein IscA [Vibrio parahaemolyticus
           K5030]
 gi|328472605|gb|EGF43468.1| HesB family protein [Vibrio parahaemolyticus 10329]
          Length = 107

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE A  R+K  + +++GK  G+R+ +K  GC+G+ Y+++ V +   + +      GV
Sbjct: 3   ITMTETAASRVKAFL-DNRGKGIGLRLGVKTTGCSGMAYVLEFVDELNEEDEVFD-FSGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIIDKKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|227539685|ref|ZP_03969734.1| iron sulfur assembly protein [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227240327|gb|EEI90342.1| iron sulfur assembly protein [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 111

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 38/112 (33%), Positives = 62/112 (55%), Gaps = 2/112 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M  ++T+T+ A  RI  I+ + Q   +  +R++++ GGC+GL Y +D   +         
Sbjct: 1   MDSMITITDKAKERIHSIMKSEQYDDSYFVRVAVESGGCSGLSYKLDFDNEEKKGDQFSE 60

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +K G+K+ +D  S LY+ GTE+D+       GF FHNPN    C CG+S  +
Sbjct: 61  DK-GIKICLDIKSYLYLAGTELDYSDGLNGKGFEFHNPNASRTCACGESFSV 111


>gi|49475741|ref|YP_033782.1| hypothetical protein BH09960 [Bartonella henselae str. Houston-1]
 gi|49238548|emb|CAF27788.1| hypothetical protein BH09960 [Bartonella henselae str. Houston-1]
          Length = 107

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +++AA  RI +I+ +   K  G+R+S++ GGC+G  Y  +LV++   D   L  K G 
Sbjct: 3   VNISDAAAKRIVQILSSEPDK-IGLRVSVEGGGCSGFSYKYNLVSETNEDDFVLK-KGGA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V IDS SL +M G EIDF  + +   F  HNPN VS+CGCG S  I
Sbjct: 61  IVLIDSLSLPFMEGAEIDFVDDLIGQSFQIHNPNAVSSCGCGVSFSI 107


>gi|312080094|ref|XP_003142454.1| hypothetical protein LOAG_06870 [Loa loa]
 gi|307762383|gb|EFO21617.1| hypothetical protein LOAG_06870 [Loa loa]
          Length = 131

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 64/105 (60%), Gaps = 2/105 (1%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  AV R+K ++     +   ++IS+++ GC GL Y +D         D+ + +DGV++
Sbjct: 29  LTPEAVKRVKYLLSKQ-PETAALKISVRQRGCNGLTYTLDYAQHKAK-FDEEVVQDGVRL 86

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           WID  + L +LG+E+D+  ++L S FVF NPN  S CGCG+S  I
Sbjct: 87  WIDPKAQLTLLGSEMDYVEDRLSSEFVFRNPNIKSTCGCGESFSI 131


>gi|304310527|ref|YP_003810125.1| HesB/YadR/YfhF family protein [gamma proteobacterium HdN1]
 gi|301796260|emb|CBL44468.1| HesB/YadR/YfhF family protein [gamma proteobacterium HdN1]
          Length = 120

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 55/110 (50%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             I+  +++A  ++K +          +R+ +  GGCAG  Y      +   + D +I K
Sbjct: 12  DSILKFSDSAARKVKSLKDEEGNDNLKLRVYITGGGCAGFSYGFSFD-EAIKEDDTVIAK 70

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +GV + +D  S  Y+ G+EID+      + FV HNPN  S CGCG S  I
Sbjct: 71  EGVVLLVDPMSAQYLAGSEIDYTEGIQGARFVVHNPNADSTCGCGSSFSI 120


>gi|312884221|ref|ZP_07743930.1| HesB family protein [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367994|gb|EFP95537.1| HesB family protein [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 107

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT+ A  R++  + +++GK  G+R+ +K  GC+G+ Y+++ V +   +        GV
Sbjct: 3   ITMTDTAASRVRTFL-DNRGKGIGLRLGVKTTGCSGMAYVLEFVDELNEEDSVFEH-SGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID+ SL+Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDAKSLVYLDGTELDYVKEGLNEGFEFNNPNAKGECGCGESFNV 107


>gi|226953089|ref|ZP_03823553.1| iron-binding protein possibly involved in Fe-S protein formation or
           repair [Acinetobacter sp. ATCC 27244]
 gi|226836181|gb|EEH68564.1| iron-binding protein possibly involved in Fe-S protein formation or
           repair [Acinetobacter sp. ATCC 27244]
          Length = 106

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   +  ++GK +GIR+ +K  GC+GL Y+++ V D     +   +  G
Sbjct: 1   MIHLTENAATHISNYL-QNRGKGEGIRVGVKTSGCSGLAYVLEFVDDVDTHDEVFEQF-G 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ G E+D+    L  GF F+NPNQ   CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLEGLEMDYVKNGLNEGFEFNNPNQKGECGCGESFTV 106


>gi|118489850|gb|ABK96724.1| unknown [Populus trichocarpa x Populus deltoides]
          Length = 179

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKDG 63
           +++TE A+  +  I  N + +   +RI +K+GGC+G+ Y +D         DD +IE +G
Sbjct: 73  ISVTENALKHLNRI-KNERNEDLCLRIGVKQGGCSGMSYTMDFENRANARPDDSIIECNG 131

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             +  D  SLL++ G ++D+    +  GF F NPN    CGCG+S  
Sbjct: 132 FVIVCDPKSLLFIFGMQLDYSDALIGGGFSFKNPNATKTCGCGKSFA 178


>gi|118487106|gb|ABK95383.1| unknown [Populus trichocarpa]
          Length = 179

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKDG 63
           +++TE A+  +  I  N + +   +RI +K+GGC+G+ Y +D         DD +IE +G
Sbjct: 73  ISVTENALKHLNRI-KNERNEDLCLRIGVKQGGCSGMSYTMDFENRANARPDDSIIECNG 131

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             +  D  SLL++ G ++D+    +  GF F NPN    CGCG+S  
Sbjct: 132 FVIVCDPKSLLFIFGMQLDYSDALIGGGFSFKNPNATKTCGCGKSFA 178


>gi|82701690|ref|YP_411256.1| HesB/YadR/YfhF [Nitrosospira multiformis ATCC 25196]
 gi|82409755|gb|ABB73864.1| HesB/YadR/YfhF [Nitrosospira multiformis ATCC 25196]
          Length = 113

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 34/114 (29%), Positives = 61/114 (53%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           M+DI   +  T+ A  +++E++         +R+ +  GGC+G +Y      +   + D 
Sbjct: 1   MTDIPTPLIFTDNAANKVRELIEEEGNNDLKLRVFVAGGGCSGFKYGFTFD-ELISEDDT 59

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++EK+GVK+ +D+ S  Y+ G EID++     + F+  NP   S CGCG S  +
Sbjct: 60  VMEKNGVKLLVDAMSFQYLAGAEIDYQENAEGAQFIIKNPGAASTCGCGSSFSV 113


>gi|319405602|emb|CBI79225.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 107

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +++ A  +I +I+    GK   +RI+++ GGC+G  Y  DLV     + D +I+KDG 
Sbjct: 3   VNISDVAAKQIAQILAEQPGKT-ALRITVEGGGCSGFSYKYDLV-SENKEDDLIIKKDGA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V+IDS SL +M G EIDF  + +   F  HNPN  S+CGCG S  I
Sbjct: 61  IVFIDSISLPFMEGAEIDFVDDLMGQSFQIHNPNATSSCGCGISFSI 107


>gi|153835381|ref|ZP_01988048.1| iron-sulfur cluster assembly protein IscA [Vibrio harveyi HY01]
 gi|156973370|ref|YP_001444277.1| hypothetical protein VIBHAR_01057 [Vibrio harveyi ATCC BAA-1116]
 gi|163802464|ref|ZP_02196357.1| scaffold protein [Vibrio sp. AND4]
 gi|148868103|gb|EDL67269.1| iron-sulfur cluster assembly protein IscA [Vibrio harveyi HY01]
 gi|156524964|gb|ABU70050.1| hypothetical protein VIBHAR_01057 [Vibrio harveyi ATCC BAA-1116]
 gi|159173765|gb|EDP58580.1| scaffold protein [Vibrio sp. AND4]
          Length = 107

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE+A  R+K  + +++GK  G+R+ +K  GC+G+ Y+++ V D   + +     D V
Sbjct: 3   ITMTESAASRVKAFL-DNRGKGIGLRLGVKTTGCSGMAYVLEFVDDLNEEDEVFELSD-V 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIIDKKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|134095418|ref|YP_001100493.1| factor involved in Fe-S cluster assembly and activation
           [Herminiimonas arsenicoxydans]
 gi|133739321|emb|CAL62371.1| Iron-binding protein iscA (Iron-sulfur cluster assembly protein)
           [Herminiimonas arsenicoxydans]
          Length = 107

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   I   +   +GK  G+R  ++  GC+GL Y ++ V ++    D + E  GV
Sbjct: 3   ITLTEKAAKHINRYM-ERRGKGIGLRFGVRTTGCSGLAYKLEYVDES-ASEDSVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+DF  E L  GF FHNPN    CGCG+S  I
Sbjct: 61  KVFVDPKSLPYIDGTELDFAREGLNEGFKFHNPNVKDECGCGESFRI 107


>gi|331007024|ref|ZP_08330259.1| putative iron binding protein from the HesB_IscA_SufA family [gamma
           proteobacterium IMCC1989]
 gi|330419172|gb|EGG93603.1| putative iron binding protein from the HesB_IscA_SufA family [gamma
           proteobacterium IMCC1989]
          Length = 117

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 58/110 (52%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              + ++++A  ++K ++         +R+ +  GGC+G +Y      +   D D +I K
Sbjct: 9   PQPIMVSDSAANKVKNLLEEEGNFDLKLRVFVTGGGCSGFQYGFTFD-ELVADDDAVITK 67

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           D VKV +DS S  Y++G +ID+K     S FV  NPN  + CGCG S  I
Sbjct: 68  DEVKVLVDSMSYAYLVGAQIDYKQNLEGSKFVVENPNAETTCGCGSSFSI 117


>gi|328543966|ref|YP_004304075.1| HesB-like domain [polymorphum gilvum SL003B-26A1]
 gi|326413709|gb|ADZ70772.1| HesB-like domain, putative [Polymorphum gilvum SL003B-26A1]
          Length = 113

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+++ A  RI  I+         +R+S++ GGC+GL+Y  D+V +     D  IE+DGV
Sbjct: 9   VTVSDRAARRIARILAGEPA-GSMLRVSVEGGGCSGLQYKYDVVNER-ESDDLAIERDGV 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D+ SL YM G+EIDF  + +   F   NPN V+ CGCG S  I
Sbjct: 67  TVLVDAVSLQYMTGSEIDFVDDLIGQSFQIRNPNAVAGCGCGTSFTI 113


>gi|294788954|ref|ZP_06754194.1| iron-sulfur cluster assembly protein IscA [Simonsiella muelleri
           ATCC 29453]
 gi|294483056|gb|EFG30743.1| iron-sulfur cluster assembly protein IscA [Simonsiella muelleri
           ATCC 29453]
          Length = 106

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 44/108 (40%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A   I+  +   +GK +GIRI +K  GC+G+ Y ++ V D     D + E+ G
Sbjct: 1   MITVTENAASHIQNFLVK-RGKGEGIRIGVKTSGCSGMAYTLEFV-DEIDSDDTVFEQSG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VK++ID  SL+Y+ GT++D+  E L  GF F NPN   +CGCG+S  +
Sbjct: 59  VKIFIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKESCGCGESFHV 106


>gi|297170757|gb|ADI21779.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF0130_22O14]
          Length = 110

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++  ++ +    A  +R+ +  GGCAG +Y      D       +  K+GV
Sbjct: 6   IIFTDAAANKVGALLQDEDNNAMHLRVYVTGGGCAGFQYGFSFDEDKDESDTMVE-KNGV 64

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+ +D  S+ Y+LG EIDF+ +   + FV  NPN  + C CG S  
Sbjct: 65  KLVVDPMSIQYLLGAEIDFQEDLQGARFVIKNPNASTTCSCGSSFS 110


>gi|317405203|gb|EFV85542.1| hypothetical protein HMPREF0005_03986 [Achromobacter xylosoxidans
           C54]
          Length = 107

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 42/111 (37%), Positives = 64/111 (57%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  VT+T+ A   I   +   +GK  G+R+ ++  GC+G+ Y ++ V D   +      
Sbjct: 1   MS--VTLTQQAATHIGRYL-QKRGKGIGLRLGVRTTGCSGMAYKLEYVDDAAPEDQVFES 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GVKV++D  SL Y+ GTE+D+  E L  GF F NPN+ + CGCG+S  +
Sbjct: 58  F-GVKVFVDPKSLAYLDGTELDYAREGLNEGFKFRNPNEKATCGCGESFTV 107


>gi|319650401|ref|ZP_08004544.1| hypothetical protein HMPREF1013_01149 [Bacillus sp. 2_A_57_CT2]
 gi|317397962|gb|EFV78657.1| hypothetical protein HMPREF1013_01149 [Bacillus sp. 2_A_57_CT2]
          Length = 120

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 1/109 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M  +V +TEAA   IKE++  ++ +   +R+++K GGC+GL Y +    +          
Sbjct: 1   MEQVVDITEAAALHIKEMMKQNEEEDAFLRVAVKGGGCSGLSYGMGFAHEVEEGDIQSEH 60

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
             G++V +       + GT+ID+K   +  GF   NPN ++ CGCG S 
Sbjct: 61  Y-GIQVLVSKEDAPILKGTKIDYKQSMMGGGFTIDNPNAIANCGCGSSF 108


>gi|50311733|ref|XP_455894.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49645030|emb|CAG98602.1| KLLA0F18150p [Kluyveromyces lactis]
          Length = 231

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 68/110 (61%), Gaps = 3/110 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++++T  A+  +K ++   + K   IRI +K  GC+GL Y +  +T      D+++E+
Sbjct: 125 KALISLTPNALSHLKGLLDQPEPK--LIRIGVKNRGCSGLTYDLQYITSPGK-FDEVVEQ 181

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGVKV IDS +L  ++G+E+D+  +KL S FVF NPN    CGCG+S  +
Sbjct: 182 DGVKVIIDSKALFSIVGSEMDWVDDKLSSRFVFKNPNSKGTCGCGESFMV 231


>gi|160387173|sp|Q2YBK7|ERPA_NITMU RecName: Full=Putative iron-sulfur cluster insertion protein erpA
          Length = 127

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 34/114 (29%), Positives = 61/114 (53%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           M+DI   +  T+ A  +++E++         +R+ +  GGC+G +Y      +   + D 
Sbjct: 15  MTDIPTPLIFTDNAANKVRELIEEEGNNDLKLRVFVAGGGCSGFKYGFTFD-ELISEDDT 73

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++EK+GVK+ +D+ S  Y+ G EID++     + F+  NP   S CGCG S  +
Sbjct: 74  VMEKNGVKLLVDAMSFQYLAGAEIDYQENAEGAQFIIKNPGAASTCGCGSSFSV 127


>gi|307946854|ref|ZP_07662189.1| FeS assembly scaffold SufA [Roseibium sp. TrichSKD4]
 gi|307770518|gb|EFO29744.1| FeS assembly scaffold SufA [Roseibium sp. TrichSKD4]
          Length = 122

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 57/113 (50%), Positives = 84/113 (74%), Gaps = 1/113 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++T+TEAA  R+KE+V NS   A G+R+ +KKGGCAG+EY +DLV +     D + +K 
Sbjct: 5   QVMTLTEAAAERVKELVDNSDKNALGLRVGIKKGGCAGMEYTMDLVEEAQAGDDVIDDK- 63

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           G K+++D +++L++LGTE+DF+  K  SGFVF NPN+ SACGCG+SV ++ AD
Sbjct: 64  GAKLFVDPSAVLFLLGTEMDFEVTKFRSGFVFKNPNETSACGCGESVALQAAD 116


>gi|297172663|gb|ADI23631.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF4000_06A21]
          Length = 112

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T +AV R+ +++ +   K   +R+ ++ GGC+G +Y      +   D  +     GV
Sbjct: 7   LEITTSAVSRLSDLIASKGNKELRLRVYVQGGGCSGFQYGFQFEEEKAADDFEFESA-GV 65

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  S  Y+ G  IDF  +   S FV +NPN  + CGCG S  I
Sbjct: 66  AVLVDPLSYQYLTGASIDFIDDLQGSRFVVNNPNATTTCGCGSSFGI 112


>gi|66559527|ref|XP_624993.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Apis mellifera]
          Length = 130

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IKE++ +   +  G+R+S+K+ GC GL Y +D   +     ++++ +DGV
Sbjct: 26  LTLTPSAVKKIKELLKDK-SEFIGLRVSVKQRGCNGLSYTLDYAKEKSKLDEEVV-QDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + ID  + L +LGTE+D+   KL S F+F+NPN    CGCG+S  +
Sbjct: 84  CIMIDKKAQLSLLGTEMDYIETKLSSEFIFNNPNIKGTCGCGESFSV 130


>gi|52426768|ref|NP_112202.2| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Homo sapiens]
 gi|77735891|ref|NP_001029642.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Bos taurus]
 gi|114701127|ref|XP_001136504.1| PREDICTED: similar to GK004 isoform 2 [Pan troglodytes]
 gi|74761270|sp|Q9BUE6|ISCA1_HUMAN RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Short=hIscA; Flags: Precursor
 gi|75076012|sp|Q4R5F0|ISCA1_MACFA RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|122140219|sp|Q3SZG8|ISCA1_BOVIN RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|12803679|gb|AAH02675.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Homo
           sapiens]
 gi|18025262|gb|AAG40950.1| HesB-like protein [Homo sapiens]
 gi|47940458|gb|AAH71621.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Homo
           sapiens]
 gi|55957468|emb|CAI14925.1| iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Homo
           sapiens]
 gi|67970665|dbj|BAE01675.1| unnamed protein product [Macaca fascicularis]
 gi|74354113|gb|AAI02864.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Bos taurus]
 gi|117646260|emb|CAL38597.1| hypothetical protein [synthetic construct]
 gi|193786263|dbj|BAG51546.1| unnamed protein product [Homo sapiens]
 gi|261860792|dbj|BAI46918.1| iron-sulfur cluster assembly 1 homolog [synthetic construct]
 gi|296484504|gb|DAA26619.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Bos taurus]
          Length = 129

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK+++ +   +  G+++ ++  GC GL Y ++         +++I +DGV
Sbjct: 25  LTLTPSAVNKIKQLLKDK-PEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVI-QDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|119469044|ref|ZP_01612028.1| Fe-S cluster assembly and activation protein (possibly as
           alternative scaffold for Fe-S cluster assembly)
           [Alteromonadales bacterium TW-7]
 gi|119447296|gb|EAW28564.1| Fe-S cluster assembly and activation protein (possibly as
           alternative scaffold for Fe-S cluster assembly)
           [Alteromonadales bacterium TW-7]
          Length = 107

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+AA  R++  + N +GK  G+R+ +K  GC+GL Y+++ V +   D +    K GV
Sbjct: 3   VTLTDAAANRVQSFLAN-RGKGLGLRVGIKTTGCSGLAYVLEFVDELNEDDETFAAK-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D+ SL+Y+ GTE+D+  E L  GF F+NPNQ   CGCG+S  +
Sbjct: 61  TLIVDAKSLVYIDGTELDYTKEGLNEGFKFNNPNQADECGCGESFTV 107


>gi|332532353|ref|ZP_08408233.1| iron binding protein IscA for iron-sulfur cluster assembly
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038220|gb|EGI74666.1| iron binding protein IscA for iron-sulfur cluster assembly
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 107

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+AA  R++  + N +GK  G+R+ +K  GC+GL Y+++ V D   D +    K GV
Sbjct: 3   VTLTDAAANRVQSFLAN-RGKGLGLRVGIKTTGCSGLAYVLEFVDDLNEDDETFAAK-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D+ SL+Y+ GTE+D+  E L  GF F+NPNQ   CGCG+S  +
Sbjct: 61  TLIVDAKSLVYIDGTELDYTKEGLNEGFKFNNPNQADECGCGESFTV 107


>gi|307207446|gb|EFN85161.1| Iron-sulfur cluster assembly 1-like protein, mitochondrial
           [Harpegnathos saltator]
          Length = 130

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IKEI+ +   +   +++ +++ GC GL Y +D   +     ++++ +D V
Sbjct: 26  LTLTPSAVNKIKEILKDK-SEYIALKVGVRQRGCNGLSYTLDYAKEKSKLDEEVV-QDDV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +++ID  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  +
Sbjct: 84  RIFIDRKAQLSLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFSV 130


>gi|296422409|ref|XP_002840753.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636976|emb|CAZ84944.1| unnamed protein product [Tuber melanosporum]
          Length = 181

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 64/110 (58%), Gaps = 3/110 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              +T+T +A   ++ ++       Q IRI +K  GC+GL Y ++ V       D+ + +
Sbjct: 74  KSAITLTPSATQHLRSLLAQ--PTPQLIRIGVKNRGCSGLAYHLEYVDRPDK-FDEEVVQ 130

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGVKV IDS +L  ++G+E+D+  +++ + FVF NPN    CGCG+S  +
Sbjct: 131 DGVKVLIDSKALFSIIGSEMDWVEDRISARFVFRNPNIKEQCGCGESFSV 180


>gi|237747553|ref|ZP_04578033.1| iron-binding protein iscA [Oxalobacter formigenes OXCC13]
 gi|229378915|gb|EEO29006.1| iron-binding protein iscA [Oxalobacter formigenes OXCC13]
          Length = 107

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   I   +   +GK  G+R  ++  GC+G+ Y ++ V +            GV
Sbjct: 3   ITLTEKAANHISRFL-QRRGKGIGLRFGVQTTGCSGMSYKLEYVDEPDAGDVIFE-SHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+DF  E L  GF F+NPN   +CGCG S ++
Sbjct: 61  KVFVDPKSLPYLDGTELDFAREGLNEGFKFYNPNVTDSCGCGNSFKV 107


>gi|225874653|ref|YP_002756112.1| iron-sulfur cluster assembly accessory protein [Acidobacterium
           capsulatum ATCC 51196]
 gi|225792822|gb|ACO32912.1| iron-sulfur cluster assembly accessory protein [Acidobacterium
           capsulatum ATCC 51196]
          Length = 122

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 60/107 (56%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+ AV +++EI+        G+RI +  GGC+G +Y +          D ++  D +
Sbjct: 17  LTLTDKAVEKVREIMATQDPLPSGLRIGVVGGGCSGFQYSMSFENQA-GMMDKVLSFDNL 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D+ S++Y+ G  +D+      +GF F NP+  S CGCG S  +
Sbjct: 76  KVYVDATSMMYLSGCVVDYVETLEAAGFKFENPSVKSTCGCGSSFSV 122


>gi|300023859|ref|YP_003756470.1| iron-sulfur cluster assembly accessory protein [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525680|gb|ADJ24149.1| iron-sulfur cluster assembly accessory protein [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 130

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 53/114 (46%), Positives = 78/114 (68%), Gaps = 2/114 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M  ++T+T+AA  R+  ++    G  + ++I +KKGGCAG+EY +          D++IE
Sbjct: 7   MPKVMTLTDAAAARVATLIAQKPG-VKALKIGIKKGGCAGMEYTMTWADQIGK-FDEVIE 64

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
             G  V ID A+++Y+LGTE+DFKT+KL S FVF+NPNQ SACGCG+SV ++ A
Sbjct: 65  DKGAIVLIDPAAIMYLLGTEMDFKTDKLSSQFVFNNPNQKSACGCGESVNLEPA 118


>gi|294083993|ref|YP_003550750.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663565|gb|ADE38666.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 132

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 57/111 (51%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+ I ++TEAA  RI  ++  ++      R+++  GGC+G +Y   + T+   +      
Sbjct: 24  MAGIFSLTEAAADRITSMLA-AEPDGSFFRVAVLGGGCSGFQYQFSIDTNRDDEDQVFT- 81

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
              V V ID  SL  +   E+D+  + + S F  +NPN  ++CGCG S  +
Sbjct: 82  SHNVDVIIDEMSLELVDHAELDYVQDLMGSYFAVNNPNATASCGCGTSFSV 132


>gi|304408202|ref|ZP_07389851.1| iron-sulfur cluster assembly accessory protein [Paenibacillus
           curdlanolyticus YK9]
 gi|304342890|gb|EFM08735.1| iron-sulfur cluster assembly accessory protein [Paenibacillus
           curdlanolyticus YK9]
          Length = 119

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 60/106 (56%), Gaps = 1/106 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +++ AV +IKE++   +     +R+ +K+GGC+G  Y +    +      +L   +G
Sbjct: 1   MIKVSDTAVDKIKEMLAAEETPNMFLRVGVKEGGCSGFSYGMGFDDEQHEGDQELSA-NG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           +KV +D  S+ Y+ G EID+K   +  GF  HNPN  + CGCG S 
Sbjct: 60  LKVVVDGDSVKYLNGLEIDWKDAAMGGGFTIHNPNATATCGCGSSF 105


>gi|219870333|ref|YP_002474708.1| iron-binding protein, HesB family iron-sulfur (Fe-S) cluster
           formation protein [Haemophilus parasuis SH0165]
 gi|219690537|gb|ACL31760.1| iron-binding protein, HesB family iron-sulfur (Fe-S) cluster
           formation protein [Haemophilus parasuis SH0165]
          Length = 107

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 44/111 (39%), Positives = 68/111 (61%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  +T+TE A  R++  + N +GK  G+R+ +K  GC+GL Y+++ V     D      
Sbjct: 1   MS--ITLTETAADRVRTFLEN-RGKGIGLRLGVKTSGCSGLAYVLEFVDVLNEDDHVFE- 56

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GVK+ +D  SL+Y+ GTE+DF  E L  GF ++NPN  + CGCG+S  +
Sbjct: 57  QHGVKIIVDEKSLVYLSGTELDFVKEGLNEGFKYNNPNVKNECGCGESFNV 107


>gi|149190099|ref|ZP_01868376.1| HesB family protein [Vibrio shilonii AK1]
 gi|148836129|gb|EDL53089.1| HesB family protein [Vibrio shilonii AK1]
          Length = 107

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA  R++  + N +GK  G+R+ +K  GC+G+ Y+++ V +     +     +GV
Sbjct: 3   ISMTEAAASRVRTFLEN-RGKGIGLRLGVKTTGCSGMAYVLEFVDELDDGDEVFEH-EGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID+ SL+Y+ GTE+D+  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDAKSLVYLDGTELDYVKEGLNEGFEFNNPNAKGECGCGESFNV 107


>gi|91225148|ref|ZP_01260370.1| HesB family protein [Vibrio alginolyticus 12G01]
 gi|269965162|ref|ZP_06179296.1| hesB family protein [Vibrio alginolyticus 40B]
 gi|91190091|gb|EAS76362.1| HesB family protein [Vibrio alginolyticus 12G01]
 gi|269830148|gb|EEZ84375.1| hesB family protein [Vibrio alginolyticus 40B]
          Length = 107

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE+A  R++  + +++GK  G+R+ +K  GC+G+ Y+++ V +   + +      GV
Sbjct: 3   ITMTESAASRVRAFL-DNRGKGIGLRLGVKTTGCSGMAYVLEFVDELNEEDEVFEL-SGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIIDQKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|77165127|ref|YP_343652.1| HesB/YadR/YfhF [Nitrosococcus oceani ATCC 19707]
 gi|254433828|ref|ZP_05047336.1| hypothetical protein NOC27_759 [Nitrosococcus oceani AFC27]
 gi|76883441|gb|ABA58122.1| HesB/YadR/YfhF [Nitrosococcus oceani ATCC 19707]
 gi|207090161|gb|EDZ67432.1| hypothetical protein NOC27_759 [Nitrosococcus oceani AFC27]
          Length = 107

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +A+ +IK+++   +   +G+RI +KK GC+G  Y++D         D + + DGV
Sbjct: 3   ITVTASALKQIKKVLSQQEN-VEGLRIGVKKSGCSGYAYVLDFA-KQVKSEDTIFDHDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL ++ GTE+D++ E L   F F NPN    CGCG+S  I
Sbjct: 61  KILVDKKSLNFIDGTELDYRREGLNESFKFQNPNVAGTCGCGESFSI 107


>gi|303257499|ref|ZP_07343511.1| iron-sulfur cluster assembly protein IscA [Burkholderiales
           bacterium 1_1_47]
 gi|331000237|ref|ZP_08323921.1| iron-sulfur cluster assembly protein IscA [Parasutterella
           excrementihominis YIT 11859]
 gi|302859469|gb|EFL82548.1| iron-sulfur cluster assembly protein IscA [Burkholderiales
           bacterium 1_1_47]
 gi|329572403|gb|EGG54056.1| iron-sulfur cluster assembly protein IscA [Parasutterella
           excrementihominis YIT 11859]
          Length = 107

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE A   ++E +   +GK  G+R+ +K  GC+G+ Y ++       +        G+
Sbjct: 3   VTLTEKAASHVEEFLRK-RGKGVGLRVGVKTSGCSGMAYALEFADKIEPEDQVYESY-GI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L +GF F NPN+  +CGCG+S  +
Sbjct: 61  KVIVDPKSLPYINGTELDFVREGLNTGFKFKNPNEKESCGCGKSFHV 107


>gi|83311630|ref|YP_421894.1| hypothetical protein amb2531 [Magnetospirillum magneticum AMB-1]
 gi|82946471|dbj|BAE51335.1| Uncharacterized conserved protein [Magnetospirillum magneticum
           AMB-1]
          Length = 117

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 52/107 (48%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++TE+A  R++ ++         +R+ +  GGC+G  Y + L      D     E  G+
Sbjct: 12  VSVTESAAERVQTLIKMEGKPNMMLRLGVSGGGCSGFSYGISLDDTVNDDDRLFSEF-GI 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL  + G+ +DF  +   S F   NPN  S CGCG S  +
Sbjct: 71  TLVVDQTSLDMLDGSVVDFVEDLSGSSFQVKNPNATSTCGCGSSFSV 117


>gi|293390588|ref|ZP_06634922.1| iron-sulfur cluster assembly protein IscA [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951122|gb|EFE01241.1| iron-sulfur cluster assembly protein IscA [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 107

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE+A  R+++ +   +GK  G+R+ +K  GC+GL YM++ V     D      + GV
Sbjct: 3   ITLTESAADRVRKFLAK-RGKGIGLRLGVKTSGCSGLSYMLEFVDALNEDDQVFE-QHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D+ SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVIVDTKSLVYLDGTQLDFAKEGLNEGFKFANPNVKDECGCGESFNV 107


>gi|255626663|gb|ACU13676.1| unknown [Glycine max]
          Length = 165

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 61/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKDG 63
           V++T+ A+  + + + + + +   +RI +K+GGC+G+ Y +D         DD +IE +G
Sbjct: 57  VSLTDNALKHLNK-MRSERNQDLCLRIGVKQGGCSGMSYTMDFEDRANKRPDDSIIEYEG 115

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            ++  D  SLL++ G ++D+    +  GF F NPN    CGCG+S  
Sbjct: 116 FEIVCDPKSLLFIFGMQLDYSDALIGGGFSFKNPNATQTCGCGKSFA 162


>gi|145589672|ref|YP_001156269.1| iron-sulfur cluster assembly protein IscA [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145048078|gb|ABP34705.1| iron-sulfur cluster assembly protein IscA [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 107

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+ A   +   +   +GK  G+R+ ++  GC+GL Y ++ V +     D + E +GV
Sbjct: 3   ITLTDKAAKHVNRNLEK-RGKGCGLRLGVRTTGCSGLAYQLEYVDEP-APEDQVFESNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV+ID  SL Y+ GTE+DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVFIDPKSLAYLDGTELDFVREGLNEGFKFQNPNVKDECGCGESFRV 107


>gi|226497192|ref|NP_001149228.1| iron-sulfur assembly protein IscA [Zea mays]
 gi|195625618|gb|ACG34639.1| iron-sulfur assembly protein IscA [Zea mays]
          Length = 192

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 59/107 (55%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKDG 63
           +++TE A+  + + +   + +   +RI +K+GGC+G+ Y ++         DD ++E DG
Sbjct: 73  ISLTEKALKHLNQ-MRAERNEVLCLRIGVKQGGCSGMSYTMEFENRENASPDDSVVEYDG 131

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             +  D  SLL+M G E+D+    +  GF F NPN    CGCG+S  
Sbjct: 132 FAIVCDPKSLLFMFGMELDYSDALIGGGFSFQNPNATKTCGCGKSFA 178


>gi|148979048|ref|ZP_01815293.1| putative HesB family protein [Vibrionales bacterium SWAT-3]
 gi|145962021|gb|EDK27309.1| putative HesB family protein [Vibrionales bacterium SWAT-3]
          Length = 113

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++ ++AA  R++ ++   +     +R+ +  GGC+G +Y      +   DGD  I   GV
Sbjct: 8   LSFSDAAATRVQTLIAEEENPELKLRVYITGGGCSGFQYGFTFD-EKVNDGDTTIVNSGV 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D  SL Y++G  +D+      + F  +NPN  + CGCG S  +
Sbjct: 67  TLVVDPMSLQYLMGGVVDYTEGLEGARFFVNNPNATTTCGCGASFSV 113


>gi|292491987|ref|YP_003527426.1| iron-sulfur cluster assembly accessory protein [Nitrosococcus
           halophilus Nc4]
 gi|291580582|gb|ADE15039.1| iron-sulfur cluster assembly accessory protein [Nitrosococcus
           halophilus Nc4]
          Length = 107

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T++A+ +IK+++       +G+R+ +KK GC+G  Y++        +       DG+
Sbjct: 3   ITVTDSALKQIKKVLSQQ-ANVEGLRVGVKKSGCSGYAYVLGFAEQVEPEDTVFDH-DGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL ++ GTE+D++ E L   F F NPN V++CGCG+S  +
Sbjct: 61  KIVIDKQSLGFIDGTELDYRREGLNESFKFQNPNVVASCGCGESFSV 107


>gi|15606896|ref|NP_214277.1| hypothetical protein aq_1857 [Aquifex aeolicus VF5]
 gi|6648042|sp|O67709|Y1857_AQUAE RecName: Full=Protein aq_1857
 gi|2984147|gb|AAC07682.1| hypothetical protein aq_1857 [Aquifex aeolicus VF5]
          Length = 116

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I  +T+ AV  IK++   +  +   +RI +  GGC+G +Y +                DG
Sbjct: 9   IFKVTDKAVEEIKKVAQENNIENPILRIRVVPGGCSGFQYAMGFDDTVEEGDHVFEY-DG 67

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           VKV ID  S+ Y+ G E+D+  + +  GF   NPN   +CGCG S  
Sbjct: 68  VKVVIDPFSMPYVNGAELDYVVDFMGGGFTIRNPNATGSCGCGSSFS 114


>gi|296269265|ref|YP_003651897.1| iron-sulfur cluster assembly accessory protein [Thermobispora
           bispora DSM 43833]
 gi|296092052|gb|ADG88004.1| iron-sulfur cluster assembly accessory protein [Thermobispora
           bispora DSM 43833]
          Length = 117

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T+AA  ++K ++     +   +R++++ GGC+GL Y +     + +DGD +   +GV
Sbjct: 13  VILTDAAAAKVKSLLEQQGEEGLSLRVAVQPGGCSGLRYQLYFDDRS-LDGDIVSTFNGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            V +D  S  Y+ G  IDF       GF   NPN  S+C CG S  
Sbjct: 72  NVVVDRMSAPYLAGATIDFVDTIEKQGFTIDNPNATSSCACGDSFN 117


>gi|303311467|ref|XP_003065745.1| Iron-sulfur cluster assembly accessory family protein [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240105407|gb|EER23600.1| Iron-sulfur cluster assembly accessory family protein [Coccidioides
           posadasii C735 delta SOWgp]
 gi|320039618|gb|EFW21552.1| iron-sulfur cluster assembly accessory protein Isa1 [Coccidioides
           posadasii str. Silveira]
          Length = 249

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 71/107 (66%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV +I+ ++       + IR+ +K  GC+GL Y ++ V + P   D+++E+DG+
Sbjct: 146 MTLTPAAVEQIRNLLSQ--PDPKMIRVGVKNRGCSGLAYHLEFV-EKPAPFDEVVEQDGI 202

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS +L  ++G+E+D++ +KL S FVF NPN    CGCG+S  +
Sbjct: 203 KVLIDSKALFSIIGSEMDWQEDKLASRFVFKNPNIKDECGCGESFMV 249


>gi|205374722|ref|ZP_03227516.1| hypothetical protein Bcoam_16845 [Bacillus coahuilensis m4-4]
          Length = 120

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 65/109 (59%), Gaps = 1/109 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS++V +TEAA ++IK+++  ++ +   +R+S+  GGC+GL Y +    +   D  ++ +
Sbjct: 1   MSEVVIITEAASFQIKDMMKQNEEEGAFLRVSVNGGGCSGLSYGMGFDHEQKEDDVEVQQ 60

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
             G+ + +D  S   + GT ID+K   +  GF   NPN ++ACGCG S 
Sbjct: 61  F-GLHILVDKESASILNGTTIDYKQSLMGGGFTIDNPNAIAACGCGSSF 108


>gi|119194195|ref|XP_001247701.1| hypothetical protein CIMG_01472 [Coccidioides immitis RS]
          Length = 249

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 71/107 (66%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV +I+ ++       + IR+ +K  GC+GL Y ++ V + P   D+++E+DG+
Sbjct: 146 MTLTPAAVEQIRNLLSQ--PDPKMIRVGVKNRGCSGLAYHLEFV-EKPAPFDEVVEQDGI 202

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS +L  ++G+E+D++ +KL S FVF NPN    CGCG+S  +
Sbjct: 203 KVLIDSKALFSIIGSEMDWQEDKLASRFVFKNPNIKDECGCGESFMV 249


>gi|196233473|ref|ZP_03132316.1| iron-sulfur cluster assembly accessory protein [Chthoniobacter
           flavus Ellin428]
 gi|196222469|gb|EDY16996.1| iron-sulfur cluster assembly accessory protein [Chthoniobacter
           flavus Ellin428]
          Length = 115

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 39/112 (34%), Positives = 62/112 (55%), Gaps = 2/112 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A+ +++ ++     + QG+RI ++ GGCAGL+Y +      P D       DG
Sbjct: 1   MIQVTEPAIRQLQVMMREQDDQTQGLRIFVEHGGCAGLQYGMGFGQAEPGDEVVER--DG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           VKV I   S  ++ G+ ID+  +   +GF   NPN V +CGCG S E   A+
Sbjct: 59  VKVIIAEKSRHFLDGSTIDYSDDLAGAGFRIQNPNAVRSCGCGTSFEPADAE 110


>gi|118104133|ref|XP_001231752.1| PREDICTED: hypothetical protein [Gallus gallus]
 gi|81170638|sp|Q5ZJ74|ISCA1_CHICK RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|53133780|emb|CAG32219.1| hypothetical protein RCJMB04_20e4 [Gallus gallus]
          Length = 129

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK+++ +   +  G+++ ++  GC GL Y ++         ++++ +DGV
Sbjct: 25  LTLTPSAVQKIKQLLKDQ-PEHVGVKVGVRTRGCNGLSYTLEYTKSKGDSDEEVV-QDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|242094662|ref|XP_002437821.1| hypothetical protein SORBIDRAFT_10g003200 [Sorghum bicolor]
 gi|241916044|gb|EER89188.1| hypothetical protein SORBIDRAFT_10g003200 [Sorghum bicolor]
          Length = 193

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKDG 63
           +++TE A+  + + +   + +   +RI +K+GGC+G+ Y ++  +      DD ++E DG
Sbjct: 74  ISLTEKALKHLNK-MRAERNEDLCLRIGVKQGGCSGMSYTMEFESRANASPDDSVVEYDG 132

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             +  D  SLL+M G E+D+    +  GF F NPN    CGCG+S  
Sbjct: 133 FAIVCDPKSLLFMFGMELDYSDALIGGGFHFQNPNATKTCGCGKSFA 179


>gi|90413141|ref|ZP_01221137.1| putative HesB family protein [Photobacterium profundum 3TCK]
 gi|90325832|gb|EAS42284.1| putative HesB family protein [Photobacterium profundum 3TCK]
          Length = 113

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 1   MSD---IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSD    ++ ++ A  ++K ++   +     +R+ +  GGC+G +Y      +   DGD 
Sbjct: 1   MSDANVPLSFSDVAANKVKTLIAEEENPELKLRVYITGGGCSGFQYGFTFD-EKVNDGDM 59

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IE  GV + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 60  TIENSGVTLVVDPMSLQYLVGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|78066899|ref|YP_369668.1| Iron-sulphur cluster assembly protein IscA [Burkholderia sp. 383]
 gi|77967644|gb|ABB09024.1| Iron-sulfur cluster assembly protein IscA [Burkholderia sp. 383]
          Length = 107

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +     D + E  GV
Sbjct: 3   ISLTEKAAQHVQKYLV-RRGKGVGLRLGVRTTGCSGLAYKLEYVDEL-APEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|297170831|gb|ADI21851.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF0130_25M15]
          Length = 110

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 54/106 (50%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T+AA  ++  ++ +    +  +R+ +  GGCAG +Y              +  K+GV
Sbjct: 6   IIFTDAAANKVGALLEDEDNHSMHLRVYVTGGGCAGFQYGFSFDESKDESDTMVE-KNGV 64

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+ +D  S+ Y+LG EIDF+ +   + FV  NPN  + C CG S  
Sbjct: 65  KLVVDPMSIQYLLGAEIDFQEDLQGARFVIKNPNASTTCSCGSSFS 110


>gi|117923849|ref|YP_864466.1| iron-sulfur cluster assembly accessory protein [Magnetococcus sp.
           MC-1]
 gi|117607605|gb|ABK43060.1| iron-sulfur cluster assembly accessory protein [Magnetococcus sp.
           MC-1]
          Length = 121

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 54/106 (50%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  ++  ++         +RI +  GGC+G +Y      +N  D D ++E   V
Sbjct: 3   ITLTENATSKLTSLIAEENNPNLKLRIFVSGGGCSGFQYGFTFD-ENQEDTDLVVESGSV 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           KV +D  S+ Y+ G EIDF  +   + F   NPN  S CGCG S  
Sbjct: 62  KVLVDPTSINYLRGAEIDFVEDLNGASFQIKNPNAQSTCGCGNSFT 107


>gi|224088740|ref|XP_002194930.1| PREDICTED: zinc finger, CCHC domain containing 6 [Taeniopygia
           guttata]
          Length = 129

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IKE++ +      G+++ ++  GC GL Y ++         ++++ +DGV
Sbjct: 25  LTLTPSAVQKIKELLKDK-PDHVGVKVGVRTRGCNGLSYTLEYTKSKGDSDEEVV-QDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|320096287|ref|ZP_08027862.1| HesB/YadR/YfhF family protein [Actinomyces sp. oral taxon 178 str.
           F0338]
 gi|319976780|gb|EFW08548.1| HesB/YadR/YfhF family protein [Actinomyces sp. oral taxon 178 str.
           F0338]
          Length = 117

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T+ A  ++K ++         +RI+++ GGC+GL Y +       +DGD + + DGV
Sbjct: 13  VILTDVAATKVKSLLAQEGRDDLRLRIAVQPGGCSGLIYQLYFDDRV-LDGDAIRDFDGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +V +D  S+ Y+ G  IDF       GF   NPN  + C CG+S  
Sbjct: 72  EVIVDRMSVPYLAGATIDFADTIERQGFTIDNPNAQNTCACGESFH 117


>gi|268595315|ref|ZP_06129482.1| iron-sulfur cluster insertion protein ErpA [Neisseria gonorrhoeae
           35/02]
 gi|268597345|ref|ZP_06131512.1| iron-sulfur cluster insertion protein ErpA [Neisseria gonorrhoeae
           FA19]
 gi|268548704|gb|EEZ44122.1| iron-sulfur cluster insertion protein ErpA [Neisseria gonorrhoeae
           35/02]
 gi|268551133|gb|EEZ46152.1| iron-sulfur cluster insertion protein ErpA [Neisseria gonorrhoeae
           FA19]
          Length = 126

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  T++   ++ +++         +R+ +  GGC+G +Y      +   D D  
Sbjct: 15  MSDESPIIFTDSCCAKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFD-EIKNDDDFE 73

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           IEK+G+   +D  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 74  IEKNGLVFLVDPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV 126


>gi|221115690|ref|XP_002155514.1| PREDICTED: similar to GK25017 [Hydra magnipapillata]
          Length = 130

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 71/107 (66%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV R+KE++   +  + G+RI +++ GC GL Y ++  T+     D+++++D V
Sbjct: 26  ITLTSSAVQRVKELL-KEKPSSVGLRIGVRERGCNGLSYTLEYATEKNK-FDEVVKQDDV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ IDS +L+ ++GTE+D+    L S FVF+NPN    CGCG+S  I
Sbjct: 84  QIMIDSKALMSLIGTEMDYSQNLLASEFVFNNPNIKGTCGCGESFHI 130


>gi|311107143|ref|YP_003979996.1| iron-sulfur cluster assembly protein IscA [Achromobacter
           xylosoxidans A8]
 gi|310761832|gb|ADP17281.1| iron-sulfur cluster assembly protein IscA [Achromobacter
           xylosoxidans A8]
          Length = 107

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 43/111 (38%), Positives = 64/111 (57%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  VT+T+ A   I   +   +GK  G+R+ ++  GC+G+ Y ++ V D   +      
Sbjct: 1   MS--VTLTQQAATHIGRYL-QKRGKGIGLRLGVRTTGCSGMAYKLEYVDDVAPEDVVFES 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GVKV+ID  SL Y+ GTE+D+  E L  GF F NPN+ + CGCG+S  +
Sbjct: 58  F-GVKVFIDPKSLSYLDGTELDYAREGLNEGFKFRNPNEKATCGCGESFTV 107


>gi|71083448|ref|YP_266167.1| hesB protein [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062561|gb|AAZ21564.1| hesB protein [Candidatus Pelagibacter ubique HTCC1062]
          Length = 110

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 46/111 (41%), Positives = 79/111 (71%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+ I+ +++ A  RIKEI+   +  + G+R+++K GGCAG+ Y+++         D++IE
Sbjct: 1   MNPIIKLSDNAASRIKEIMSGVESNSIGVRVAVKSGGCAGMSYVMEYA-KEINLSDEIIE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GVKV++D+A+++Y+LGTE+D+K E+  S FVF+NPN+   CGCG+S ++
Sbjct: 60  DKGVKVFVDAAAVMYLLGTEMDYKKEEFSSSFVFNNPNESERCGCGESFKV 110


>gi|110634127|ref|YP_674335.1| FeS assembly scaffold SufA [Mesorhizobium sp. BNC1]
 gi|110285111|gb|ABG63170.1| FeS assembly scaffold SufA [Chelativorans sp. BNC1]
          Length = 128

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 60/114 (52%), Positives = 85/114 (74%), Gaps = 2/114 (1%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++TMT+AA  R++EIV   +G A GIR+ +KKGGCAG+EY +DLVT+     D +   D
Sbjct: 5   QVMTMTDAAAARVREIVETREG-AHGIRVGIKKGGCAGMEYTIDLVTEPNPKDDHIER-D 62

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           GV V++   + L++LGTE+DF+  ++ +GFVF+NPNQ SACGCG+SVE+K ADL
Sbjct: 63  GVHVYVAPEAALFLLGTEMDFEVTRIRTGFVFNNPNQSSACGCGESVELKPADL 116


>gi|261867569|ref|YP_003255491.1| iron-sulfur cluster assembly protein IscA [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412901|gb|ACX82272.1| iron-sulfur cluster assembly protein IscA [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 107

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE+A  R+K  +   +GK  G+R+ +K  GC+GL YM++ V     D      + GV
Sbjct: 3   ITLTESAADRVKTFLAK-RGKGIGLRLGVKTSGCSGLSYMLEFVDALNEDDQVFE-QHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D+ SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVIVDTKSLVYLDGTQLDFTKEGLNEGFKFANPNVKDECGCGESFNV 107


>gi|154509188|ref|ZP_02044830.1| hypothetical protein ACTODO_01709 [Actinomyces odontolyticus ATCC
           17982]
 gi|153798822|gb|EDN81242.1| hypothetical protein ACTODO_01709 [Actinomyces odontolyticus ATCC
           17982]
          Length = 117

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T+ A  ++K ++         +RI+++ GGC+GL Y +       +DGD +   DGV
Sbjct: 13  VILTDVAAAKVKSLLEQEGRDDLRLRIAVQPGGCSGLIYQLYFDDRT-LDGDAIRSFDGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +V +D  S+ Y+ G  IDF       GF   NPN  + C CG+S  
Sbjct: 72  EVVVDRMSVPYLSGATIDFADTIERQGFTIDNPNAQNTCACGESFH 117


>gi|146340984|ref|YP_001206032.1| hypothetical protein BRADO4055 [Bradyrhizobium sp. ORS278]
 gi|146193790|emb|CAL77807.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 113

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 1   MSD----IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGD 56
           M++     VT++E A  RI EI+         +RIS++ GGC+G +Y  D+      D  
Sbjct: 1   MTNASTGPVTISERAARRIGEILGKESA-GAMLRISVEGGGCSGFQYKFDIDRAKAEDDL 59

Query: 57  DLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +   D   V +D AS+ ++ G+E+DF  + + + F  +NPN  ++CGCG S  +
Sbjct: 60  VIAR-DKAVVLVDPASVPFLAGSEVDFVDDLMGASFRINNPNATASCGCGTSFSV 113


>gi|115524968|ref|YP_781879.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris BisA53]
 gi|115518915|gb|ABJ06899.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris BisA53]
          Length = 133

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 46/113 (40%), Positives = 76/113 (67%), Gaps = 1/113 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++ +T+AA  R++++V  +     G+R+ +K GGCAG  Y VD   D     + + +K
Sbjct: 18  PQVMRLTDAAAERVRDLVGRADSTILGLRVGIKNGGCAGQSYTVDYAHDIQPTDEVVEDK 77

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            GVK+ +D  ++L++LGTE+D+K +K+ + FVF+NPNQ SACGCG+SV++  A
Sbjct: 78  -GVKILVDPKAVLFLLGTEMDYKVDKMSATFVFNNPNQTSACGCGESVQLTPA 129


>gi|254804439|ref|YP_003082660.1| hypothetical protein NMO_0439 [Neisseria meningitidis alpha14]
 gi|254667981|emb|CBA04281.1| conserved hypothetical protein [Neisseria meningitidis alpha14]
          Length = 112

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  T++   ++ +++         +R+ +  GGC+G +Y      +   D D  
Sbjct: 1   MSDESPIIFTDSCCAKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFD-EIKNDDDFE 59

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           IEK+G+   +D  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 60  IEKNGLVFLVDPMSYQYLVGAEIDYTENLQGSQFVIRNPNAETTCGCGSSFSV 112


>gi|50084579|ref|YP_046089.1| iron-binding protein [Acinetobacter sp. ADP1]
 gi|49530555|emb|CAG68267.1| iron-binding protein , believed to be involved in Fe-S protein
           formation or repair [Acinetobacter sp. ADP1]
          Length = 106

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 70/108 (64%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   ++  + N +GK +GIR+ +K  GC+GL Y+++ V D+  + D + E+ G
Sbjct: 1   MIHLTETAANHVRNYLLN-RGKGEGIRVGVKTSGCSGLAYVLEFV-DDINEYDQVFEQHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  S++Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSIVYLDGLEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|325104094|ref|YP_004273748.1| iron-sulfur cluster assembly accessory protein [Pedobacter saltans
           DSM 12145]
 gi|324972942|gb|ADY51926.1| iron-sulfur cluster assembly accessory protein [Pedobacter saltans
           DSM 12145]
          Length = 108

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 62/109 (56%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +VT+T+ A  +++E++  +    +  +R+S+K GGC+GL Y +D   +      +    +
Sbjct: 1   MVTITDKAKQKVQELMEGAGLDNSYFLRVSVKGGGCSGLSYNMDFDNEAHSGDQNFE-DN 59

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G+K+ +D  S LY+ GTE+D+       GF F NPN    CGCG+S  +
Sbjct: 60  GLKIVLDMKSFLYLAGTELDYSDGLNGKGFNFVNPNASRTCGCGESFSV 108


>gi|195448473|ref|XP_002071673.1| GK25017 [Drosophila willistoni]
 gi|194167758|gb|EDW82659.1| GK25017 [Drosophila willistoni]
          Length = 130

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 67/106 (63%), Gaps = 2/106 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV RIK ++   +    G+++ +++ GC GL Y +D  +      ++++ +DGV
Sbjct: 26  LTLTPAAVQRIKSLL-QDKPDFVGLKVGVRQRGCNGLSYTLDYASHKDKLDEEVV-QDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           KV+ID  + L +LGTE+D+   KL S FVF+NPN    CGCG+S  
Sbjct: 84  KVFIDKKAQLSLLGTEMDYVESKLSSEFVFNNPNIKGTCGCGESFN 129


>gi|186476214|ref|YP_001857684.1| iron-sulfur cluster assembly protein IscA [Burkholderia phymatum
           STM815]
 gi|184192673|gb|ACC70638.1| iron-sulfur cluster assembly protein IscA [Burkholderia phymatum
           STM815]
          Length = 118

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +   + +     +GV
Sbjct: 14  ITLTEKAAQHVQKYL-TRRGKGVGLRLGVRTTGCSGLAYKLEYVDELAPEDEVFEC-NGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 72  KIVVDPKSLAYIDGTELDFAREGLNEGFRFNNPNVKDECGCGESFRV 118


>gi|157964661|ref|YP_001499485.1| Iron-sulfur cluster assembly accessory protein [Rickettsia
           massiliae MTU5]
 gi|157844437|gb|ABV84938.1| Iron-sulfur cluster assembly accessory protein [Rickettsia
           massiliae MTU5]
          Length = 117

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 67/110 (60%), Gaps = 1/110 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M +++++T +A  ++K ++        GIR+ +K GGCAG  Y V+         D+++E
Sbjct: 1   MKNVISLTASAAKQVKLLIAKRAKPTFGIRVGVKSGGCAGQTYYVEYADSK-NQFDEVVE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           + GV++ ID  +L+Y+LG+++D+   K  S F F NPN+ + CGCG+S  
Sbjct: 60  EKGVRILIDPKALMYILGSKMDYVETKFKSQFTFTNPNEKANCGCGKSFS 109


>gi|327330908|gb|EGE72652.1| HesB/YadR/YfhF family protein [Propionibacterium acnes HL096PA3]
          Length = 117

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 52/106 (49%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AA  ++K ++         +R++++ GGC+GL Y +    +  ++GD +    GV
Sbjct: 13  IILTDAAAAKVKSLLDQEGRDDLALRLAVQPGGCSGLRYQLFFD-ERHLEGDVVKTYGGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            V  D  S  Y+ G  IDF       GF   NPN  S C CG S  
Sbjct: 72  DVVTDRMSAPYLAGATIDFMDTIEKQGFTIDNPNATSTCACGDSFH 117


>gi|262089242|gb|ACY24464.1| putative iron-sulfur cluster assembly accessory protein [uncultured
           crenarchaeote 29d5]
          Length = 116

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 56/109 (51%), Gaps = 1/109 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           + ++T++  A  ++ E +      +  +R+ +  GGC+GL Y +        D   +  +
Sbjct: 7   TQLITISPKAAEKVTEFMKQENKDSLYLRVYVSGGGCSGLSYGMGFEEKPDEDDSVID-Q 65

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +G+K+ +DS S  Y+ GT ID+    + SGF  +NPN   +C CG S  
Sbjct: 66  NGIKMIVDSYSQKYLKGTNIDYIESLMGSGFKINNPNVTKSCSCGHSFS 114


>gi|291233939|ref|XP_002736905.1| PREDICTED: HESB like domain containing 2-like [Saccoglossus
           kowalevskii]
          Length = 130

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +TE+A  +IK ++ +   +  G+RI +K  GC GL Y +D   +     D+ + ++G 
Sbjct: 26  LNLTESAATKIKTLMADK-PQVLGVRIGVKTRGCNGLSYTLDYAYEKQK-FDEEVIQNGA 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV+IDS + L +LGTE+DF   KL S FVF NPN    CGCG+S  +
Sbjct: 84  KVYIDSKAQLTLLGTEMDFVENKLSSEFVFTNPNIKGTCGCGESFNV 130


>gi|291614711|ref|YP_003524868.1| iron-sulfur cluster assembly protein IscA [Sideroxydans
           lithotrophicus ES-1]
 gi|291584823|gb|ADE12481.1| iron-sulfur cluster assembly protein IscA [Sideroxydans
           lithotrophicus ES-1]
          Length = 107

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE A   ++  +   +GK  G+R+ ++  GC+G+ Y ++       +    +  +GV
Sbjct: 3   ISLTENAAKHVQNFLAK-RGKGVGLRLGVRTSGCSGMAYKLEFADAVDSEDLQFV-SNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  SL Y+ G E+D+  E L  GF F+NPN    CGCG+S ++
Sbjct: 61  TVLVDQHSLPYIDGMELDYTREGLNEGFKFNNPNVKDQCGCGESFKV 107


>gi|225076035|ref|ZP_03719234.1| hypothetical protein NEIFLAOT_01062 [Neisseria flavescens
           NRL30031/H210]
 gi|241760828|ref|ZP_04758919.1| iron-sulfur cluster assembly accessory protein [Neisseria
           flavescens SK114]
 gi|261365315|ref|ZP_05978198.1| iron-sulfur cluster assembly accessory protein [Neisseria mucosa
           ATCC 25996]
 gi|261379288|ref|ZP_05983861.1| iron-sulfur cluster assembly accessory protein [Neisseria subflava
           NJ9703]
 gi|319639087|ref|ZP_07993844.1| iron-sulfur cluster insertion protein erpA [Neisseria mucosa C102]
 gi|224952750|gb|EEG33959.1| hypothetical protein NEIFLAOT_01062 [Neisseria flavescens
           NRL30031/H210]
 gi|241318725|gb|EER55277.1| iron-sulfur cluster assembly accessory protein [Neisseria
           flavescens SK114]
 gi|284797725|gb|EFC53072.1| iron-sulfur cluster assembly accessory protein [Neisseria subflava
           NJ9703]
 gi|288566245|gb|EFC87805.1| iron-sulfur cluster assembly accessory protein [Neisseria mucosa
           ATCC 25996]
 gi|317399665|gb|EFV80329.1| iron-sulfur cluster insertion protein erpA [Neisseria mucosa C102]
          Length = 112

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  T++   ++ +++         +R+ +  GGC+G +Y      +   D D  
Sbjct: 1   MSDESPIIFTDSCCTKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFD-EIKNDDDFE 59

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           I+K+G+   +D  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 60  IQKNGLTFLVDPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV 112


>gi|163759510|ref|ZP_02166595.1| hypothetical protein HPDFL43_09162 [Hoeflea phototrophica DFL-43]
 gi|162283107|gb|EDQ33393.1| hypothetical protein HPDFL43_09162 [Hoeflea phototrophica DFL-43]
          Length = 130

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 64/113 (56%), Positives = 86/113 (76%), Gaps = 2/113 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T AA  R+K IV N +G A+GIR+S+KKGGCAG+EY +DL        DD IE+DG
Sbjct: 6   VMTLTPAAAERVKTIVRNEEG-AEGIRVSIKKGGCAGMEYAIDLA-TEINPKDDRIERDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
             V++   ++LY+LGTE+D++  KL SGFVF+NPNQ SACGCG+SVE+K ADL
Sbjct: 64  AAVFVAPEAVLYLLGTEMDYEVTKLRSGFVFNNPNQTSACGCGESVELKPADL 116


>gi|329904113|ref|ZP_08273679.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327548135|gb|EGF32851.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 107

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   I   +   +GK  G+R  ++  GC+GL Y ++ V ++    D + E  GV
Sbjct: 3   ITLTEKAAKHISRYM-ERRGKGIGLRFGVRTTGCSGLAYKLEYVDES-ATEDSMFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+++D  SL Y+ GTE+DF  E L  GF F+NPN   ACGCG+S  I
Sbjct: 61  KLFVDPKSLPYIDGTELDFAREGLNEGFKFYNPNVKDACGCGESFRI 107


>gi|91762129|ref|ZP_01264094.1| hesB protein [Candidatus Pelagibacter ubique HTCC1002]
 gi|91717931|gb|EAS84581.1| hesB protein [Candidatus Pelagibacter ubique HTCC1002]
          Length = 110

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 79/111 (71%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS I+ +++ A  RIKEI+   +  + G+R+++K GGCAG+ Y+++         D++IE
Sbjct: 1   MSPIIKLSDNAASRIKEIMSGVESNSIGVRVAVKSGGCAGMSYVMEYA-KEINPSDEIIE 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GVKV++D+A+++Y+LGTE+D+K E+  S FVF+NPN+   CGCG+S ++
Sbjct: 60  DKGVKVFVDAAAVMYLLGTEMDYKKEEFSSSFVFNNPNESERCGCGESFKV 110


>gi|91091584|ref|XP_968263.1| PREDICTED: similar to conserved hypothetical protein [Tribolium
           castaneum]
 gi|270001035|gb|EEZ97482.1| hypothetical protein TcasGA2_TC011316 [Tribolium castaneum]
          Length = 129

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 45/105 (42%), Positives = 65/105 (61%), Gaps = 2/105 (1%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T AAV R+KEI+        G++I +K+ GC GL Y +D V       D+ + +DGV++
Sbjct: 27  LTPAAVNRVKEILKGQDN-YVGLKIGVKQRGCNGLSYTLDYVDKKDK-MDEEVVQDGVRI 84

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +ID  + L +LGTE+D+   KL S FVF+NPN    CGCG+S  I
Sbjct: 85  FIDKKAQLTLLGTEMDYVQNKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|319404149|emb|CBI77742.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 107

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +++ A  +I +I+    GK   +RIS++ GGC+G  Y  DLV     + D +I+KDG 
Sbjct: 3   VNISDIAAKQIAQILAEQPGKT-ALRISVEGGGCSGFSYKYDLV-SESKEDDFVIKKDGA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V+IDS S  +M G EIDF  + +   F  HNPN  S+CGCG S  I
Sbjct: 61  VVFIDSISFPFMEGAEIDFVDDLMGQSFQIHNPNATSSCGCGVSFSI 107


>gi|332558087|ref|ZP_08412409.1| Iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides WS8N]
 gi|332275799|gb|EGJ21114.1| Iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides WS8N]
          Length = 108

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 44/111 (39%), Positives = 68/111 (61%), Gaps = 3/111 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+    +T+ A  R+ EI   + G+ + +R++++ GGC+G +Y  ++  D+P   D ++E
Sbjct: 1   MNLPPRVTDRAFARLAEI-AEASGETRALRVAVEGGGCSGFQY--EIKLDDPGADDLVLE 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KDG KV ID  SL ++   EID+  E + S FV HNPN  S+CGCG S  I
Sbjct: 58  KDGQKVLIDQVSLPFLANAEIDYTDELIGSRFVIHNPNASSSCGCGTSFSI 108


>gi|152981602|ref|YP_001352944.1| [Fe-S] cluster formation/repair protein [Janthinobacterium sp.
           Marseille]
 gi|151281679|gb|ABR90089.1| [Fe-S] cluster formation/repair protein [Janthinobacterium sp.
           Marseille]
          Length = 107

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   I   +   +GK  G+R  ++  GC+GL Y ++ V ++  + D + E  G+
Sbjct: 3   ITLTEKAAKHITRYM-ERRGKGIGLRFGVRTTGCSGLAYKLEYVDES-ANEDSVFESHGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+DF  E L  GF F NPN    CGCG+S  I
Sbjct: 61  KVFVDPKSLPYIDGTELDFAREGLNEGFKFRNPNVKDECGCGESFRI 107


>gi|83593900|ref|YP_427652.1| HesB/YadR/YfhF [Rhodospirillum rubrum ATCC 11170]
 gi|83576814|gb|ABC23365.1| HesB/YadR/YfhF [Rhodospirillum rubrum ATCC 11170]
          Length = 113

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 72/110 (65%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              +T+TEAAV RIK ++  +     G+R+ +   GC+GL Y +D   D P   ++++ +
Sbjct: 4   PPPITLTEAAVARIKALMARADKPVAGLRVGVSTKGCSGLSYKIDYAEDGPRPFEEVVSQ 63

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DG  V+++S ++++++G+++DFK +KL + F F NPN+ + CGCG+S  +
Sbjct: 64  DGATVFLESNAVMFLIGSQMDFKQDKLSATFSFANPNEKARCGCGESFSV 113


>gi|15602185|ref|NP_245257.1| hypothetical protein PM0320 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720557|gb|AAK02404.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 107

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE A  R++  + N +GK  G+R+ +K  GC+GL Y+++ V +   +      + GV
Sbjct: 3   ISLTETAADRVRTFLAN-RGKGIGLRLGIKTSGCSGLAYVLEFVDELNPEDQVFE-QHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D+ SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIVDAKSLVYLDGTELDFAKEGLNEGFKFNNPNVKDQCGCGESFHV 107


>gi|12584843|gb|AAG59854.1|AF284752_1 GK004 [Homo sapiens]
          Length = 130

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK+++ +   +  G+++ ++  GC GL Y ++         +++I +DGV
Sbjct: 26  LTLTPSAVNKIKQLLKDK-PEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVI-QDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 84  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 130


>gi|293189816|ref|ZP_06608530.1| HesB/YadR/YfhF family protein [Actinomyces odontolyticus F0309]
 gi|292821231|gb|EFF80176.1| HesB/YadR/YfhF family protein [Actinomyces odontolyticus F0309]
          Length = 117

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T+ A  ++K ++         +RI+++ GGC+GL Y +       +DGD +   DGV
Sbjct: 13  VILTDVAAAKVKSLLEQEGRDDLRLRIAVQPGGCSGLIYQLYFDDRT-LDGDAIRSFDGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +V +D  S+ Y+ G  IDF       GF   NPN  + C CG+S  
Sbjct: 72  EVVVDRMSVPYLSGATIDFADTIERQGFTIDNPNAQNTCACGESFH 117


>gi|296156153|ref|ZP_06838992.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp. Ch1-1]
 gi|295893659|gb|EFG73438.1| iron-sulfur cluster assembly protein IscA [Burkholderia sp. Ch1-1]
          Length = 107

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 57/107 (53%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T AA   +++ +        G+R+++K  GC+G  Y ++ V     +        GV
Sbjct: 3   ISLTPAAARHVEKSLRKRGS-GIGLRVAVKTSGCSGFAYALEFVDTANDEDQRFEA-HGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  SL  + GTE+DF  E L  GF FHNPN  + CGCG+S  +
Sbjct: 61  TVVVDPRSLTMLDGTELDFVREGLNEGFRFHNPNARANCGCGESFAV 107


>gi|293606130|ref|ZP_06688495.1| iron-sulfur cluster assembly protein IscA [Achromobacter piechaudii
           ATCC 43553]
 gi|292815585|gb|EFF74701.1| iron-sulfur cluster assembly protein IscA [Achromobacter piechaudii
           ATCC 43553]
          Length = 107

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 43/111 (38%), Positives = 65/111 (58%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  VT+T+ A   I   +   +GK  G+R+ ++  GC+G+ Y ++ V D+  +      
Sbjct: 1   MS--VTLTQQAATHIGRYL-QKRGKGIGLRLGVRTTGCSGMAYKLEYVDDSAPEDVVFES 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GVKV+ID  SL Y+ GTE+D+  E L  GF F NPN+ + CGCG+S  +
Sbjct: 58  F-GVKVFIDPKSLAYLDGTELDYAREGLNEGFKFRNPNEKATCGCGESFTV 107


>gi|260912951|ref|ZP_05919436.1| iron-binding protein IscA [Pasteurella dagmatis ATCC 43325]
 gi|260632941|gb|EEX51107.1| iron-binding protein IscA [Pasteurella dagmatis ATCC 43325]
          Length = 107

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TEAA  R++  + N +GK  G+R+ +K  GC+GL Y+++ V +     D + E+ GV
Sbjct: 3   ISLTEAAADRVRTFLTN-RGKGIGLRLGIKTSGCSGLAYVLEFVDEL-NPDDQVFEQHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D+ SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIVDAKSLVYLDGTELDFAKEGLNEGFKFNNPNVKDQCGCGESFHV 107


>gi|149580480|ref|XP_001511499.1| PREDICTED: similar to HESB like domain containing 2
           [Ornithorhynchus anatinus]
          Length = 129

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV +IK+++ +   +  G+++ ++  GC GL Y ++         ++++ +DG+
Sbjct: 25  LTLTPSAVNKIKQLLKDK-PENVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVV-QDGI 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|50842188|ref|YP_055415.1| HesB protein, putative for nitrogen fixation [Propionibacterium
           acnes KPA171202]
 gi|289426140|ref|ZP_06427886.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes SK187]
 gi|289426863|ref|ZP_06428589.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes J165]
 gi|295130276|ref|YP_003580939.1| iron binding protein from the HesB_IscA_SufA family protein
           [Propionibacterium acnes SK137]
 gi|50839790|gb|AAT82457.1| HesB protein, putative for nitrogen fixation [Propionibacterium
           acnes KPA171202]
 gi|289153305|gb|EFD02020.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes SK187]
 gi|289159952|gb|EFD08130.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes J165]
 gi|291375460|gb|ADD99314.1| iron binding protein from the HesB_IscA_SufA family protein
           [Propionibacterium acnes SK137]
 gi|313763851|gb|EFS35215.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL013PA1]
 gi|313771443|gb|EFS37409.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL074PA1]
 gi|313791512|gb|EFS39630.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL110PA1]
 gi|313802401|gb|EFS43627.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL110PA2]
 gi|313808274|gb|EFS46748.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL087PA2]
 gi|313811265|gb|EFS48979.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL083PA1]
 gi|313812445|gb|EFS50159.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL025PA1]
 gi|313814782|gb|EFS52496.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL059PA1]
 gi|313818870|gb|EFS56584.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL046PA2]
 gi|313820692|gb|EFS58406.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL036PA1]
 gi|313822367|gb|EFS60081.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL036PA2]
 gi|313825838|gb|EFS63552.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL063PA1]
 gi|313828184|gb|EFS65898.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL063PA2]
 gi|313830985|gb|EFS68699.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL007PA1]
 gi|313833410|gb|EFS71124.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL056PA1]
 gi|313838985|gb|EFS76699.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL086PA1]
 gi|314915057|gb|EFS78888.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL005PA4]
 gi|314918611|gb|EFS82442.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL050PA1]
 gi|314920589|gb|EFS84420.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL050PA3]
 gi|314925549|gb|EFS89380.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL036PA3]
 gi|314932264|gb|EFS96095.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL067PA1]
 gi|314954697|gb|EFS99103.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL027PA1]
 gi|314958559|gb|EFT02661.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL002PA1]
 gi|314959843|gb|EFT03945.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL002PA2]
 gi|314968185|gb|EFT12284.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL037PA1]
 gi|314973868|gb|EFT17964.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL053PA1]
 gi|314976523|gb|EFT20618.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL045PA1]
 gi|314979293|gb|EFT23387.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL072PA2]
 gi|314983366|gb|EFT27458.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL005PA1]
 gi|314986781|gb|EFT30873.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL005PA2]
 gi|314989343|gb|EFT33434.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL005PA3]
 gi|315077323|gb|EFT49383.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL053PA2]
 gi|315080066|gb|EFT52042.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL078PA1]
 gi|315085147|gb|EFT57123.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL002PA3]
 gi|315089057|gb|EFT61033.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL072PA1]
 gi|315096415|gb|EFT68391.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL038PA1]
 gi|315099057|gb|EFT71033.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL059PA2]
 gi|315100937|gb|EFT72913.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL046PA1]
 gi|315107125|gb|EFT79101.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL030PA1]
 gi|315108158|gb|EFT80134.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL030PA2]
 gi|327326894|gb|EGE68677.1| HesB/YadR/YfhF family protein [Propionibacterium acnes HL096PA2]
 gi|327331029|gb|EGE72771.1| HesB/YadR/YfhF family protein [Propionibacterium acnes HL097PA1]
 gi|327442900|gb|EGE89554.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL043PA1]
 gi|327445025|gb|EGE91679.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL043PA2]
 gi|327447517|gb|EGE94171.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL013PA2]
 gi|327450003|gb|EGE96657.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL087PA3]
 gi|327455267|gb|EGF01922.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL092PA1]
 gi|327455449|gb|EGF02104.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL083PA2]
 gi|328752671|gb|EGF66287.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL087PA1]
 gi|328752891|gb|EGF66507.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL020PA1]
 gi|328759414|gb|EGF73030.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL025PA2]
 gi|328760355|gb|EGF73925.1| HesB/YadR/YfhF family protein [Propionibacterium acnes HL099PA1]
 gi|332675116|gb|AEE71932.1| HesB family protein [Propionibacterium acnes 266]
          Length = 117

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 52/106 (49%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AA  ++K ++         +R++++ GGC+GL Y +    +  ++GD +    GV
Sbjct: 13  IILTDAAAAKVKSLLDQEGRDDLALRLAVQPGGCSGLRYQLFFD-ERHLEGDVVKTYGGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            V  D  S  Y+ G  IDF       GF   NPN  S C CG S  
Sbjct: 72  DVVTDRMSAPYLAGATIDFMDTIEKQGFTIDNPNATSTCACGDSFH 117


>gi|195133108|ref|XP_002010981.1| GI16259 [Drosophila mojavensis]
 gi|193906956|gb|EDW05823.1| GI16259 [Drosophila mojavensis]
          Length = 130

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 68/106 (64%), Gaps = 2/106 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV RIK ++  ++    G+++ +++ GC GL Y +D  +      ++++ +DGV
Sbjct: 26  LTLTPAAVNRIKSLL-QNKPDVIGLKVGVRQRGCNGLSYTLDYASTKDKLDEEVV-QDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           KV+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  
Sbjct: 84  KVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFS 129


>gi|170694741|ref|ZP_02885892.1| iron-sulfur cluster assembly protein IscA [Burkholderia graminis
           C4D1M]
 gi|170140372|gb|EDT08549.1| iron-sulfur cluster assembly protein IscA [Burkholderia graminis
           C4D1M]
          Length = 107

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +   + +     +GV
Sbjct: 3   ITLTEKAAQHVQKYLI-RRGKGVGLRLGVRTTGCSGLAYKLEYVDELAPEDEVFEC-NGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDPKSLAYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV 107


>gi|294054728|ref|YP_003548386.1| iron-sulfur cluster assembly accessory protein [Coraliomargarita
           akajimensis DSM 45221]
 gi|293614061|gb|ADE54216.1| iron-sulfur cluster assembly accessory protein [Coraliomargarita
           akajimensis DSM 45221]
          Length = 105

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 58/107 (54%), Gaps = 2/107 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T++A  +I+++        Q +RI ++ GGC+G EY +        + D  +E +G
Sbjct: 1   MITLTDSAAAQIRKMQAEKASDGQRLRIFVEPGGCSGFEYGMSFDDV--KEADQELESNG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           V   ID+ SL Y+ G+ ++F       GF   NPN  S CGCG+S  
Sbjct: 59  VPFLIDATSLEYLDGSVVEFDDGLNGKGFEIKNPNATSTCGCGRSFN 105


>gi|284040656|ref|YP_003390586.1| iron-sulfur cluster assembly accessory protein [Spirosoma linguale
           DSM 74]
 gi|283819949|gb|ADB41787.1| iron-sulfur cluster assembly accessory protein [Spirosoma linguale
           DSM 74]
          Length = 108

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 60/109 (55%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +VT+++ A  +I E+       +   IR++++ GGC+GL Y +          D L+E  
Sbjct: 1   MVTVSDIAKNKIVELRQKDGLAEDTAIRVAVEGGGCSGLMYDLQFD-ATQQPTDHLVEDK 59

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G+K+ +D  SLLY+ GTE+DF       GF F NPN    CGCG+S  +
Sbjct: 60  GIKILVDRKSLLYLAGTELDFSDGLNGKGFQFKNPNATRTCGCGESFAV 108


>gi|49474354|ref|YP_032396.1| hypothetical protein BQ07680 [Bartonella quintana str. Toulouse]
 gi|49239858|emb|CAF26252.1| hypothetical protein BQ07680 [Bartonella quintana str. Toulouse]
          Length = 107

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 68/111 (61%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  V +++ A  RI +I+ +   K  G+RIS++ GGC+G  Y  +LV     + D +++
Sbjct: 1   MN--VNISDVAAKRIAQILLSETDK-IGLRISVEGGGCSGFSYKYNLV-SETSEDDLVLK 56

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KDG  V+IDS SL +M G EIDF  + +   F  HNPN VS+CGCG S  I
Sbjct: 57  KDGAVVFIDSLSLPFMEGAEIDFVDDLMGQSFQIHNPNAVSSCGCGVSFSI 107


>gi|15676462|ref|NP_273601.1| iron-sulfur cluster insertion protein ErpA [Neisseria meningitidis
           MC58]
 gi|59801769|ref|YP_208481.1| iron-sulfur cluster insertion protein ErpA [Neisseria gonorrhoeae
           FA 1090]
 gi|121634352|ref|YP_974597.1| iron-sulfur cluster insertion protein ErpA [Neisseria meningitidis
           FAM18]
 gi|218767680|ref|YP_002342192.1| iron-sulfur cluster insertion protein ErpA [Neisseria meningitidis
           Z2491]
 gi|239999504|ref|ZP_04719428.1| hypothetical protein Ngon3_08461 [Neisseria gonorrhoeae 35/02]
 gi|240014681|ref|ZP_04721594.1| hypothetical protein NgonD_08553 [Neisseria gonorrhoeae DGI18]
 gi|240017128|ref|ZP_04723668.1| hypothetical protein NgonFA_08156 [Neisseria gonorrhoeae FA6140]
 gi|240081234|ref|ZP_04725777.1| hypothetical protein NgonF_07995 [Neisseria gonorrhoeae FA19]
 gi|240113445|ref|ZP_04727935.1| hypothetical protein NgonM_07754 [Neisseria gonorrhoeae MS11]
 gi|240116209|ref|ZP_04730271.1| hypothetical protein NgonPID1_08195 [Neisseria gonorrhoeae PID18]
 gi|240118493|ref|ZP_04732555.1| hypothetical protein NgonPID_08522 [Neisseria gonorrhoeae PID1]
 gi|240121203|ref|ZP_04734165.1| hypothetical protein NgonPI_05423 [Neisseria gonorrhoeae PID24-1]
 gi|240124035|ref|ZP_04736991.1| hypothetical protein NgonP_08853 [Neisseria gonorrhoeae PID332]
 gi|240126342|ref|ZP_04739228.1| hypothetical protein NgonSK_09094 [Neisseria gonorrhoeae SK-92-679]
 gi|240128701|ref|ZP_04741362.1| hypothetical protein NgonS_08742 [Neisseria gonorrhoeae SK-93-1035]
 gi|254494220|ref|ZP_05107391.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|260439978|ref|ZP_05793794.1| hypothetical protein NgonDG_02640 [Neisseria gonorrhoeae DGI2]
 gi|268599519|ref|ZP_06133686.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268601871|ref|ZP_06136038.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268604202|ref|ZP_06138369.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268682661|ref|ZP_06149523.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268684928|ref|ZP_06151790.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268687088|ref|ZP_06153950.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|75355676|sp|Q5F6W8|ERPA_NEIG1 RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|81707240|sp|Q7DDN1|ERPA_NEIMB RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|160385713|sp|A1IQG0|ERPA_NEIMA RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|160385714|sp|A1KSG6|ERPA_NEIMF RecName: Full=Putative iron-sulfur cluster insertion protein erpA
 gi|7225784|gb|AAF40985.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|59718664|gb|AAW90069.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|120866058|emb|CAM09796.1| hypothetical protein NMC0498 [Neisseria meningitidis FAM18]
 gi|121051688|emb|CAM07991.1| hypothetical protein NMA0739 [Neisseria meningitidis Z2491]
 gi|226513260|gb|EEH62605.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|254671462|emb|CBA09003.1| conserved hypothetical protein [Neisseria meningitidis alpha153]
 gi|254673414|emb|CBA08745.1| conserved hypothetical protein [Neisseria meningitidis alpha275]
 gi|261393073|emb|CAX50668.1| conserved hypothetical protein [Neisseria meningitidis 8013]
 gi|268583650|gb|EEZ48326.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268586002|gb|EEZ50678.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268588333|gb|EEZ53009.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268622945|gb|EEZ55345.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268625212|gb|EEZ57612.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268627372|gb|EEZ59772.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|308388741|gb|ADO31061.1| HesB/YadR/YfhF family protein [Neisseria meningitidis alpha710]
 gi|319409935|emb|CBY90262.1| conserved hypothetical protein [Neisseria meningitidis WUE 2594]
 gi|325127685|gb|EGC50598.1| iron-sulfur cluster assembly accessory protein [Neisseria
           meningitidis N1568]
 gi|325129690|gb|EGC52503.1| iron-sulfur cluster assembly accessory protein [Neisseria
           meningitidis OX99.30304]
 gi|325131770|gb|EGC54471.1| iron-sulfur cluster assembly accessory protein [Neisseria
           meningitidis M6190]
 gi|325133928|gb|EGC56584.1| iron-sulfur cluster assembly accessory protein [Neisseria
           meningitidis M13399]
 gi|325135853|gb|EGC58465.1| iron-sulfur cluster assembly accessory protein [Neisseria
           meningitidis M0579]
 gi|325137660|gb|EGC60237.1| iron-sulfur cluster assembly accessory protein [Neisseria
           meningitidis ES14902]
 gi|325139791|gb|EGC62324.1| iron-sulfur cluster assembly accessory protein [Neisseria
           meningitidis CU385]
 gi|325141782|gb|EGC64231.1| iron-sulfur cluster assembly accessory protein [Neisseria
           meningitidis 961-5945]
 gi|325144057|gb|EGC66367.1| iron-sulfur cluster assembly accessory protein [Neisseria
           meningitidis M01-240013]
 gi|325197769|gb|ADY93225.1| iron-sulfur cluster assembly accessory protein [Neisseria
           meningitidis G2136]
 gi|325200755|gb|ADY96210.1| iron-sulfur cluster assembly accessory protein [Neisseria
           meningitidis H44/76]
 gi|325202654|gb|ADY98108.1| iron-sulfur cluster assembly accessory protein [Neisseria
           meningitidis M01-240149]
 gi|325203647|gb|ADY99100.1| iron-sulfur cluster assembly accessory protein [Neisseria
           meningitidis M01-240355]
 gi|325206593|gb|ADZ02046.1| iron-sulfur cluster assembly accessory protein [Neisseria
           meningitidis M04-240196]
 gi|325207600|gb|ADZ03052.1| iron-sulfur cluster assembly accessory protein [Neisseria
           meningitidis NZ-05/33]
          Length = 112

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  T++   ++ +++         +R+ +  GGC+G +Y      +   D D  
Sbjct: 1   MSDESPIIFTDSCCAKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFD-EIKNDDDFE 59

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           IEK+G+   +D  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 60  IEKNGLVFLVDPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV 112


>gi|89068858|ref|ZP_01156241.1| iron-sulfur cluster assembly accessory protein [Oceanicola
           granulosus HTCC2516]
 gi|89045628|gb|EAR51691.1| iron-sulfur cluster assembly accessory protein [Oceanicola
           granulosus HTCC2516]
          Length = 126

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 44/114 (38%), Positives = 72/114 (63%), Gaps = 3/114 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              VT+T+ A  +I+ ++     +  G+RI +KKGGCAG+EY +D         D+++E+
Sbjct: 7   KQAVTITDRAAAQIRRLMQRDGHQ--GLRIGVKKGGCAGMEYTMDFADSVD-PNDEVVEQ 63

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           DG +V I   + +++ GTEID++T  L SGF F+NPN   +CGCG+S++ K  +
Sbjct: 64  DGARVMIAPMAQMFLFGTEIDYQTALLESGFKFNNPNVTDSCGCGESIKFKDVE 117


>gi|332971026|gb|EGK09997.1| iron-sulfur cluster assembly accessory protein [Kingella kingae
           ATCC 23330]
          Length = 114

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 57/113 (50%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  TE+   ++ +++         +R+ +  GGC+G +Y      +   D D  
Sbjct: 3   MSDEYPINFTESCCTKVADLIAEENNPDLMLRVFVNGGGCSGFQYGFTFD-EIKNDDDFE 61

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           IEK+G+K  +D  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 62  IEKNGLKFLVDPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV 114


>gi|94968609|ref|YP_590657.1| HesB/YadR/YfhF [Candidatus Koribacter versatilis Ellin345]
 gi|94550659|gb|ABF40583.1| HesB/YadR/YfhF [Candidatus Koribacter versatilis Ellin345]
          Length = 186

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 60/107 (56%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T  AV ++KEI+        G+R+ +  GGC+G  Y ++  T      D + E DG+
Sbjct: 81  LNLTPNAVAKVKEIMSQQNPVPAGLRVGVVGGGCSGFSYSMNFETSA-GLMDKVYEFDGL 139

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV+ID+ S++Y+ G  +D+      +GF F NPN  S CGCG S  +
Sbjct: 140 KVYIDATSVVYLNGAVVDYVETLEGAGFKFENPNVKSTCGCGSSFSV 186


>gi|115352212|ref|YP_774051.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria
           AMMD]
 gi|115282200|gb|ABI87717.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria
           AMMD]
          Length = 122

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +     D + E  GV
Sbjct: 18  ITLTEKAAQHVQKYLV-RRGKGVGLRLGVRTTGCSGLAYKLEYVDEL-APEDQVFESHGV 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GT++DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 76  KVIVDPKSLAYIDGTQLDFAREGLNEGFKFNNPNVKDECGCGESFRV 122


>gi|256422371|ref|YP_003123024.1| iron-sulfur cluster assembly accessory protein [Chitinophaga
           pinensis DSM 2588]
 gi|256037279|gb|ACU60823.1| iron-sulfur cluster assembly accessory protein [Chitinophaga
           pinensis DSM 2588]
          Length = 109

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQG-KAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++T++E A   IK+++          +R+ +K GGC+GLEY++   +    +GD   E  
Sbjct: 1   MITVSEKAGEYIKDLMVKENHAPGTFVRVGVKGGGCSGLEYVLKFESSEHEEGDQTFEDK 60

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVK+ +   SLLY+ GTE+D+       G  F+NPN    C CG+S  +
Sbjct: 61  GVKIVVQMKSLLYLYGTELDYSDGLNGKGLYFNNPNATRTCSCGESFAV 109


>gi|52081706|ref|YP_080497.1| hypothetical protein BL03149 [Bacillus licheniformis ATCC 14580]
 gi|52787091|ref|YP_092920.1| YutM [Bacillus licheniformis ATCC 14580]
 gi|319647622|ref|ZP_08001840.1| YutM protein [Bacillus sp. BT1B_CT2]
 gi|52004917|gb|AAU24859.1| conserved protein YutM [Bacillus licheniformis ATCC 14580]
 gi|52349593|gb|AAU42227.1| YutM [Bacillus licheniformis ATCC 14580]
 gi|317389963|gb|EFV70772.1| YutM protein [Bacillus sp. BT1B_CT2]
          Length = 121

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 63/110 (57%), Gaps = 2/110 (1%)

Query: 1   MS-DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           MS   VT+TEAA   IK+++   + +   +RI +K GGC+GL Y +    +   D ++ +
Sbjct: 1   MSEKTVTVTEAAALHIKDMMKEHEEENAFLRIGVKGGGCSGLSYGMGFEHEKNEDDNEFV 60

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
            + G+ V +D  SL  M GT IDFK   +  GF   NPN +++CGCG S 
Sbjct: 61  -QHGITVLVDQESLDIMNGTVIDFKQSMMGGGFTIDNPNAIASCGCGSSF 109


>gi|241251061|ref|XP_002403434.1| iron-sulfur protein Isa2, putative [Ixodes scapularis]
 gi|241998666|ref|XP_002433976.1| iron-sulfur protein Isa2, putative [Ixodes scapularis]
 gi|215495735|gb|EEC05376.1| iron-sulfur protein Isa2, putative [Ixodes scapularis]
 gi|215496508|gb|EEC06148.1| iron-sulfur protein Isa2, putative [Ixodes scapularis]
          Length = 129

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 45/105 (42%), Positives = 67/105 (63%), Gaps = 2/105 (1%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T+AAV RI+ ++      A G+R+ +K  GC GL Y++D  T+     D  + +DGVKV
Sbjct: 27  LTKAAVERIQRLLSTKG-DAIGLRVGVKHRGCNGLTYVLDYATEK-GRFDVEVHQDGVKV 84

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++DS + L +LGTE+DF   +L S FVF+NPN    CGCG+S  +
Sbjct: 85  FVDSKAQLSLLGTEMDFVETELSSEFVFNNPNVKGTCGCGESFTL 129


>gi|77463210|ref|YP_352714.1| HesB/YadR/YfhF family protein [Rhodobacter sphaeroides 2.4.1]
 gi|126462084|ref|YP_001043198.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221639070|ref|YP_002525332.1| Iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides KD131]
 gi|77387628|gb|ABA78813.1| HesB/YadR/YfhF family protein [Rhodobacter sphaeroides 2.4.1]
 gi|126103748|gb|ABN76426.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221159851|gb|ACM00831.1| Iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides KD131]
          Length = 108

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 44/111 (39%), Positives = 68/111 (61%), Gaps = 3/111 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+    +T+ A  R+ EI   + G+ + +R++++ GGC+G +Y  ++  D+P   D ++E
Sbjct: 1   MNLPPRVTDRAFARLAEI-AEASGETRALRVAVEGGGCSGFQY--EIKLDDPGSDDLVLE 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KDG KV ID  SL ++   EID+  E + S FV HNPN  S+CGCG S  I
Sbjct: 58  KDGQKVLIDQVSLPFLANAEIDYTDELIGSRFVIHNPNASSSCGCGTSFSI 108


>gi|332821405|ref|XP_003310762.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Pan troglodytes]
          Length = 249

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 67/108 (62%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV  IK+++ +   +  G+++ ++  GC GL Y ++          + I +DGV
Sbjct: 111 LTLTPSAVNTIKQLLKDK-PEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDKEFI-QDGV 168

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I+
Sbjct: 169 RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNIR 216


>gi|27379870|ref|NP_771399.1| hypothetical protein blr4759 [Bradyrhizobium japonicum USDA 110]
 gi|27353023|dbj|BAC50024.1| blr4759 [Bradyrhizobium japonicum USDA 110]
          Length = 109

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 66/111 (59%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  VT+++ A  RI EI+         +RIS++ GGC+G +Y  D +  +  D D +IE
Sbjct: 1   MTTAVTISDRAARRIGEILKGEGS-GAMLRISVEGGGCSGFQYKFD-IDRDRTDDDLVIE 58

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +D   V +DSAS  ++ G+++DF  + + + F  +NPN  ++CGCG S  I
Sbjct: 59  QDNAVVLVDSASQPFLAGSQVDFVDDLIGASFRVNNPNATASCGCGTSFSI 109


>gi|240850750|ref|YP_002972150.1| iron-sulfur cluster assembly accessory protein [Bartonella grahamii
           as4aup]
 gi|240267873|gb|ACS51461.1| iron-sulfur cluster assembly accessory protein [Bartonella grahamii
           as4aup]
          Length = 107

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 46/111 (41%), Positives = 64/111 (57%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  V +++ A  +I +I+     K   +RIS++ GGC+G  Y  DLV++   D   L  
Sbjct: 1   MN--VKISDVAAKKIAQILLREPDK-IALRISVEGGGCSGFSYKYDLVSEMCKDDLVLK- 56

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KDG  V+ID  SL +M G EIDF  + +   F  HNPN VS+CGCG S  I
Sbjct: 57  KDGAVVFIDLLSLPFMEGAEIDFVDDLMGQSFQIHNPNAVSSCGCGVSFSI 107


>gi|293608206|ref|ZP_06690509.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828779|gb|EFF87141.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325122063|gb|ADY81586.1| hypothetical protein BDGL_001000 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 106

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V           +  G
Sbjct: 1   MIHLTENAATHISNYLKN-RGKGEGIRVGVKTSGCSGLAYVLEFVDSVDEHDQVFEQF-G 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLEGLEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|260550149|ref|ZP_05824363.1| iron-sulfur cluster assembly protein IscA [Acinetobacter sp.
           RUH2624]
 gi|260406904|gb|EEX00383.1| iron-sulfur cluster assembly protein IscA [Acinetobacter sp.
           RUH2624]
          Length = 106

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V D         +  G
Sbjct: 1   MIHLTENAATHISNYLKN-RGKGEGIRVGVKTSGCSGLAYVLEFVDDIDEHDQVFEQF-G 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLEGLEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|255066736|ref|ZP_05318591.1| iron-sulfur cluster assembly accessory protein [Neisseria sicca
           ATCC 29256]
 gi|255049064|gb|EET44528.1| iron-sulfur cluster assembly accessory protein [Neisseria sicca
           ATCC 29256]
          Length = 112

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  TE+   ++ +++         +R+ +  GGC+G +Y      +   D D  
Sbjct: 1   MSDESPIIFTESCCTKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFD-EIKNDDDFE 59

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           I+K+G+   +D  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 60  IQKNGLTFLVDPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV 112


>gi|269977233|ref|ZP_06184206.1| iron-sulfur cluster assembly accessory protein [Mobiluncus mulieris
           28-1]
 gi|306818831|ref|ZP_07452553.1| HesB family protein [Mobiluncus mulieris ATCC 35239]
 gi|307700754|ref|ZP_07637779.1| iron-sulfur cluster assembly accessory protein [Mobiluncus mulieris
           FB024-16]
 gi|269934536|gb|EEZ91097.1| iron-sulfur cluster assembly accessory protein [Mobiluncus mulieris
           28-1]
 gi|304648517|gb|EFM45820.1| HesB family protein [Mobiluncus mulieris ATCC 35239]
 gi|307613749|gb|EFN92993.1| iron-sulfur cluster assembly accessory protein [Mobiluncus mulieris
           FB024-16]
          Length = 136

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 57/106 (53%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +TEAAV +I+ ++         +RI +  GGC+GL Y ++   D   + D + + DGV
Sbjct: 32  VNLTEAAVAKIRALLEQEGRDDLNLRIGVAPGGCSGLIYQLEFD-DVIEEDDAVRDFDGV 90

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+ +D  S+ Y+ G  IDF+      GFV  NPN  + C CG S  
Sbjct: 91  KLVVDRMSVPYLAGASIDFQDTLAQQGFVIDNPNAANTCSCGGSFH 136


>gi|315125529|ref|YP_004067532.1| Fe-S cluster assembly/activation protein [Pseudoalteromonas sp.
           SM9913]
 gi|315014042|gb|ADT67380.1| Fe-S cluster assembly/activation protein [Pseudoalteromonas sp.
           SM9913]
          Length = 107

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+AA  R++  + N +GK  G+R+ +K  GC+GL Y+++ V +   D +    K GV
Sbjct: 3   VTLTDAAANRVQSFLAN-RGKGIGLRVGIKTTGCSGLAYVLEFVDELNDDDETFAAK-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D+ SL+Y+ GTE+D+  E L  GF F+NPNQ   CGCG+S  +
Sbjct: 61  TLIVDAKSLVYIDGTELDYTKEGLNEGFKFNNPNQADECGCGESFTV 107


>gi|226290008|gb|EEH45492.1| iron-binding protein iscA [Paracoccidioides brasiliensis Pb18]
          Length = 260

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV  +++++   Q   + IR+ +K  GC+GL Y ++ V       D+++E+DGV
Sbjct: 157 LTITPEAVSHLRKLI--DQPDPKLIRVGVKNRGCSGLSYNLEYVDKP-APFDEVVEQDGV 213

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +DS +L  ++G+E+D++ +KL S FVF NPN    CGCG+S  +
Sbjct: 214 KILVDSKALFSIIGSEMDWQEDKLASRFVFKNPNIKDQCGCGESFMV 260


>gi|295669196|ref|XP_002795146.1| iron-binding protein iscA [Paracoccidioides brasiliensis Pb01]
 gi|226285080|gb|EEH40646.1| iron-binding protein iscA [Paracoccidioides brasiliensis Pb01]
          Length = 260

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV  +++++   Q   + IR+ +K  GC+GL Y ++ V       D+++E+DGV
Sbjct: 157 LTITPEAVSHLRKLI--DQPDPKLIRVGVKNRGCSGLSYNLEYVDKP-APFDEVVEQDGV 213

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +DS +L  ++G+E+D++ +KL S FVF NPN    CGCG+S  +
Sbjct: 214 KILVDSKALFSIIGSEMDWQEDKLASRFVFKNPNIKDQCGCGESFMV 260


>gi|294670859|ref|ZP_06735715.1| hypothetical protein NEIELOOT_02563 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307346|gb|EFE48589.1| hypothetical protein NEIELOOT_02563 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 119

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 55/113 (48%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  T++   ++ +++         +R+ +  GGC+G +Y      +   D D  
Sbjct: 8   MSDESPIIFTDSCCTKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFD-EIKNDDDFE 66

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           I K+G+   +D  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 67  ILKNGLTFLVDPMSYQYLVGAEIDYTESLHGSQFVIRNPNAETTCGCGSSFSV 119


>gi|157134795|ref|XP_001656446.1| hypothetical protein AaeL_AAEL000418 [Aedes aegypti]
 gi|108884323|gb|EAT48548.1| conserved hypothetical protein [Aedes aegypti]
          Length = 129

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T +AV R+K+++     +  G+++ +++ GC GL Y +D  T      ++++ +DGV
Sbjct: 25  LSLTPSAVARVKQLLDGK-SEYIGLKVGVRQRGCNGLSYTLDYATTKDKLDEEVV-QDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  + L +LGTE+D+   KL + FVF+NPN    CGCG+S  I
Sbjct: 83  KVLIDKKAQLSLLGTEMDYVETKLSAEFVFNNPNIKGTCGCGESFSI 129


>gi|39935921|ref|NP_948197.1| HesB/YadR/YfhF [Rhodopseudomonas palustris CGA009]
 gi|39649775|emb|CAE28297.1| Protein of unknown function, HesB/YadR/YfhF [Rhodopseudomonas
           palustris CGA009]
          Length = 110

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E A  RI EI+     +   +RIS++ GGC+G +Y  D V     D D +I K+G 
Sbjct: 6   VTISERAARRIGEILKGEG-QGAMLRISVEGGGCSGFQYKFD-VDRTKTDDDLVIAKEGA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +DSAS+ ++ G+E+DF  + + + F  +NPN  ++CGCG S  I
Sbjct: 64  VVLVDSASVPFLAGSEVDFVDDLIGASFRVNNPNATASCGCGTSFSI 110


>gi|220935225|ref|YP_002514124.1| iron-sulfur cluster assembly protein [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219996535|gb|ACL73137.1| iron-sulfur cluster assembly protein [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 107

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE+A  R+K  +   +GK  G+R+ ++  GC+G+ Y+++   +         +K GV
Sbjct: 3   ITLTESAADRVKTFLAK-RGKGLGLRLGVRTTGCSGMAYVIEFADELDEGDTVFEDK-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ++  SL+Y+ GTE+DF  E L  GF F+NPN+   CGCG+S  +
Sbjct: 61  KVIVNPKSLVYLEGTELDFAREGLNEGFKFNNPNEKDRCGCGESFNV 107


>gi|198282960|ref|YP_002219281.1| iron-sulfur cluster assembly protein IscA [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218665449|ref|YP_002425163.1| iron-sulfur cluster assembly protein IscA [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198247481|gb|ACH83074.1| iron-sulfur cluster assembly protein IscA [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218517662|gb|ACK78248.1| iron-sulfur cluster assembly protein IscA [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 107

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 65/106 (61%), Gaps = 2/106 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++E+A  ++++ +   +GK  GIRI +K  GC+GL Y+++ V     +       D V
Sbjct: 3   LTLSESAARQVRKSIAK-RGKGLGIRIGVKTSGCSGLSYVMEFVDVPNPEDLVFPH-DDV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            +++D  SL+Y+ GTE+DF  E L  GF F+NPN   ACGCG+S  
Sbjct: 61  NLFVDPKSLIYLDGTELDFTREGLNEGFRFNNPNVKDACGCGESFT 106


>gi|156366241|ref|XP_001627048.1| predicted protein [Nematostella vectensis]
 gi|156213945|gb|EDO34948.1| predicted protein [Nematostella vectensis]
          Length = 131

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV ++K ++ +    A  +++ +++ GC GL Y ++  T+     D+L+ +DGV
Sbjct: 27  LTLTPSAVNKVKTLLSSQ-PDAIALKVGVRQRGCNGLSYTLEFATEKGK-FDELVTQDGV 84

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS + L +LGTE+DF  +KL S FVF+NPN    CGCG+S  I
Sbjct: 85  KVLIDSKAQLSLLGTEMDFVEDKLSSEFVFNNPNIKGTCGCGESFNI 131


>gi|119898305|ref|YP_933518.1| putative regulatory protein [Azoarcus sp. BH72]
 gi|119670718|emb|CAL94631.1| putative regulatory Protein [Azoarcus sp. BH72]
          Length = 107

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++++A   +   +   +GK  GIR+ ++  GC+G+ Y ++ V +   +        GV
Sbjct: 3   VTLSQSAAKHVANFIAK-RGKGLGIRLGVRTSGCSGMAYKLEFVDEKQDEDLVFE-SHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V +D  SL Y+ GTE+DF  E L  GF F+NPN   ACGCG+S  +
Sbjct: 61  QVIVDPKSLPYIDGTELDFVREGLNEGFKFNNPNVKDACGCGESFNV 107


>gi|92114966|ref|YP_574894.1| HesB/YadR/YfhF [Chromohalobacter salexigens DSM 3043]
 gi|91798056|gb|ABE60195.1| HesB/YadR/YfhF [Chromohalobacter salexigens DSM 3043]
          Length = 108

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 66/111 (59%), Gaps = 3/111 (2%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M++ + ++ AA  +I+ ++   +G   G+R+++K  GC+G  Y++D+  D   D D   E
Sbjct: 1   MAN-IRISPAAADQIQHVLA-ERGNGLGLRVAVKPSGCSGYSYVLDIA-DEIGDNDVPFE 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GVKV +D  +L  + GTE+D+ +E L   F F+NPN    CGCG+S  +
Sbjct: 58  DHGVKVLVDKEALTILDGTEVDYVSEGLNRYFRFNNPNATDQCGCGESFNV 108


>gi|269962419|ref|ZP_06176769.1| hesB family protein [Vibrio harveyi 1DA3]
 gi|269832915|gb|EEZ87024.1| hesB family protein [Vibrio harveyi 1DA3]
          Length = 107

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMTE+A  R+K  + +++GK  G+R+ +K  GC+G+ Y+++ V D   + +     + V
Sbjct: 3   ITMTESAASRVKAFL-DNRGKGIGLRLGVKTTGCSGMAYVLEFVDDLNEEDEVFELSE-V 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL+Y+ GTE+D+  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIIDKKSLVYLDGTELDYVKEGLNEGFEFNNPNAKSECGCGESFNV 107


>gi|262376141|ref|ZP_06069371.1| iron-sulfur cluster assembly protein IscA [Acinetobacter lwoffii
           SH145]
 gi|262308742|gb|EEY89875.1| iron-sulfur cluster assembly protein IscA [Acinetobacter lwoffii
           SH145]
          Length = 106

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V +         +  G
Sbjct: 1   MIHLTENAATHISNYLKN-RGKGEGIRVGVKTSGCSGLAYVLEFVDEVDTHDQAFEQF-G 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLEGMEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|261378024|ref|ZP_05982597.1| iron-sulfur cluster assembly accessory protein [Neisseria cinerea
           ATCC 14685]
 gi|261401029|ref|ZP_05987154.1| iron-sulfur cluster assembly accessory protein [Neisseria lactamica
           ATCC 23970]
 gi|313668957|ref|YP_004049241.1| iron-sulphur cluster biosynthesis protein [Neisseria lactamica
           ST-640]
 gi|269145900|gb|EEZ72318.1| iron-sulfur cluster assembly accessory protein [Neisseria cinerea
           ATCC 14685]
 gi|269209034|gb|EEZ75489.1| iron-sulfur cluster assembly accessory protein [Neisseria lactamica
           ATCC 23970]
 gi|309379596|emb|CBX21767.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313006419|emb|CBN87882.1| putative iron-sulphur cluster biosynthesis protein [Neisseria
           lactamica 020-06]
          Length = 112

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  T++   ++ +++         +R+ +  GGC+G +Y      +   D D  
Sbjct: 1   MSDESPIIFTDSCCTKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFD-EIKNDDDFE 59

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           IEK+G+   +D  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 60  IEKNGLVFLVDPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV 112


>gi|19075612|ref|NP_588112.1| iron-sulfur protein Isa1 [Schizosaccharomyces pombe 972h-]
 gi|2495216|sp|P78859|ISA1_SCHPO RecName: Full=Iron-sulfur assembly protein 1
 gi|1749626|dbj|BAA13870.1| unnamed protein product [Schizosaccharomyces pombe]
 gi|4539275|emb|CAB39899.1| iron-sulfur protein Isa1 [Schizosaccharomyces pombe]
          Length = 190

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 67/109 (61%), Gaps = 1/109 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
            +++ +T  AV  +K++  ++  K + +RI +K+ GCAG  Y ++ +       D+++++
Sbjct: 80  KNVIKLTPLAVEHLKKMQSSASMKGKMLRIGVKQKGCAGQAYSLEYIEKPDK-FDEIVKQ 138

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           DG+ + +   +LL ++G+ +D++ + L S F+F NPN  S CGCG+S  
Sbjct: 139 DGISIIVARRALLQIIGSVMDYRDDDLQSRFIFSNPNVKSTCGCGESFS 187


>gi|170717818|ref|YP_001783509.1| iron-sulfur cluster assembly protein IscA [Haemophilus somnus 2336]
 gi|168825947|gb|ACA31318.1| iron-sulfur cluster assembly protein IscA [Haemophilus somnus 2336]
          Length = 107

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 45/111 (40%), Positives = 68/111 (61%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  +T+T+AA  R++  +   +GK  G+R+ +K  GC+GL Y+++ V     D +    
Sbjct: 1   MS--ITLTQAAANRVRTFLEK-RGKGIGLRLGIKTSGCSGLAYVLEFVDVLNEDDEVFE- 56

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +DGVKV +D  SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 57  QDGVKVIVDHKSLVYLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFNV 107


>gi|113460429|ref|YP_718491.1| HesB-family protein [Haemophilus somnus 129PT]
 gi|112822472|gb|ABI24561.1| HesB-family protein [Haemophilus somnus 129PT]
          Length = 107

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA  R++  +   +GK  G+R+ +K  GC+GL Y+++ V     D +    +DGV
Sbjct: 3   ITLTQAAANRVRTFLEK-RGKGIGLRLGIKTSGCSGLAYVLEFVDILNEDDEVFE-QDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVIVDRKSLVYLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFNV 107


>gi|300114133|ref|YP_003760708.1| iron-sulfur cluster assembly accessory protein [Nitrosococcus
           watsonii C-113]
 gi|299540070|gb|ADJ28387.1| iron-sulfur cluster assembly accessory protein [Nitrosococcus
           watsonii C-113]
          Length = 107

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 63/106 (59%), Gaps = 2/106 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +A+ +IK+++   +   +G+R+ +KK GC+G  Y++D         D +   DGV
Sbjct: 3   ITVTASALKQIKKVLSQQEN-VEGLRVGVKKSGCSGYAYVLDFA-KQVKSEDTVFNHDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+ +D  SL ++ GTE+D++ E L   F F NPN    CGCG+S  
Sbjct: 61  KILVDKQSLNFIDGTELDYRREGLNESFKFQNPNVTGTCGCGESFS 106


>gi|227822096|ref|YP_002826067.1| putative HesB nitrogen fixation family protein [Sinorhizobium
           fredii NGR234]
 gi|227341096|gb|ACP25314.1| putative HesB nitrogen fixation family protein [Sinorhizobium
           fredii NGR234]
          Length = 130

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 61/113 (53%), Positives = 86/113 (76%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++++T+AA  R++ IV N++G A+GIR+S+KKGGCAG+EY VDLVTD     D +  + G
Sbjct: 5   VMSLTDAAAGRVRSIVENARGDAKGIRLSIKKGGCAGMEYAVDLVTDANAKDDLIEHQ-G 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            +VW+   ++LY+LGT++DF+   L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  ARVWVAPEAVLYLLGTQMDFEVTALRSGFTFKNPNQTSACGCGESVELKPADL 116


>gi|209885396|ref|YP_002289253.1| HesB/YadR/YfhF [Oligotropha carboxidovorans OM5]
 gi|209873592|gb|ACI93388.1| HesB/YadR/YfhF [Oligotropha carboxidovorans OM5]
          Length = 109

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  VT++E A  RI EI+ +   +   +RIS++ GGC+G +Y  D+      D   ++ 
Sbjct: 1   MTANVTISERAARRIGEILKSEG-EGAKLRISVEGGGCSGFQYKFDIDKTQAEDDLVIVR 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + V V +DS+S  ++  +E+DF  + + + F   NPN  ++CGCG S  I
Sbjct: 60  DNAV-VLVDSSSAPFLADSELDFVDDLIGASFRVVNPNATASCGCGTSFSI 109


>gi|121997670|ref|YP_001002457.1| iron-sulfur cluster insertion protein ErpA [Halorhodospira
           halophila SL1]
 gi|160380677|sp|A1WVE3|ERPA_HALHL RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|121589075|gb|ABM61655.1| iron-sulfur cluster assembly accessory protein [Halorhodospira
           halophila SL1]
          Length = 123

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 61/110 (55%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++  T+AA  +++E++   +G    +R+ +  GGC+G +Y      +   +GD +IEK
Sbjct: 15  DQLLIFTDAAADKVRELLDGEEGGDVKLRVFITGGGCSGFQYGFTFD-ETVEEGDTIIEK 73

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GVK+ +D  S +Y+ G E+DF +      F+  NPN  + CGCG S  I
Sbjct: 74  RGVKIVVDPVSGIYLQGAEVDFSSGLEGEQFIIRNPNATTTCGCGSSFAI 123


>gi|255714939|ref|XP_002553751.1| KLTH0E06182p [Lachancea thermotolerans]
 gi|238935133|emb|CAR23314.1| KLTH0E06182p [Lachancea thermotolerans]
          Length = 267

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 71/110 (64%), Gaps = 3/110 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++++T  AV  +K ++  +Q + + IR+ +K  GC+GL Y ++ +T      D+++E+
Sbjct: 161 KALISLTPNAVDHLKLLL--NQPEPKLIRVGVKNRGCSGLTYDLEYITAPGK-FDEVVEQ 217

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGV+V +DS +L  ++G+E+D+  ++L S FVF NPN    CGCG+S  +
Sbjct: 218 DGVRVILDSKALFSIVGSEMDWIDDRLSSRFVFKNPNSKGTCGCGESFMV 267


>gi|227875522|ref|ZP_03993662.1| HesB family protein [Mobiluncus mulieris ATCC 35243]
 gi|227843858|gb|EEJ54027.1| HesB family protein [Mobiluncus mulieris ATCC 35243]
          Length = 139

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 57/106 (53%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +TEAAV +I+ ++         +RI +  GGC+GL Y ++   D   + D + + DGV
Sbjct: 35  VNLTEAAVAKIRALLEQEGRDDLNLRIGVAPGGCSGLIYQLEFD-DVIEEDDAVRDFDGV 93

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K+ +D  S+ Y+ G  IDF+      GFV  NPN  + C CG S  
Sbjct: 94  KLVVDRMSVPYLAGASIDFQDTLAQQGFVIDNPNAANTCSCGGSFH 139


>gi|310643818|ref|YP_003948576.1| iron-sulfur cluster assembly accessory protein [Paenibacillus
           polymyxa SC2]
 gi|309248768|gb|ADO58335.1| Iron-sulfur cluster assembly accessory protein [Paenibacillus
           polymyxa SC2]
          Length = 119

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 57/106 (53%), Gaps = 1/106 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T++A  R+KE++   +     +R+ +  GGC G  Y +    +       +  +D 
Sbjct: 1   MINITDSAAERLKEMLEQQETPNMFLRLGVTPGGCTGFSYAMGFDDNETDQDIYMNVQD- 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           +KV ++  S+ Y+ G EIDF+   +  GF  HNPN V+ CGCG S 
Sbjct: 60  MKVVVEKDSIRYLDGLEIDFEESGMSGGFTIHNPNAVATCGCGSSF 105


>gi|167042751|gb|ABZ07471.1| putative HesB-like domain protein [uncultured marine crenarchaeote
           HF4000_ANIW133O4]
 gi|167044858|gb|ABZ09525.1| putative HesB-like domain protein [uncultured marine crenarchaeote
           HF4000_APKG8D22]
          Length = 116

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 59/108 (54%), Gaps = 1/108 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++T+T  A  +IKE +   +   Q +RI ++ GGC+GL Y +        + D +IE++
Sbjct: 8   KLITITSKAAEKIKEFMAEEKDSPQFLRIYVQGGGCSGLSYGMGFEKAA-EEDDLIIEEN 66

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           GVKV +DS S  ++    +D+    + SGF  +NPN   +C CG S  
Sbjct: 67  GVKVIVDSMSQDHLKDANVDYIESLMGSGFKINNPNVTKSCSCGSSFS 114


>gi|332289847|ref|YP_004420699.1| iron-sulfur cluster assembly protein [Gallibacterium anatis UMN179]
 gi|330432743|gb|AEC17802.1| iron-sulfur cluster assembly protein [Gallibacterium anatis UMN179]
          Length = 107

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE+A  R+++ + N +GK  G+R+ +K  GC+GL Y+++ V     D       +GV
Sbjct: 3   ISLTESAAQRVRDFLAN-RGKGIGLRLGIKTSGCSGLAYVLEFVDTLNEDDQVFE-DNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D+ SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KIIVDNKSLVYLDGTQLDFVKEGLNEGFKFTNPNVKEQCGCGESFHV 107


>gi|301632488|ref|XP_002945317.1| PREDICTED: iron-binding protein iscA-like [Xenopus (Silurana)
           tropicalis]
          Length = 107

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T+AA   +   +   +GK  G+R+ +K  GC+GL Y ++ V D     D + E  G+
Sbjct: 3   ISLTDAAARHVSRYLA-RRGKGIGVRLGVKTTGCSGLAYKLEYV-DEQSPEDVVFENHGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF FHNPN+   CGCG+S  I
Sbjct: 61  KVLVDPKSLAYIDGTELDFVREGLNEGFKFHNPNERDRCGCGESFRI 107


>gi|255320692|ref|ZP_05361869.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter
           radioresistens SK82]
 gi|262380677|ref|ZP_06073830.1| iron-sulfur cluster assembly protein IscA [Acinetobacter
           radioresistens SH164]
 gi|255302308|gb|EET81548.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter
           radioresistens SK82]
 gi|262297625|gb|EEY85541.1| iron-sulfur cluster assembly protein IscA [Acinetobacter
           radioresistens SH164]
          Length = 111

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 28/112 (25%), Positives = 55/112 (49%), Gaps = 2/112 (1%)

Query: 1   MS-DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M+   + +++ A  +++++  +   +   +R+ +  GGC+G  Y  +       D  +  
Sbjct: 1   MNAPALVLSDNAANKVRQLRESEGNQDLMLRVYVTGGGCSGFSYGFNFAESMNEDDAEFT 60

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             D V + +DS S  Y++G+ +D+      S F+  NPN  + CGCG S  I
Sbjct: 61  NGD-VTMLVDSLSYQYLVGSVVDYIQGLEGSRFIVENPNATTTCGCGSSFSI 111


>gi|86609100|ref|YP_477862.1| iron-sulfur cluster assembly accessory protein [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86557642|gb|ABD02599.1| iron-sulfur cluster assembly accessory protein [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 118

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 59/109 (54%), Gaps = 3/109 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQ--GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           ++T+T++A+  +K +    + +     +R+ +K  GC+GL Y+++         D   + 
Sbjct: 1   MITLTDSAIQELKRLRSKYEKEGSQPILRLGVKPSGCSGLSYVMNFE-SQANPDDHTFDF 59

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             ++V +D  S+  + GT +DF  + L  GF F NPN +++CGCG S  
Sbjct: 60  GDIQVAVDPLSMTLISGTTVDFSEDLLGGGFRFRNPNAIASCGCGTSFA 108


>gi|257093607|ref|YP_003167248.1| iron-sulfur cluster assembly protein IscA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257046131|gb|ACV35319.1| iron-sulfur cluster assembly protein IscA [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 107

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E A   +   +   +GK  G+R+ ++  GC+G+ Y ++    +  D  +     GV
Sbjct: 3   VTLSERAASHVANYMVK-RGKGIGLRLGVRTSGCSGMAYKLEFADVSHPDDIEFE-SHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V +D+ SL Y+ GTE+D+  E L  GF F+NPN   ACGCG+S  +
Sbjct: 61  RVLVDAKSLPYLDGTELDYAREGLNEGFRFNNPNVKDACGCGESFNV 107


>gi|167856665|ref|ZP_02479356.1| iron-binding protein IscA [Haemophilus parasuis 29755]
 gi|167852210|gb|EDS23533.1| iron-binding protein IscA [Haemophilus parasuis 29755]
          Length = 107

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/111 (39%), Positives = 69/111 (62%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  +T+TE A  R++  + N +GK  G+R+ +K  GC+GL Y+++ V     D     +
Sbjct: 1   MS--ITLTETAADRVRTFLEN-RGKGIGLRLGVKTSGCSGLAYVLEFVDVLNEDDHVFEQ 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + GVK+ +D  SL+Y+ GTE+DF  E L  GF ++NPN  + CGCG+S  +
Sbjct: 58  Q-GVKIIVDEKSLVYLSGTELDFVKEGLNEGFKYNNPNVKNECGCGESFNV 107


>gi|297172409|gb|ADI23383.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF0770_28K04]
 gi|297172916|gb|ADI23877.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF4000_48J03]
          Length = 116

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V  T+AA  ++  ++   +     +R+ +  GGCAG +Y      +      +++++ GV
Sbjct: 12  VIFTDAAAMKVGSLLTEEENPDLNLRVYVTGGGCAGFQYGFSFDENKDEGDTEVVKR-GV 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           ++ +D  S+ Y++G EIDF+ +   + FV  NPN  + C CG S  
Sbjct: 71  RLIVDPMSIQYLMGAEIDFQEDLQGARFVIKNPNATTTCSCGSSFS 116


>gi|149236257|ref|XP_001524006.1| hypothetical protein LELG_04819 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146452382|gb|EDK46638.1| hypothetical protein LELG_04819 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 310

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 70/110 (63%), Gaps = 3/110 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T+T +A+  ++ ++  +Q   + IRI ++  GC+GL Y +D V       D+LIE+
Sbjct: 204 KQLITLTPSAISHLEGLM--NQPTPKLIRIGVRNRGCSGLTYDLDYVEKPGK-FDELIEQ 260

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGVKV IDS +L  ++G+E+D+  +KL S F+F NPN    CGCG+S  +
Sbjct: 261 DGVKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGESFMV 310


>gi|255020954|ref|ZP_05293010.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Acidithiobacillus caldus ATCC 51756]
 gi|254969745|gb|EET27251.1| Iron binding protein IscA for iron-sulfur cluster assembly
           [Acidithiobacillus caldus ATCC 51756]
          Length = 107

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 64/106 (60%), Gaps = 2/106 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +TE A  +++  +   +GK QGIRI +K  GC+GL Y+++ V +   +       D V
Sbjct: 3   IVLTERAAEQVRRSIAK-RGKGQGIRIGVKTSGCSGLSYVMEFVDEPRPEDRVFSHAD-V 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           ++++D  SL+Y+ G E+DF  E L  GF F+NPN  + CGCG+S  
Sbjct: 61  RLFVDPKSLIYLDGMEVDFTREGLNQGFRFNNPNVKNTCGCGESFT 106


>gi|160899431|ref|YP_001565013.1| iron-sulfur cluster assembly protein IscA [Delftia acidovorans
           SPH-1]
 gi|160365015|gb|ABX36628.1| iron-sulfur cluster assembly protein IscA [Delftia acidovorans
           SPH-1]
 gi|222875129|gb|EEF12260.1| predicted protein [Populus trichocarpa]
          Length = 107

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T++A   +   + + +GK  G+R+ +K  GC+GL Y ++ V D  +  D + E  G+
Sbjct: 3   ISLTDSAARHVSRYL-SRRGKGIGVRLGVKTTGCSGLAYKLEYV-DEQLPEDVIFEDHGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF FHNPN+   CGCG+S  I
Sbjct: 61  KVLVDPKSLAYIDGTELDFVREGLNEGFKFHNPNERDRCGCGESFRI 107


>gi|54307736|ref|YP_128756.1| iron-sulfur cluster insertion protein ErpA [Photobacterium
           profundum SS9]
 gi|81400174|sp|Q6LUS1|ERPA_PHOPR RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|46912159|emb|CAG18954.1| putative HesB family protein [Photobacterium profundum SS9]
          Length = 113

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 1   MSD---IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MSD    ++ ++ A  ++K ++   +     +R+ +  GGC+G +Y      +   DGD 
Sbjct: 1   MSDANVPLSFSDVAANKVKTLIAEEENPELKLRVYITGGGCSGFQYGFTFD-EKVNDGDM 59

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            IE  GV + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  +
Sbjct: 60  TIENSGVTLVVDPMSLQYLVGGIVDYTEGLEGSRFFVNNPNATTTCGCGASFSV 113


>gi|269836798|ref|YP_003319026.1| iron-sulfur cluster assembly accessory protein [Sphaerobacter
           thermophilus DSM 20745]
 gi|269786061|gb|ACZ38204.1| iron-sulfur cluster assembly accessory protein [Sphaerobacter
           thermophilus DSM 20745]
          Length = 121

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 64/107 (59%), Gaps = 1/107 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T  AV R+KE + +   +   +R+ +  GGC+GL+Y +  V +   + D +IE+DG
Sbjct: 1   MITITPEAVERLKEYLVDEGFEDAMLRVFVAPGGCSGLQYGMS-VEEVAEEDDQIIEQDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +K+ +D  S +Y+ G EID+    +  GF   NPN V+ C CG S +
Sbjct: 60  IKLLVDQFSAMYLEGAEIDYVNSLMGGGFTVRNPNAVATCACGHSFD 106


>gi|40062625|gb|AAR37554.1| iron-sulfur cluster assembly accessory protein [uncultured marine
           bacterium 311]
          Length = 115

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 55/110 (50%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              + +TE AV +I  +  + + K   +R+ +  GGC+G +Y      +   +   +   
Sbjct: 7   PSTLNLTEGAVNKIHSLSDSDKSKEINLRVYVTGGGCSGFQYGFSFDQEVDEEDTCVSR- 65

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DG  + ID  SL Y+ G+ ID+  +   S F+  NPN  + CGCG+S  I
Sbjct: 66  DGANLVIDPLSLQYLAGSTIDYAEDLSGSKFIVKNPNATTTCGCGESFSI 115


>gi|195045788|ref|XP_001992036.1| GH24545 [Drosophila grimshawi]
 gi|193892877|gb|EDV91743.1| GH24545 [Drosophila grimshawi]
          Length = 130

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 67/106 (63%), Gaps = 2/106 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV RIK ++ +      G+++ +++ GC GL Y ++  +      ++++ +DGV
Sbjct: 26  LTLTPAAVQRIKSLLHDK-PDVIGLKVGVRQRGCNGLSYTLNYASTKDKLDEEVL-QDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           KV+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  
Sbjct: 84  KVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFS 129


>gi|184157977|ref|YP_001846316.1| hypothetical protein ACICU_01657 [Acinetobacter baumannii ACICU]
 gi|332874436|ref|ZP_08442339.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           6014059]
 gi|183209571|gb|ACC56969.1| uncharacterized conserved protein [Acinetobacter baumannii ACICU]
 gi|322508295|gb|ADX03749.1| iscA [Acinetobacter baumannii 1656-2]
 gi|323517921|gb|ADX92302.1| hypothetical protein ABTW07_1873 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332737280|gb|EGJ68204.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           6014059]
          Length = 106

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V D         +  G
Sbjct: 1   MIHLTENAASHISNYLKN-RGKGEGIRVGVKTSGCSGLAYVLEFVDDIDEHDQIFEQF-G 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLDGLEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|163868518|ref|YP_001609727.1| hypothetical protein Btr_1370 [Bartonella tribocorum CIP 105476]
 gi|161018174|emb|CAK01732.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 107

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 65/111 (58%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  V +++AA  +I +I+     K   +RIS++ GGC+G  Y  +LV++   D   L  
Sbjct: 1   MN--VKISDAAANQIIQILLREPDK-IALRISVEGGGCSGFSYKYELVSEMCEDDLVLK- 56

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KDG  V IDS SL +M G EIDF  + +   F  HNPN VS+CGCG S  I
Sbjct: 57  KDGATVLIDSLSLPFMEGAEIDFVDDLMEQSFQIHNPNAVSSCGCGVSFSI 107


>gi|153006429|ref|YP_001380754.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           sp. Fw109-5]
 gi|152030002|gb|ABS27770.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter
           sp. Fw109-5]
          Length = 127

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T  AV  +K+ +        GIR+ +  GGCAG +Y +D   D          ++GV
Sbjct: 22  VRLTAKAVEMVKDAMEREGLSEYGIRVGVMGGGCAGFQYSMDFEKDPREGDVSFE-QEGV 80

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           K++ID  S +Y+ G  ID+      +GF F+NPN  + CGCG S  
Sbjct: 81  KLFIDPMSSMYLQGVTIDYVVGLQGAGFKFNNPNARTTCGCGSSFS 126


>gi|299139219|ref|ZP_07032395.1| iron-sulfur cluster assembly accessory protein [Acidobacterium sp.
           MP5ACTX8]
 gi|298598899|gb|EFI55061.1| iron-sulfur cluster assembly accessory protein [Acidobacterium sp.
           MP5ACTX8]
          Length = 126

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T +A+ ++KEI+        G+RI +  GGC+G +Y +     +    D ++  D +
Sbjct: 21  VVLTPSAIVKVKEIMATQDPIPAGLRIGVVGGGCSGFQYSMSFENAS-GMMDKVVRFDDL 79

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV+ID+ S +Y+ G  +D+      +GF F NP   S CGCG S  +
Sbjct: 80  KVFIDATSAMYLNGCTVDYVETLEAAGFKFENPQVKSTCGCGSSFSV 126


>gi|169633486|ref|YP_001707222.1| iron-binding protein, believed to be involved in Fe-S protein
           formation or repair [Acinetobacter baumannii SDF]
 gi|169796096|ref|YP_001713889.1| iron-binding protein, believed to be involved in Fe-S protein
           formation or repair [Acinetobacter baumannii AYE]
 gi|213157171|ref|YP_002319216.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           AB0057]
 gi|215483551|ref|YP_002325770.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           AB307-0294]
 gi|239501902|ref|ZP_04661212.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           AB900]
 gi|260555145|ref|ZP_05827366.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           ATCC 19606]
 gi|301345051|ref|ZP_07225792.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           AB056]
 gi|301510362|ref|ZP_07235599.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           AB058]
 gi|301595501|ref|ZP_07240509.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           AB059]
 gi|332851747|ref|ZP_08433672.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           6013150]
 gi|332865878|ref|ZP_08436658.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           6013113]
 gi|169149023|emb|CAM86900.1| iron-binding protein , believed to be involved in Fe-S protein
           formation or repair [Acinetobacter baumannii AYE]
 gi|169152278|emb|CAP01188.1| iron-binding protein , believed to be involved in Fe-S protein
           formation or repair [Acinetobacter baumannii]
 gi|193077273|gb|ABO12057.2| hypothetical protein A1S_1630 [Acinetobacter baumannii ATCC 17978]
 gi|213056331|gb|ACJ41233.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           AB0057]
 gi|213987221|gb|ACJ57520.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           AB307-0294]
 gi|260411687|gb|EEX04984.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           ATCC 19606]
 gi|332729754|gb|EGJ61089.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           6013150]
 gi|332734928|gb|EGJ66014.1| iron-sulfur cluster assembly protein IscA [Acinetobacter baumannii
           6013113]
          Length = 106

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 41/108 (37%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V D         +  G
Sbjct: 1   MIHLTENAATHISNYLKN-RGKGEGIRVGVKTSGCSGLAYVLEFVDDIDEHDQIFEQF-G 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLDGLEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|110634166|ref|YP_674374.1| iron-sulfur cluster assembly accessory protein [Mesorhizobium sp.
           BNC1]
 gi|110285150|gb|ABG63209.1| iron-sulfur cluster assembly accessory protein [Chelativorans sp.
           BNC1]
          Length = 116

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AA  RI +I+     K   +R+S++ GGC+G  Y  DLV     D D +IEKDG 
Sbjct: 12  IELTDAAARRIVKILAAEPDKT-ALRVSIEGGGCSGFSYKFDLVDSR-NDDDLVIEKDGA 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V ID  SL+YM G+ IDF  + +   F   NPN V++CGCG S  I
Sbjct: 70  TVLIDDLSLVYMGGSVIDFVDDLIGQSFQIRNPNAVASCGCGTSFSI 116


>gi|77361584|ref|YP_341159.1| Fe-S cluster assembly/activation protein [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76876495|emb|CAI87717.1| Fe-S cluster assembly and activation protein (possibly as
           alternative scaffold for Fe-S cluster assembly)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 107

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+AA  R++  + N +GK  G+R+ +K  GC+GL Y+++ V +   D +  + K GV
Sbjct: 3   VTLTDAAANRVQSFLAN-RGKGLGLRVGIKTTGCSGLAYVLEFVDELNDDDETFVAK-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D+ SL+Y+ GT++D+  E L  GF F NPNQ   CGCG+S  +
Sbjct: 61  TLIVDAKSLVYIDGTQLDYTKEGLNEGFKFTNPNQADECGCGESFTV 107


>gi|317125124|ref|YP_004099236.1| iron-sulfur cluster assembly accessory protein [Intrasporangium
           calvum DSM 43043]
 gi|315589212|gb|ADU48509.1| iron-sulfur cluster assembly accessory protein [Intrasporangium
           calvum DSM 43043]
          Length = 128

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T+ A  ++K ++         +R+ ++ GGC+GL Y +    +  +DGD + + DGV
Sbjct: 24  VILTDVAASKVKSLLEQEGRDDLRLRVGVQPGGCSGLIYQLYFD-ERTLDGDLVRDYDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +V +D  S  Y+ G  IDF       GF   NPN  S+C CG S  
Sbjct: 83  EVVVDRMSSPYLEGATIDFADTIEKQGFTIDNPNAGSSCACGDSFS 128


>gi|90424332|ref|YP_532702.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisB18]
 gi|90106346|gb|ABD88383.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisB18]
          Length = 134

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 45/115 (39%), Positives = 78/115 (67%), Gaps = 1/115 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++ +T+AA  R++E+   +  +  G+R+ +K GGCAG  Y VD   D     + + +K
Sbjct: 19  PQVMRLTDAAAARVRELTERADSEIIGLRVGIKNGGCAGQSYTVDYAHDVRPSDEVVEDK 78

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            GVK+ ++  ++L++LGTE+D+K +K+ + FVF+NPNQ+SACGCG+SV++  A +
Sbjct: 79  -GVKILVEPKAVLFLLGTEMDYKVDKMSATFVFNNPNQISACGCGESVQLSPAKI 132


>gi|300312139|ref|YP_003776231.1| hypothetical protein Hsero_2831 [Herbaspirillum seropedicae SmR1]
 gi|300074924|gb|ADJ64323.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 118

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  T++AV ++ E++         +RI +  GGC+G EY          D   +   +GV
Sbjct: 13  LIFTDSAVAKVSELISEEGNTELKLRIYVSGGGCSGFEYGFAFDDAVNEDDFCIER-NGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + +D+ S+ Y+ G EI ++     S F+  NPN  + CGCG S  +
Sbjct: 72  SLLVDAMSMQYLNGAEIGYEEGLEGSRFIIKNPNATTTCGCGSSFSV 118


>gi|254414701|ref|ZP_05028466.1| hypothetical protein MC7420_3722 [Microcoleus chthonoplastes PCC
           7420]
 gi|196178549|gb|EDX73548.1| hypothetical protein MC7420_3722 [Microcoleus chthonoplastes PCC
           7420]
          Length = 109

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 58/109 (53%), Gaps = 1/109 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+++AA+  I+ +    Q +   +R+ +K GGCA L Y ++              + G
Sbjct: 1   MITLSQAAIAEIRRLQTKRQQQQARLRLGVKPGGCADLYYTLEFDDAVRASDRVYDCQ-G 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           V V +D AS+ ++    +D+  + +  GF F+NPN +  CGCG S  +K
Sbjct: 60  VAVVVDEASIKHLTTLTLDYSEDLMGGGFRFYNPNAIETCGCGNSFRVK 108


>gi|262195414|ref|YP_003266623.1| iron-sulfur cluster assembly accessory protein [Haliangium
           ochraceum DSM 14365]
 gi|262078761|gb|ACY14730.1| iron-sulfur cluster assembly accessory protein [Haliangium
           ochraceum DSM 14365]
          Length = 123

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 61/107 (57%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +++T+ A  ++ EI       +  G+R+ +  GGCAG  Y  DL  DN  D D     +G
Sbjct: 18  LSITDTAASKVNEIREAESIEQEMGLRVRVVGGGCAGFSY--DLYFDNTTDMDRTFGVNG 75

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           V+V +D  SL+Y++GTEID+      +GF F+NPN  S CGCG S  
Sbjct: 76  VEVVVDEMSLMYLMGTEIDYVESLQGAGFKFNNPNVKSTCGCGSSFS 122


>gi|192291569|ref|YP_001992174.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris TIE-1]
 gi|192285318|gb|ACF01699.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris TIE-1]
          Length = 110

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E A  RI EI+     +   +RI ++ GGC+G +Y  D V     D D +I K+G 
Sbjct: 6   VTISERAARRIGEILKGEG-QGAMLRIRVEGGGCSGFQYKFD-VDRTKTDDDLVIAKEGA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +DSAS+ ++ G+E+DF  + + + F  +NPN  ++CGCG S  I
Sbjct: 64  VVLVDSASVPFLAGSEVDFVDDLIGASFRVNNPNATASCGCGTSFSI 110


>gi|33592863|ref|NP_880507.1| [Fe-S] cluster formation/repair protein [Bordetella pertussis
           Tohama I]
 gi|33596645|ref|NP_884288.1| [Fe-S] cluster formation/repair protein [Bordetella parapertussis
           12822]
 gi|33601261|ref|NP_888821.1| [Fe-S] cluster formation/repair protein [Bordetella bronchiseptica
           RB50]
 gi|33572511|emb|CAE42087.1| [Fe-S] cluster formation/repair protein [Bordetella pertussis
           Tohama I]
 gi|33573346|emb|CAE37330.1| [Fe-S] cluster formation/repair protein [Bordetella parapertussis]
 gi|33575696|emb|CAE32774.1| [Fe-S] cluster formation/repair protein [Bordetella bronchiseptica
           RB50]
 gi|332382276|gb|AEE67123.1| [Fe-S] cluster formation/repair protein [Bordetella pertussis CS]
          Length = 107

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T++A   +   +   +GK  G+R+ ++  GC+G+ Y ++ V +   D        GV
Sbjct: 3   VTLTQSAANHVGRYL-QKRGKGIGLRLGVRTTGCSGMAYKLEYVDEQAADDVVFDSF-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV+ID  SL Y+ GTE+D+  E L  GF F NPN+ + CGCG+S  +
Sbjct: 61  KVFIDPKSLAYLDGTELDYAREGLNEGFRFSNPNEKATCGCGESFTV 107


>gi|268316900|ref|YP_003290619.1| iron-sulfur cluster assembly accessory protein [Rhodothermus
           marinus DSM 4252]
 gi|262334434|gb|ACY48231.1| iron-sulfur cluster assembly accessory protein [Rhodothermus
           marinus DSM 4252]
          Length = 115

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 33/108 (30%), Positives = 58/108 (53%), Gaps = 3/108 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           + +T  A   I++I+   Q  +   +R+ ++ GGC+G+ Y++        + D   E +G
Sbjct: 10  IQLTPRAAQEIRKIMQTKQIPEGYALRVGVRGGGCSGMSYLLGFDRKR--EYDLEFEVEG 67

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + +++D    LY++GT ID+       GFVF+NPN    CGCG S  +
Sbjct: 68  ITIYMDRRHGLYLMGTTIDYHDGLNARGFVFNNPNATQTCGCGSSFAV 115


>gi|84393810|ref|ZP_00992556.1| HesB family protein [Vibrio splendidus 12B01]
 gi|86148144|ref|ZP_01066443.1| HesB family protein [Vibrio sp. MED222]
 gi|84375550|gb|EAP92451.1| HesB family protein [Vibrio splendidus 12B01]
 gi|85834061|gb|EAQ52220.1| HesB family protein [Vibrio sp. MED222]
          Length = 113

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 32/114 (28%), Positives = 59/114 (51%), Gaps = 4/114 (3%)

Query: 1   MSDI---VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD 57
           MS++   ++ ++AA  R++ ++   +     +R+ +  GGC+G +Y      +   DGD 
Sbjct: 1   MSEVNIPLSFSDAAATRVQTLIAEEENPELKLRVYITGGGCSGFQYGFTFD-EKVNDGDT 59

Query: 58  LIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            I   GV + +D  SL Y++G  +D+      + F  +NPN  + CGCG S  +
Sbjct: 60  TIVNSGVTLVVDPMSLQYLMGGMVDYTEGLEGARFFVNNPNATTTCGCGASFSV 113


>gi|332525030|ref|ZP_08401211.1| iron-sulfur cluster assembly accessory protein [Rubrivivax
           benzoatilyticus JA2]
 gi|332108320|gb|EGJ09544.1| iron-sulfur cluster assembly accessory protein [Rubrivivax
           benzoatilyticus JA2]
          Length = 107

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 57/107 (53%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T  A  +I++ +        G+R+ +K  GC+G  Y ++         D   E +GV
Sbjct: 3   ISVTPKAAAQIRKALAKRGS-GVGLRLDVKTSGCSGYAYALEFADAA-APEDLAFESEGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++++ + SL  + GT +D+  E L  GF F NPN  + CGCG+S  +
Sbjct: 61  QLFVAANSLPLLDGTRLDWVREGLNEGFKFDNPNAAATCGCGESFAV 107


>gi|315425724|dbj|BAJ47380.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Caldiarchaeum subterraneum]
          Length = 117

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 63/109 (57%), Gaps = 2/109 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQG-KAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +T+TE A  +I +++    G     +RI +  GGC+G  Y + L  +   D   +    G
Sbjct: 10  LTVTERAAKKIAQLIEQEGGSDKMALRIYITGGGCSGYRYGMALDENVYEDDVVVNA-HG 68

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           VKV +DS S  ++ G+EID+  + + SGF  +NPN VS+CGCGQS  +K
Sbjct: 69  VKVVVDSFSAPFLEGSEIDYIEDVMGSGFAINNPNVVSSCGCGQSFNLK 117


>gi|302781833|ref|XP_002972690.1| hypothetical protein SELMODRAFT_228144 [Selaginella moellendorffii]
 gi|302812835|ref|XP_002988104.1| hypothetical protein SELMODRAFT_159176 [Selaginella moellendorffii]
 gi|300144210|gb|EFJ10896.1| hypothetical protein SELMODRAFT_159176 [Selaginella moellendorffii]
 gi|300159291|gb|EFJ25911.1| hypothetical protein SELMODRAFT_228144 [Selaginella moellendorffii]
          Length = 129

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/112 (33%), Positives = 62/112 (55%), Gaps = 3/112 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              + ++++A  RI++++         +R+ +K  GC G  Y ++         D+L+E 
Sbjct: 20  KQAIALSDSAAKRIRQLLDLRNKD--YLRVGVKVRGCNGYSYTMNYADQA-ERHDELVED 76

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
            GVKV ID  +L+ ++GT++DF  ++L S FVF NPN    CGCG+S   K 
Sbjct: 77  KGVKVLIDPRALMKIIGTKMDFIEDRLKSEFVFLNPNATGTCGCGESFTAKE 128


>gi|289208017|ref|YP_003460083.1| iron-sulfur cluster assembly protein IscA [Thioalkalivibrio sp.
           K90mix]
 gi|288943648|gb|ADC71347.1| iron-sulfur cluster assembly protein IscA [Thioalkalivibrio sp.
           K90mix]
          Length = 107

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A  RI+  +   +GK  G+R+ ++  GC+G+ Y+V+   D+  D D + E  GV
Sbjct: 3   ITLTEPAAERIQSFLA-QRGKGLGVRLGVRTTGCSGMAYVVEFA-DDIEDTDTVFEDRGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ++  SL+Y+ GTE+DF  E L  GF F+NPN+ + CGCG+S  I
Sbjct: 61  KLVVNPKSLVYLDGTELDFGKEGLNEGFKFNNPNEKARCGCGESFSI 107


>gi|308070634|ref|YP_003872239.1| hypothetical protein PPE_03904 [Paenibacillus polymyxa E681]
 gi|305859913|gb|ADM71701.1| Conserved hypothetical protein [Paenibacillus polymyxa E681]
          Length = 119

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 31/106 (29%), Positives = 57/106 (53%), Gaps = 1/106 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T++A  R+K+++   +     +R+ +  GGC G  Y +    +       +  +D 
Sbjct: 1   MINITDSAAERLKDMLEQQETPNMFLRLGVTPGGCTGFSYAMGFDDNETDQDIYMNVQD- 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           +K+ ++  S+ Y+ G EIDF+   +  GF  HNPN V+ CGCG S 
Sbjct: 60  MKIVVEKESIRYLDGLEIDFEESGMSGGFTIHNPNAVATCGCGSSF 105


>gi|302561050|ref|ZP_07313392.1| HesB/YadR/YfhF family protein [Streptomyces griseoflavus Tu4000]
 gi|302478668|gb|EFL41761.1| HesB/YadR/YfhF family protein [Streptomyces griseoflavus Tu4000]
          Length = 118

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AA  +++ ++         +R++++ GGC+GL Y +     + +DGD   + DGV
Sbjct: 14  IVLTDAAASKVRALLDQEGRDDLALRVAVQPGGCSGLRYQLFFDERS-LDGDVQKDFDGV 72

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           KV  D  S  Y+ G  IDF       GF   NPN   +C CG S  
Sbjct: 73  KVVTDRMSAPYLGGATIDFVDTIEKQGFTIDNPNATGSCACGDSFS 118


>gi|163857087|ref|YP_001631385.1| hypothetical protein Bpet2775 [Bordetella petrii DSM 12804]
 gi|163260815|emb|CAP43117.1| conserved hypothetical protein [Bordetella petrii]
          Length = 107

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 41/111 (36%), Positives = 63/111 (56%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  VT+T+ A   I   +   +GK  G+R+ ++  GC+G+ Y ++ V D   +      
Sbjct: 1   MS--VTLTQQAASHIGRYL-QKRGKGVGLRLGVRTTGCSGMAYKLEYVDDPAPEDMVFES 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GVKV++D  S  Y+ GTE+D+  E L  GF F NPN+ + CGCG+S  +
Sbjct: 58  F-GVKVFVDPKSFAYLDGTELDYAREGLNEGFKFRNPNEKATCGCGESFTV 107


>gi|223936198|ref|ZP_03628111.1| iron-sulfur cluster assembly accessory protein [bacterium Ellin514]
 gi|223895060|gb|EEF61508.1| iron-sulfur cluster assembly accessory protein [bacterium Ellin514]
          Length = 128

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 62/107 (57%), Gaps = 1/107 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE+A  ++  ++         +R+++  GGC+GL+Y +DL  D P + D L+E  G
Sbjct: 22  LIKVTESAAKKVSSLLTKQGRAQGVLRVAVVGGGCSGLQYKMDL-QDGPANRDILVESSG 80

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +KV +D  S LY+ G+E+D+       GF   NPN  ++C CG+S  
Sbjct: 81  IKVVVDPKSALYVTGSELDYLDALQEGGFKVKNPNAATSCSCGESFS 127


>gi|167465178|ref|ZP_02330267.1| hypothetical protein Plarl_21896 [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322384551|ref|ZP_08058231.1| chaperone-like protein associated with Fe-S cluster assembly
           [Paenibacillus larvae subsp. larvae B-3650]
 gi|321150606|gb|EFX44083.1| chaperone-like protein associated with Fe-S cluster assembly
           [Paenibacillus larvae subsp. larvae B-3650]
          Length = 120

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 63/111 (56%), Gaps = 1/111 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ ++E A  +IKE++   +     +R+ + +GGC+G  Y +    +   + D++++ DG
Sbjct: 1   MIQISEIANEKIKELLAAEETPGLFLRLGVLEGGCSGFSYGMGFDNEQ-KEEDEVLDVDG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           +K+ +D  S+ Y+ G EID+K   +  GF  HNPN ++ CGCG S      
Sbjct: 60  LKIVVDQDSMKYLNGLEIDYKEAGMGGGFTIHNPNAIATCGCGSSFRTAPE 110


>gi|59711226|ref|YP_204002.1| Fe-S cluster assembly protein IscA [Vibrio fischeri ES114]
 gi|197335386|ref|YP_002155376.1| iron-sulfur cluster assembly protein IscA [Vibrio fischeri MJ11]
 gi|59479327|gb|AAW85114.1| Fe-S cluster assembly protein IscA [Vibrio fischeri ES114]
 gi|197316876|gb|ACH66323.1| iron-sulfur cluster assembly protein IscA [Vibrio fischeri MJ11]
          Length = 107

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TEAA  R+++ + N +GK  G+R+ ++  GC+G+ Y+++ V +   +     +  GV
Sbjct: 3   ISVTEAAASRVQKFLEN-RGKGVGLRLGVRTSGCSGMAYILEFVDELNEEDQVFEQF-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL YM GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIIDPKSLAYMDGTELDFAKEGLNEGFKFNNPNVKSECGCGESFNV 107


>gi|312115591|ref|YP_004013187.1| iron-sulfur cluster assembly accessory protein [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311220720|gb|ADP72088.1| iron-sulfur cluster assembly accessory protein [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 122

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 53/112 (47%), Positives = 81/112 (72%), Gaps = 1/112 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            +VT+T++A  R+K I+  S+    G+R+ +KKGGCAG+EY ++   +     + + +K 
Sbjct: 7   KVVTLTDSAAERVKAIIGRSETPVVGLRVGIKKGGCAGMEYTMEYAAEARPLEEVVEDK- 65

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           GV++ I+ +++LY+LGTE+D+KTEK  SGFVF NPNQ SACGCG+SVE+  A
Sbjct: 66  GVRILIEPSAILYLLGTEMDYKTEKFVSGFVFKNPNQTSACGCGESVELSPA 117


>gi|255082211|ref|XP_002508324.1| predicted protein [Micromonas sp. RCC299]
 gi|226523600|gb|ACO69582.1| predicted protein [Micromonas sp. RCC299]
          Length = 222

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 64/113 (56%), Gaps = 5/113 (4%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              + +TEAA  RIKE++         ++I ++  GC G+ Y ++   D      D +  
Sbjct: 112 KQAMELTEAAAARIKELLAKRAKP--YLKIGVRTRGCNGMTYTMNYADDGDKGKFDEVVT 169

Query: 62  D---GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
               GVKV ID A+L++++GT++DF T++L S FVF NPN    CGCG+S  +
Sbjct: 170 HEASGVKVIIDPAALMHVVGTKMDFVTDRLRSEFVFENPNAKGECGCGESFNV 222


>gi|163759457|ref|ZP_02166542.1| hypothetical protein HPDFL43_08897 [Hoeflea phototrophica DFL-43]
 gi|162283054|gb|EDQ33340.1| hypothetical protein HPDFL43_08897 [Hoeflea phototrophica DFL-43]
          Length = 111

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E+A  RIKEIV   QGK+  +R+S++ GGC+G  Y  DL  +   D   L   D  
Sbjct: 7   VTLSESAARRIKEIVSAEQGKS-ALRVSVEGGGCSGFSYKFDLDNEPGEDDIVLER-DDA 64

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V ID  SL+YM G+EIDF    +   F   NPN V++CGCG S  +
Sbjct: 65  RVLIDQVSLVYMAGSEIDFVDNLMGQAFQIKNPNAVASCGCGTSFSV 111


>gi|297180368|gb|ADI16585.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF0010_01E20]
          Length = 110

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   +  +E A  ++K ++ +       +R+ +  GGC G  Y          D   +  
Sbjct: 1   MQADIEFSERAASKVKSLIEDEGDSRLCLRVFITGGGCNGFSYGFTFDDTPAEDDAVIER 60

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GV++ +D+ S  Y+ G++ID+  +   + F   NPN  + CGCG S  +
Sbjct: 61  L-GVRMLVDAMSYPYLAGSDIDYVEDLAGAQFTVSNPNASATCGCGSSFSL 110


>gi|301095054|ref|XP_002896629.1| iron-sulfur cluster assembly protein, putative [Phytophthora
           infestans T30-4]
 gi|262108859|gb|EEY66911.1| iron-sulfur cluster assembly protein, putative [Phytophthora
           infestans T30-4]
          Length = 149

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 34/112 (30%), Positives = 63/112 (56%), Gaps = 3/112 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDL--VTDNPVDGDDLIEKD 62
           + +T  A  ++ E     + K   +R++++ GGC+G +Y+++         + D + E+ 
Sbjct: 38  LIITPIAAQKLLEAAERQKAKNLMLRVAVEGGGCSGFQYVIEFEKDATPDAEEDVVFEQH 97

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGF-VFHNPNQVSACGCGQSVEIKR 113
           G KV +D  SL  + G+ +D++ E + S F V +NPN V+ CGCG S ++K 
Sbjct: 98  GGKVVVDKESLELIRGSTVDYEQELIRSAFAVVNNPNAVAGCGCGTSFDLKD 149


>gi|297583479|ref|YP_003699259.1| iron-sulfur cluster assembly accessory protein [Bacillus
           selenitireducens MLS10]
 gi|297141936|gb|ADH98693.1| iron-sulfur cluster assembly accessory protein [Bacillus
           selenitireducens MLS10]
          Length = 116

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 66/106 (62%), Gaps = 2/106 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TEAA  ++K+++ +    A+ +R+ ++ GGC+GL Y +   T+   + D L+E DG
Sbjct: 1   MLEITEAAATQVKQMMEDE-ADAKFLRVGVQGGGCSGLSYGMGFDTEK-AEDDTLLEVDG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           ++V +D  S   + GT+ID+K   +  GF   NPN V++CGCG S 
Sbjct: 59  IEVLVDKESEPMLKGTKIDYKENMMGGGFTIDNPNAVASCGCGSSF 104


>gi|119475786|ref|ZP_01616139.1| HesB/YadR/YfhF family protein [marine gamma proteobacterium
           HTCC2143]
 gi|119451989|gb|EAW33222.1| HesB/YadR/YfhF family protein [marine gamma proteobacterium
           HTCC2143]
          Length = 117

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 55/105 (52%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           ++E AV ++K ++         +R+ +  GGC+G  Y      +   D D +IE +GV  
Sbjct: 14  LSERAVAKVKSLIAEEANDDLKLRVFVTGGGCSGFSYGFTFD-ELVADDDTVIETEGVVA 72

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +DS S  Y++G E+D++     S FV  NPN  + CGCG S  +
Sbjct: 73  LLDSMSYQYLVGAEVDYQEGLEGSRFVAINPNADTTCGCGSSFSV 117


>gi|86606311|ref|YP_475074.1| iron-sulfur cluster assembly accessory protein [Synechococcus sp.
           JA-3-3Ab]
 gi|86554853|gb|ABC99811.1| iron-sulfur cluster assembly accessory protein [Synechococcus sp.
           JA-3-3Ab]
          Length = 118

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 58/109 (53%), Gaps = 3/109 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQ--GIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           ++T+TE+A+  +K +    + +     +R+ +K  GC+GL Y ++         D   + 
Sbjct: 1   MITLTESAIQELKRLRSKYEKEGSQPILRLGVKPSGCSGLSYTMNFEPQA-NPDDHTFDF 59

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             ++V +D  S+ ++ G  +DF  + L  GF F NPN V++CGCG S  
Sbjct: 60  GEIRVAVDPLSMTFIQGLTVDFSEDLLGGGFRFKNPNAVASCGCGTSFA 108


>gi|325192644|emb|CCA27067.1| ironsulfur cluster assembly protein putative [Albugo laibachii
           Nc14]
          Length = 154

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 64/110 (58%), Gaps = 2/110 (1%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              + +T AA  RI+E++ N   +A GIR+ ++  GC GL Y ++         ++ ++ 
Sbjct: 47  PPPLKITNAAADRIRELMKNK-PEALGIRLGVRTRGCNGLSYTMNYADRK-APLEEEVKD 104

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GV V+++  +L +++GT +DF T  L S FVF NPN   +CGCG+S  +
Sbjct: 105 KGVCVFVEPKALFHVVGTTMDFHTSPLASEFVFENPNAKGSCGCGESFNV 154


>gi|92117301|ref|YP_577030.1| HesB/YadR/YfhF [Nitrobacter hamburgensis X14]
 gi|91800195|gb|ABE62570.1| HesB/YadR/YfhF [Nitrobacter hamburgensis X14]
          Length = 110

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++E A  RI EI+ +       +RIS++ GGC+G +Y  D+      D   +   D  
Sbjct: 6   ITVSERAARRIGEILKSEG-DGAMLRISVEGGGCSGFQYKFDIERAKAEDDLVIAR-DTA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D AS+ ++ G+E+DF  + + + F   NPN  ++CGCG S  I
Sbjct: 64  VVLVDPASVPFLSGSEVDFVDDLIGASFRVVNPNATASCGCGTSFSI 110


>gi|297626746|ref|YP_003688509.1| HesB protein [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
 gi|296922511|emb|CBL57084.1| HesB protein [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
          Length = 116

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+AA  + + ++         +R+ ++ GGC+GL Y +       +  D +   DGV
Sbjct: 12  VTLTDAAAQKARTLLEGEGRDDLALRVEVQPGGCSGLRYRLAFDDSR-LPDDLVDAYDGV 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            + +D  S  Y+ G  IDF       GF   NPN  S C CG S  
Sbjct: 71  DLVVDRLSAPYLGGATIDFVDTIEQQGFTIDNPNAQSTCACGDSFH 116


>gi|88858494|ref|ZP_01133136.1| Fe-S cluster assembly and activation protein [Pseudoalteromonas
           tunicata D2]
 gi|88820111|gb|EAR29924.1| Fe-S cluster assembly and activation protein [Pseudoalteromonas
           tunicata D2]
          Length = 107

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 73/107 (68%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE+AV R++  +  ++GK  G+R+ +K  GC+GL Y+++ V +   +GD+  E+DGV
Sbjct: 3   ITLTESAVNRVRTFL-QNRGKGIGLRVGIKTTGCSGLAYVLEFVDEL-AEGDETFEQDGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D+ SL+Y+ GT++DF  E L  GF F NPNQ   CGCG+S  +
Sbjct: 61  TVIVDAKSLVYIDGTQLDFVKEGLNEGFKFSNPNQSGECGCGESFTV 107


>gi|311031747|ref|ZP_07709837.1| iron-sulfur cluster assembly accessory protein [Bacillus sp. m3-13]
          Length = 120

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 64/109 (58%), Gaps = 1/109 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MSD++T+TEAA ++IK+++     ++  +R+ +K GGC+GL Y +    +      +L  
Sbjct: 1   MSDVITITEAAAFQIKDMMKEHGDESVFLRVGVKGGGCSGLSYGMGFEEEKGEKDIELE- 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           + G+K+ ID+ S   +   +IDFK   +  GF   NPN ++ CGCG S 
Sbjct: 60  QHGIKILIDAESKPILQDVKIDFKQSMMGGGFTIDNPNAIANCGCGSSF 108


>gi|262370467|ref|ZP_06063793.1| iron-binding protein [Acinetobacter johnsonii SH046]
 gi|262314809|gb|EEY95850.1| iron-binding protein [Acinetobacter johnsonii SH046]
          Length = 106

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V           +  G
Sbjct: 1   MINLTENAATHISNYLKN-RGKGEGIRVGVKTSGCSGLAYVLEFVDSIDAHDTTFEQF-G 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  SL+Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSLVYLDGMEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|119944628|ref|YP_942308.1| iron-sulfur cluster assembly accessory protein [Psychromonas
           ingrahamii 37]
 gi|160385717|sp|A1ST94|ERPA_PSYIN RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|119863232|gb|ABM02709.1| iron-sulfur cluster assembly accessory protein [Psychromonas
           ingrahamii 37]
          Length = 118

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 49/106 (46%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +  +++A  ++K ++   +     +R+ +  GGC+G  Y          D   +    GV
Sbjct: 13  IYFSDSAANKVKGLIAEEENPNMKLRVYVTGGGCSGFSYGFTFAETANEDDTKIENA-GV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            + +D  SL Y++G  +D+      S F  +NPN  + CGCG S  
Sbjct: 72  TLLVDPMSLQYLVGGTVDYTNGLEGSRFFVNNPNATATCGCGSSFS 117


>gi|332526734|ref|ZP_08402836.1| iron-sulfur cluster assembly protein IscA [Rubrivivax
           benzoatilyticus JA2]
 gi|332111137|gb|EGJ11169.1| iron-sulfur cluster assembly protein IscA [Rubrivivax
           benzoatilyticus JA2]
          Length = 107

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 42/111 (37%), Positives = 62/111 (55%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  +T+TEAA   +   +   +GK  G+R+ +K  GC+GL Y ++   +   +      
Sbjct: 1   MS--ITLTEAAARHVTRYL-GRRGKGVGVRLGVKTTGCSGLAYKLEYADEVGAEDIVFE- 56

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GVKV +D  SL Y+ GT++DF  E L  GF FHNP +   CGCG+S  +
Sbjct: 57  DHGVKVLVDPKSLPYLDGTQLDFVREGLNEGFKFHNPRERDRCGCGESFRV 107


>gi|260574691|ref|ZP_05842694.1| iron-sulfur cluster assembly accessory protein [Rhodobacter sp.
           SW2]
 gi|259023108|gb|EEW26401.1| iron-sulfur cluster assembly accessory protein [Rhodobacter sp.
           SW2]
          Length = 112

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 61/105 (58%), Gaps = 3/105 (2%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T+ A  R+ EI   S  + + +R++++ GGC+G +Y + L        D ++EKDG KV
Sbjct: 11  VTDRAFARLAEIAAASG-EQRALRVAVEGGGCSGFQYDIKLDDP--AADDLVLEKDGQKV 67

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D+ SL ++    ID+  E + + FV  NPN  S+CGCG S  I
Sbjct: 68  LVDAVSLPFLANAVIDYSEELIGARFVIDNPNASSSCGCGTSFSI 112


>gi|327404075|ref|YP_004344913.1| iron-sulfur cluster assembly accessory protein [Fluviicola
           taffensis DSM 16823]
 gi|327319583|gb|AEA44075.1| iron-sulfur cluster assembly accessory protein [Fluviicola
           taffensis DSM 16823]
          Length = 107

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 57/108 (52%), Gaps = 1/108 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+TE A  +   ++ +       IR+ ++ GGC+GL Y +          D   E +G
Sbjct: 1   MITVTEQAKKQAIRLMEDDGKAGYFIRVGVEGGGCSGLMYQLTFDNQE-KADDKTFEDNG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +KV +D  S LY++GT +DF       GF+F NPN    CGCG+S  +
Sbjct: 60  IKVVVDKKSFLYLVGTTLDFSGGLNGKGFIFSNPNAGRTCGCGESFSL 107


>gi|194768925|ref|XP_001966561.1| GF21925 [Drosophila ananassae]
 gi|190617325|gb|EDV32849.1| GF21925 [Drosophila ananassae]
          Length = 130

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 67/106 (63%), Gaps = 2/106 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV RIK ++   +    G+++ +++ GC GL Y +D  +      ++++ +DGV
Sbjct: 26  LTLTPAAVQRIKTLL-QDKPDMVGLKVGVRQRGCNGLSYTLDYASQKDKLDEEVV-QDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           KV+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  
Sbjct: 84  KVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFS 129


>gi|195164087|ref|XP_002022880.1| GL16489 [Drosophila persimilis]
 gi|198471618|ref|XP_001355683.2| GA20890 [Drosophila pseudoobscura pseudoobscura]
 gi|194104942|gb|EDW26985.1| GL16489 [Drosophila persimilis]
 gi|198145998|gb|EAL32742.2| GA20890 [Drosophila pseudoobscura pseudoobscura]
          Length = 130

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 67/106 (63%), Gaps = 2/106 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV RIK ++   +    G+++ +++ GC GL Y +D  +      ++++ +DGV
Sbjct: 26  LTLTPAAVNRIKTLL-QDKPDFIGLKVGVRQRGCNGLSYTLDYASSKDKLDEEVV-QDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           KV+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  
Sbjct: 84  KVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFS 129


>gi|188582822|ref|YP_001926267.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           populi BJ001]
 gi|179346320|gb|ACB81732.1| iron-sulfur cluster assembly accessory protein [Methylobacterium
           populi BJ001]
          Length = 108

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 56/107 (52%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  A  RI EI+  S+     +RIS+  GGC+G  Y  D+        D +IE+DG 
Sbjct: 4   ITLTPRAAKRINEIM-GSEPPGSSLRISVNGGGCSGFSYAFDIT-SAREGDDIVIERDGA 61

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  SL YM G  IDF  + +   F   NP   ++CGCG S  I
Sbjct: 62  TVLVDPVSLEYMGGATIDFVNDLIGQSFKIENPLATASCGCGTSFAI 108


>gi|327481762|gb|AEA85072.1| iron-sulfur cluster assembly protein IscA [Pseudomonas stutzeri DSM
           4166]
          Length = 107

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT AA   ++  +   +GK  G+R+ ++  GC+GL Y+++ V +     D + E  GV
Sbjct: 3   ITMTPAAAQHVRRSLEG-RGKGVGVRLGVRTTGCSGLAYVLEFVDET-AAEDSVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  I
Sbjct: 61  KVIIDPKSLVYLDGTELDFVREGLNEGFKFNNPNVRGECGCGESFNI 107


>gi|158424432|ref|YP_001525724.1| HesB protein [Azorhizobium caulinodans ORS 571]
 gi|158331321|dbj|BAF88806.1| HesB protein [Azorhizobium caulinodans ORS 571]
          Length = 140

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T++A  RI EI+     ++  +R+S++ GGC+G +Y  D VT      D +IE+DG 
Sbjct: 36  VIVTDSAARRISEILSAEAPES-ALRVSVEGGGCSGFQYRFD-VTRERNPDDIVIEQDGA 93

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  SL YM G  IDF  + + + F   NP+  ++CGCG S  I
Sbjct: 94  TVLVDKVSLDYMSGCRIDFVDDLIGAAFKIENPHATASCGCGTSFSI 140


>gi|229820375|ref|YP_002881901.1| iron-sulfur cluster assembly accessory protein [Beutenbergia
           cavernae DSM 12333]
 gi|229566288|gb|ACQ80139.1| iron-sulfur cluster assembly accessory protein [Beutenbergia
           cavernae DSM 12333]
          Length = 119

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 57/106 (53%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T+ A  ++K ++         +R++++ GGC+GL Y +    +  +DGD L + DGV
Sbjct: 15  VELTDVAAAKVKALLEQEGRDDLRLRVAVQPGGCSGLIYQLYFD-ERVLDGDALRDFDGV 73

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +V +D  S+ Y++G  IDF       GF   NPN   +C CG S  
Sbjct: 74  EVVVDKMSVPYLVGATIDFADTIEKQGFTIDNPNASGSCACGDSFH 119


>gi|195396973|ref|XP_002057103.1| GJ16900 [Drosophila virilis]
 gi|194146870|gb|EDW62589.1| GJ16900 [Drosophila virilis]
          Length = 130

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 68/106 (64%), Gaps = 2/106 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV RIK ++   + +  G+++ +++ GC GL Y +D  +      ++++ +DGV
Sbjct: 26  LTLTPAAVQRIKSLL-QDKPEVIGLKVGVRQRGCNGLSYTLDYASTKDKLDEEVV-QDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           KV+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  
Sbjct: 84  KVFIDKKAQLSLLGTEMDFVESKLTSEFVFNNPNIKGTCGCGESFS 129


>gi|163845628|ref|YP_001633672.1| iron-sulfur cluster assembly accessory protein [Chloroflexus
           aurantiacus J-10-fl]
 gi|222523331|ref|YP_002567801.1| iron-sulfur cluster assembly accessory protein [Chloroflexus sp.
           Y-400-fl]
 gi|163666917|gb|ABY33283.1| iron-sulfur cluster assembly accessory protein [Chloroflexus
           aurantiacus J-10-fl]
 gi|222447210|gb|ACM51476.1| iron-sulfur cluster assembly accessory protein [Chloroflexus sp.
           Y-400-fl]
          Length = 147

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 60/113 (53%), Gaps = 1/113 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
            ++T++EAA  R+ +++   + +   +R+ +  GGC+GL+Y +    +     ++    +
Sbjct: 18  PLLTISEAASSRLLKMMQEKELEGYALRVFVAGGGCSGLQYGMTFDDEVREGDNEFYAGN 77

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            ++V +D  S  Y+ G  IDF    +  GF   NPN VS+CGCG S   +  D
Sbjct: 78  -LRVLVDPISAQYLFGASIDFVDTLMGGGFKIDNPNAVSSCGCGHSFRARDTD 129


>gi|323488632|ref|ZP_08093874.1| iron-sulfur cluster assembly accessory protein [Planococcus
           donghaensis MPA1U2]
 gi|323397650|gb|EGA90454.1| iron-sulfur cluster assembly accessory protein [Planococcus
           donghaensis MPA1U2]
          Length = 120

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 64/109 (58%), Gaps = 1/109 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+++V +TEAA ++IKE++ +++ +   +R+++K GGC+GL Y +    +   + D   +
Sbjct: 1   MTEVVEITEAASFQIKEMMRHNEEEGSYLRVAVKGGGCSGLTYGMGFEKEKTGEDDRYEQ 60

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
             G+ + I       + GT +D+K   +  GF   NPN +++CGCG S 
Sbjct: 61  F-GIPILIAKEDAPILQGTVVDYKQSLMGGGFTIENPNAIASCGCGTSF 108


>gi|294789070|ref|ZP_06754310.1| iron-sulfur cluster assembly accessory protein [Simonsiella
           muelleri ATCC 29453]
 gi|294483172|gb|EFG30859.1| iron-sulfur cluster assembly accessory protein [Simonsiella
           muelleri ATCC 29453]
          Length = 112

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 57/113 (50%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  T+A   ++ +++         +R+ +  GGC+G +Y      +   D D  
Sbjct: 1   MSDESPIIFTDACCVKVADLIAEENNPNLMLRVFVNGGGCSGFQYGFTFD-EIKNDDDFE 59

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           IEK+G+K  +D  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 60  IEKNGLKFLVDPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV 112


>gi|304311757|ref|YP_003811355.1| Iron-sulphur cluster assembly protein [gamma proteobacterium HdN1]
 gi|301797490|emb|CBL45710.1| Iron-sulphur cluster assembly protein [gamma proteobacterium HdN1]
          Length = 117

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 59/108 (54%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++ T  A+  +++I+      AQG+R+S+K  GC+G  Y++D       +   L    G+
Sbjct: 12  LSFTPNAIAHLRKIL--QSNTAQGVRVSVKMSGCSGYRYVLDCADQPKENDLSLEVASGL 69

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
            V+ID  SL  + GTE+D+  E L S   F NPN    CGCG+S  +K
Sbjct: 70  IVFIDPESLPMLAGTEVDYVREGLNSSLQFRNPNATGECGCGESFTVK 117


>gi|85716515|ref|ZP_01047486.1| HesB/YadR/YfhF [Nitrobacter sp. Nb-311A]
 gi|85696704|gb|EAQ34591.1| HesB/YadR/YfhF [Nitrobacter sp. Nb-311A]
          Length = 110

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++E A  RI EI+ +       +RIS++ GGC+G +Y  D+      D D +I +D  
Sbjct: 6   ITVSERAARRIGEILKSEG-DGAMLRISVEGGGCSGFQYKFDIERAK-ADDDLVIARDSA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D AS+ ++ G+E+DF  + + + F   NPN  ++CGCG S  I
Sbjct: 64  VVLVDPASVPFLSGSEVDFVDDLIGASFRVVNPNATASCGCGTSFSI 110


>gi|329119220|ref|ZP_08247907.1| iron-sulfur cluster assembly accessory protein [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327464567|gb|EGF10865.1| iron-sulfur cluster assembly accessory protein [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 112

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 55/113 (48%), Gaps = 3/113 (2%)

Query: 1   MSD--IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           MSD   +  TE+   ++ +++         +R+ +  GGC+G +Y      +   D D  
Sbjct: 1   MSDESPIIFTESCCTKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFD-EIKNDDDFE 59

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           I K+G+   +D  S  Y++G EID+      S FV  NPN  + CGCG S  +
Sbjct: 60  IVKNGLTFLVDPMSYQYLVGAEIDYTESLHGSQFVIRNPNAETTCGCGSSFSV 112


>gi|171913432|ref|ZP_02928902.1| iron-sulfur cluster assembly accessory protein [Verrucomicrobium
           spinosum DSM 4136]
          Length = 110

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 62/110 (56%), Gaps = 3/110 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGK-AQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++ +T+ AV  ++E++ +       G+R+ +KKGGCAG EY + L +    D       +
Sbjct: 1   MIAVTDNAVKHLRELLESQNAAAGVGLRLMVKKGGCAGWEYAMKLDSPGAADRVFGP--E 58

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           GV V++D  SL Y+ G+++D+      +GF   NPN   +CGCG S E K
Sbjct: 59  GVSVFVDPESLEYLDGSQLDYSEGLSDAGFKVENPNAARSCGCGSSFEPK 108


>gi|170594738|ref|XP_001902112.1| Iron-sulfur cluster assembly accessory protein [Brugia malayi]
 gi|158590409|gb|EDP29041.1| Iron-sulfur cluster assembly accessory protein [Brugia malayi]
          Length = 712

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 65/113 (57%), Gaps = 4/113 (3%)

Query: 1   MSDIVTM--TEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDL 58
           M   + +  T  AV R+K ++     +   ++IS+++ GC GL Y +D         D+ 
Sbjct: 602 MPSKIALWLTPEAVKRVKYLLSKQ-PETTALKISVRQRGCNGLTYTLDYAQQKAK-FDEE 659

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + +DGV++WID  + L +LG+E+D+  ++L S FVF NPN    CGCG+S  I
Sbjct: 660 VVQDGVRLWIDPKAQLSLLGSEMDYVEDRLSSEFVFRNPNIKGTCGCGESFSI 712


>gi|312796713|ref|YP_004029635.1| iron-sulphur cluster assembly protein IscA [Burkholderia
           rhizoxinica HKI 454]
 gi|312168488|emb|CBW75491.1| Iron-sulphur cluster assembly protein IscA [Burkholderia
           rhizoxinica HKI 454]
          Length = 107

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 61/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TE A   +++ +   +GK  G+R+ ++  GC+GL Y ++ V +            G+
Sbjct: 3   ITLTEKAAQHVQKYL-TRRGKGIGLRLGVRTTGCSGLAYKLEYVDELDGGDMVFE-SHGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIVDPKSLAYIDGTELDFAREGLNEGFRFNNPNVKDECGCGESFRV 107


>gi|149277991|ref|ZP_01884130.1| scaffold protein for iron-sulphur cluster assembly [Pedobacter sp.
           BAL39]
 gi|149231189|gb|EDM36569.1| scaffold protein for iron-sulphur cluster assembly [Pedobacter sp.
           BAL39]
          Length = 108

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 64/109 (58%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++T+T+ A  +I  ++ ++   ++  +R+S+K GGC+GL Y +D   +         ++ 
Sbjct: 1   MITITDKAKSKIDHLMQDAHLDESYFLRVSVKGGGCSGLSYNLDFDNEEKTGDQFFEDR- 59

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVK+ +D  S LY+ GTE+DF       GF F+NPN   +CGCG+S  +
Sbjct: 60  GVKIALDMKSFLYLAGTELDFTDGLNGKGFNFNNPNASRSCGCGESFSV 108


>gi|171463239|ref|YP_001797352.1| iron-sulfur cluster assembly protein IscA [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|171192777|gb|ACB43738.1| iron-sulfur cluster assembly protein IscA [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 107

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+ A   +   +   +GK  G+R+ ++  GC+GL Y ++ V +     D + E +G+
Sbjct: 3   ITLTDKAAAHVNRNLEK-RGKGCGLRLGVRTTGCSGLAYQLEYVDEP-AAEDQVFESNGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D  SL Y+ GTE+DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVFVDPKSLAYLDGTELDFVREGLNEGFKFQNPNVKDECGCGESFRV 107


>gi|50553450|ref|XP_504136.1| YALI0E19206p [Yarrowia lipolytica]
 gi|49650005|emb|CAG79731.1| YALI0E19206p [Yarrowia lipolytica]
          Length = 250

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 67/110 (60%), Gaps = 3/110 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T++  AV  +K+++   + K   IRI ++  GC+GL Y +D V       D+ + +
Sbjct: 144 KAVITLSPTAVKHLKDLLDQPEPK--LIRIGVRNRGCSGLTYHIDYVDKPAK-FDEEVVQ 200

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGV+V IDS +L  ++G+E+D+  +KL S F+F NPN    CGCG+S  +
Sbjct: 201 DGVRVLIDSKALFSIIGSEMDWLDDKLSSRFIFRNPNSKGECGCGESFMV 250


>gi|117926340|ref|YP_866957.1| iron-sulfur cluster assembly accessory protein [Magnetococcus sp.
           MC-1]
 gi|117610096|gb|ABK45551.1| iron-sulfur cluster assembly accessory protein [Magnetococcus sp.
           MC-1]
          Length = 113

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 59/107 (55%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE A  ++++++         +RI +   GC+G  Y ++                GV
Sbjct: 8   VTITEKAAAQVQKMLQGRGTPDAAVRIGVGTSGCSGFSYKLEYADQLEEGDMVYEA-HGV 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V +DS SLLYM GT++D+ TE   SGF F NP + S CGCG+S ++
Sbjct: 67  RVVVDSKSLLYMAGTQMDYVTENFKSGFTFTNPKETSRCGCGESFKV 113


>gi|164660828|ref|XP_001731537.1| hypothetical protein MGL_1720 [Malassezia globosa CBS 7966]
 gi|159105437|gb|EDP44323.1| hypothetical protein MGL_1720 [Malassezia globosa CBS 7966]
          Length = 182

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 69/108 (63%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPV-DGDDLIEKDG 63
           + +T  AV  I++++  S G    +R+ ++  GCAG+ Y ++ VT       D+ + +DG
Sbjct: 76  IKLTPTAVEHIRKLLSASDGPKL-VRVGVRNKGCAGMSYHLEYVTPGEEGRFDERVMQDG 134

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V+V IDS +L  ++G+E+D+K +++ + FVF+NPN   ACGCG+S  +
Sbjct: 135 VEVLIDSRALFSIIGSEMDWKEDRMSAKFVFNNPNIKDACGCGESFMV 182


>gi|290561206|gb|ADD38005.1| Iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Lepeophtheirus salmonis]
          Length = 135

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 44/105 (41%), Positives = 66/105 (62%), Gaps = 2/105 (1%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           MT +AV RIKE+V   + +  G+RI +K+ GC G+ Y++D         D+ + +DGVK+
Sbjct: 33  MTPSAVRRIKELV-EERHECIGLRIGVKQRGCNGMSYVLDYAIQKEK-HDEEVIQDGVKI 90

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +ID  + L +LGTE+D+    L + FVF+NPN    CGCG+S  I
Sbjct: 91  FIDKKAQLSILGTEMDYVDSNLSAEFVFNNPNIKGTCGCGESFSI 135


>gi|51892121|ref|YP_074812.1| hypothetical protein STH983 [Symbiobacterium thermophilum IAM
           14863]
 gi|51855810|dbj|BAD39968.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 124

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 64/109 (58%), Gaps = 4/109 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +T+TE A  R+KEI+ +   +   +R+ ++ GGC+G EY + L  +   D +    
Sbjct: 1   MN--ITLTEKASNRLKEIIKSKG-ENLALRVLVRPGGCSGFEYGMALERNPRPDDNISE- 56

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
            DG+KV ID ASL Y+ G+ ID+    +  GF  +NPN V+ C CGQS 
Sbjct: 57  FDGIKVVIDPASLPYLDGSTIDYVDSLMGGGFAINNPNAVTGCACGQSF 105


>gi|311895615|dbj|BAJ28023.1| hypothetical protein KSE_22010 [Kitasatospora setae KM-6054]
          Length = 117

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AA  +IK ++         +R++++ GGC+GL Y +     + +DGD + + DGV
Sbjct: 13  ILLTDAAAAKIKGLLEQEGRDDLSLRVAVQPGGCSGLRYQLFFDERS-LDGDVVKDFDGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +V  D  S  Y+ G  +DF       GF   NPN   +C CG S  
Sbjct: 72  QVVTDRMSAPYLGGATVDFVDTIEKQGFTIDNPNATGSCACGDSFS 117


>gi|13470348|ref|NP_101914.1| HesB-like protein [Mesorhizobium loti MAFF303099]
 gi|14021087|dbj|BAB47700.1| HesB-like protein [Mesorhizobium loti MAFF303099]
          Length = 144

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 59/113 (52%), Positives = 79/113 (69%), Gaps = 2/113 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMTE A  R++EIV   +  A GIR+ +KKGGCAG+EY VDLVT+     D +   DG
Sbjct: 24  VITMTEKAADRVREIVATREN-AHGIRLGIKKGGCAGMEYTVDLVTEPNTKDDHIER-DG 81

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
             V++   + L++ GTE+DF+   L +GF FHNPNQ SACGCG+SVE+K ADL
Sbjct: 82  AHVYVAPEAALFLFGTEMDFEQTTLRTGFTFHNPNQSSACGCGESVELKPADL 134


>gi|307547049|ref|YP_003899528.1| hypothetical protein HELO_4459 [Halomonas elongata DSM 2581]
 gi|307219073|emb|CBV44343.1| hypothetical protein HELO_4459 [Halomonas elongata DSM 2581]
          Length = 117

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 58/105 (55%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           ++++A  R++ +V     +   +R+ +  GGC+G +Y  D   ++  + D L+E D V +
Sbjct: 14  LSDSAKARLRSLVEEEGNRELKLRVYVTGGGCSGFQYGFDFA-ESVAEDDTLVEFDDVAL 72

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  S  Y++G+ +DF+     + F+  NPN  + CGCG S  +
Sbjct: 73  VVDPLSYQYLVGSTVDFEEGLAGARFMIQNPNATTTCGCGASFMV 117


>gi|218437065|ref|YP_002375394.1| iron-sulfur cluster assembly accessory protein [Cyanothece sp. PCC
           7424]
 gi|218169793|gb|ACK68526.1| iron-sulfur cluster assembly accessory protein [Cyanothece sp. PCC
           7424]
          Length = 109

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 54/109 (49%), Gaps = 1/109 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T+AA   +K +  +       +R+ ++ GGC+GL Y ++LV              G
Sbjct: 1   MIELTQAAANEVKRLQHSRALSNSYLRVKVQPGGCSGLYYSLELVEQLHQGDRLSPCL-G 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           + + ID  S  Y+   ++D+  + +  GF FHNP     CGCG S  +K
Sbjct: 60  INIIIDQQSEEYLKHLKLDYAEDLMGGGFRFHNPQAQETCGCGLSFTLK 108


>gi|242008035|ref|XP_002424818.1| hes-B, putative [Pediculus humanus corporis]
 gi|212508368|gb|EEB12080.1| hes-B, putative [Pediculus humanus corporis]
          Length = 130

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 67/105 (63%), Gaps = 2/105 (1%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  AV +IKEI+ +   +  G+++ +++ GC GL Y +D   +     ++++ +DGV+V
Sbjct: 28  LTPNAVKKIKEILKDK-TEYIGLKVGVRQRGCNGLSYTLDYAIEKGKLDEEVV-QDGVRV 85

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +ID  + L +LGTE+D+  +KL   FVF+NPN    CGCG+S  I
Sbjct: 86  FIDRKAQLTLLGTEMDYVKDKLSEEFVFNNPNIKGTCGCGESFSI 130


>gi|325293221|ref|YP_004279085.1| iron-sulfur cluster insertion protein [Agrobacterium sp. H13-3]
 gi|325061074|gb|ADY64765.1| putative iron-sulfur cluster insertion protein [Agrobacterium sp.
           H13-3]
          Length = 129

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 63/113 (55%), Positives = 85/113 (75%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I+TMT AA  R+K IV NS   A+G+R+ +KKGGCAG+EY +DLVT+     D +   DG
Sbjct: 5   IMTMTGAAASRVKAIVENSGPDAKGVRVGIKKGGCAGMEYTIDLVTEADAKDDLVE-FDG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            KVW+  +++LY+LGT++DF+  K+ SGF F+NPNQ SACGCG+SVE+K ADL
Sbjct: 64  AKVWVQPSAVLYLLGTQMDFEVTKMRSGFTFNNPNQTSACGCGESVELKPADL 116


>gi|315633892|ref|ZP_07889181.1| iron-sulfur cluster assembly protein IscA [Aggregatibacter segnis
           ATCC 33393]
 gi|315477142|gb|EFU67885.1| iron-sulfur cluster assembly protein IscA [Aggregatibacter segnis
           ATCC 33393]
          Length = 109

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/111 (40%), Positives = 66/111 (59%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M   VT+TE+A  R++  +   +GK  G+R+ +K  GC+GL YM++ V     D     +
Sbjct: 1   MIMSVTLTESAADRVRTFLAK-RGKGIGLRLGIKTSGCSGLSYMLEFVDALNADDHVFEQ 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GVKV +D+ SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 60  Y-GVKVIVDTKSLVYLDGTQLDFAKEGLNEGFKFTNPNVKDECGCGESFNV 109


>gi|255531464|ref|YP_003091836.1| iron-sulfur cluster assembly accessory protein [Pedobacter
           heparinus DSM 2366]
 gi|255344448|gb|ACU03774.1| iron-sulfur cluster assembly accessory protein [Pedobacter
           heparinus DSM 2366]
          Length = 108

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 64/109 (58%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQG-IRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++T+TE A  +I +++  SQ      +R+S+K GGC+GL Y +D   +    GD   E  
Sbjct: 1   MITITEKAKSKIDQLMEESQMDTTYFLRVSVKGGGCSGLSYNLDFDDEE-KAGDQFFEDK 59

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G+++ +D  S LY+ GTE+DF       GF F+NPN   +CGCG+S  +
Sbjct: 60  GIRIALDMKSFLYLAGTELDFSDGLNGKGFNFNNPNASRSCGCGESFSV 108


>gi|262089324|gb|ACY24544.1| putative iron-sulfur cluster assembly accessory protein [uncultured
           crenarchaeote 76h13]
          Length = 116

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 58/109 (53%), Gaps = 1/109 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           ++++T++  A  ++ E +      +  +R+ +  GGC+GL Y +        D + +  +
Sbjct: 7   TELITISPKAAEKVMEFMKQENKDSLYLRVYVSGGGCSGLSYGMGFEEKPDEDDNVID-Q 65

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +G+K+ +DS S  Y+ GT ID+    + SGF  +NPN   +C CG S  
Sbjct: 66  NGIKMIVDSYSQKYLKGTNIDYIESLMGSGFKINNPNVTKSCSCGHSFS 114


>gi|254780287|ref|YP_003064700.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039964|gb|ACT56760.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 109

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 43/111 (38%), Positives = 64/111 (57%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M  I+ +T+AA  +IK I+ ++  K + +RI+++ GGC+G  Y  DL      + D + E
Sbjct: 1   MVPIIKITDAAATQIKTILESNSDK-KALRITIEGGGCSGFSYKFDLE-SKQSEDDIVFE 58

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+G +++ID  SL Y+  +EIDF    L   F   NPN  S CGCG S  I
Sbjct: 59  KNGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI 109


>gi|312282967|dbj|BAJ34349.1| unnamed protein product [Thellungiella halophila]
          Length = 177

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 59/110 (53%), Gaps = 2/110 (1%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIE 60
              +++T+ A+  + + + + +G+   +RI +K+GGC+G+ Y +D         DD  IE
Sbjct: 66  KPAISLTDNALKHLNK-MRSERGEDLCLRIGVKQGGCSGMSYTMDFENRANARPDDSTIE 124

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             G  +  D  S+L++ G ++D+    +  GF F NPN    CGCG+S  
Sbjct: 125 YQGFAIVCDPKSMLFLFGMQLDYSDALIGGGFSFSNPNATQTCGCGKSFA 174


>gi|307190801|gb|EFN74670.1| Iron-sulfur cluster assembly 1-like protein, mitochondrial
           [Camponotus floridanus]
          Length = 130

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 67/105 (63%), Gaps = 2/105 (1%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  AV +IKEI+ +   +  G+++ +++ GC GL Y ++   +     +++I +DGV++
Sbjct: 28  LTPNAVNKIKEILKDK-TEYIGLKVGVRQRGCNGLSYTMNYAKEKSKLDEEVI-QDGVRI 85

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +ID  + L +LGTE+D+   KL S FVF+NPN    CGCG+S  +
Sbjct: 86  FIDRKAQLSLLGTEMDYVENKLSSEFVFNNPNIKGTCGCGESFSV 130


>gi|260460853|ref|ZP_05809103.1| FeS assembly scaffold SufA [Mesorhizobium opportunistum WSM2075]
 gi|259033430|gb|EEW34691.1| FeS assembly scaffold SufA [Mesorhizobium opportunistum WSM2075]
          Length = 126

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 59/113 (52%), Positives = 79/113 (69%), Gaps = 2/113 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMTE A  R++EIV   +  A GIR+ +KKGGCAG+EY VDLVT+     D +   DG
Sbjct: 6   VITMTEKAADRVREIVATREN-AHGIRLGIKKGGCAGMEYTVDLVTEPNTKDDHIER-DG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
             V++   + L++ GTE+DF+   L +GF FHNPNQ SACGCG+SVE+K ADL
Sbjct: 64  AHVYVAPEAALFLFGTEMDFEQTTLRTGFTFHNPNQSSACGCGESVELKPADL 116


>gi|251798817|ref|YP_003013548.1| iron-sulfur cluster assembly accessory protein [Paenibacillus sp.
           JDR-2]
 gi|247546443|gb|ACT03462.1| iron-sulfur cluster assembly accessory protein [Paenibacillus sp.
           JDR-2]
          Length = 118

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++E+A  +IKE++         +RI +K+GGC G  Y +    +   +   L   D 
Sbjct: 1   MITISESASEKIKEMLEEEGTPGLFLRIGVKEGGCTGFSYGMGFDDEENENDKSLEVAD- 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           +KV +D  SL Y+ G  ID+K   +  GF   NPN  + CGCG S 
Sbjct: 60  LKVVVDDESLKYLFGLIIDWKESAMGGGFTIENPNATATCGCGSSF 105


>gi|296123221|ref|YP_003630999.1| iron-sulfur cluster assembly accessory protein [Planctomyces
           limnophilus DSM 3776]
 gi|296015561|gb|ADG68800.1| iron-sulfur cluster assembly accessory protein [Planctomyces
           limnophilus DSM 3776]
          Length = 110

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 59/107 (55%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           VT+TE+A   I+ I+   Q  ++  +R+ +  GGC+G +Y            D LIE  G
Sbjct: 3   VTLTESAAKEIQRIISEQQMSESTLVRVGIAGGGCSGFKYNFGFEEAADPVNDHLIEYHG 62

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           VKV ID  S LY+ GT IDF +     GFVF NPN V +CGCG S  
Sbjct: 63  VKVAIDKKSALYLDGTTIDFYSGLDRRGFVFENPNAVKSCGCGSSFS 109


>gi|149177048|ref|ZP_01855656.1| hypothetical protein PM8797T_11941 [Planctomyces maris DSM 8797]
 gi|148844113|gb|EDL58468.1| hypothetical protein PM8797T_11941 [Planctomyces maris DSM 8797]
          Length = 110

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           VT+TE A   +K  + +    +   +RI +  GGC+G +Y    V D   + D+  E+ G
Sbjct: 3   VTITENASKELKRYMEDQNVAEGSHLRIGIVSGGCSGFQYDFRFVDDVDTEKDNTSEQHG 62

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +KV +D  S LY+ GT +D+       GF F NPN V +CGCG S  
Sbjct: 63  IKVVVDKKSDLYLDGTTLDYYESLEKRGFTFDNPNAVKSCGCGSSFS 109


>gi|91778665|ref|YP_553873.1| HesB/YadR/YfhF, Iron-sulphur cluster assembly protein IscA
           [Burkholderia xenovorans LB400]
 gi|91691325|gb|ABE34523.1| HesB/YadR/YfhF, Iron-sulfur cluster assembly protein IscA
           [Burkholderia xenovorans LB400]
          Length = 107

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 57/107 (53%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T AA   +++ +        G+R++++  GC+G  Y ++ V     +        GV
Sbjct: 3   ISLTPAAARHVEKSLRKRGS-GMGLRVAVRTSGCSGFAYALEFVDTANDEDQRFEA-HGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  SL  + GTE+DF  E L  GF FHNPN  + CGCG+S  +
Sbjct: 61  TVVVDPRSLTMLDGTELDFVREGLNEGFRFHNPNARANCGCGESFAV 107


>gi|85709820|ref|ZP_01040885.1| hypothetical protein NAP1_13083 [Erythrobacter sp. NAP1]
 gi|85688530|gb|EAQ28534.1| hypothetical protein NAP1_13083 [Erythrobacter sp. NAP1]
          Length = 109

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 55/111 (49%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  +T+T AA  R+  I       A  +R+S++ GGC+G +Y  DL      D      
Sbjct: 1   MSQTLTLTPAAAKRVAWIAEKQTKPAI-LRLSVEGGGCSGFQYKFDLADGADSDDAVSET 59

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            DGVK+ +D  SL  + G+ +DF      + F   NPN  + CGCG S  I
Sbjct: 60  -DGVKLVVDPVSLDLVDGSVVDFVESLGGAAFRVENPNAAAGCGCGSSFGI 109


>gi|93006482|ref|YP_580919.1| iron-sulfur cluster assembly protein IscA [Psychrobacter
           cryohalolentis K5]
 gi|92394160|gb|ABE75435.1| iron-sulfur cluster assembly protein IscA [Psychrobacter
           cryohalolentis K5]
          Length = 106

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ MTE A   ++E + +++GK +GIR+ ++  GC+GL Y+++ V     +        G
Sbjct: 1   MIEMTERAAQHVREFL-DNRGKGEGIRVGIRTAGCSGLAYVLEFVDTPDENDTRYESL-G 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V ++ID  SL+Y+ G  +D++ E L  GF F NPNQ   CGCG+S  +
Sbjct: 59  VSIFIDPKSLVYLDGLLMDYEKEGLNEGFKFSNPNQKGECGCGESFTV 106


>gi|319898839|ref|YP_004158932.1| hypothetical protein BARCL_0673 [Bartonella clarridgeiae 73]
 gi|319402803|emb|CBI76354.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 107

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +++ A  +I +I+    GK   +RIS++ GGC+G  Y  DLV     + D +I+KDG 
Sbjct: 3   VNISDFAAKQIAKILAGQPGK-IALRISVEGGGCSGFSYKYDLV-SENKEDDFIIKKDGA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V+IDS SL +M G EIDF  + +   F  HNPN  S+CGCG S  I
Sbjct: 61  VVFIDSISLPFMEGAEIDFVDDLMGQSFQIHNPNARSSCGCGVSFSI 107


>gi|316933985|ref|YP_004108967.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris DX-1]
 gi|315601699|gb|ADU44234.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas
           palustris DX-1]
          Length = 110

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E A  RI EI+     +   +RIS++ GGC+G +Y  D V     D D +I +DG 
Sbjct: 6   VTISERAARRIGEILKGEG-QGAMLRISVEGGGCSGFQYKFD-VDRTKTDDDLVIARDGA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +DSAS+ ++ G+E+DF  + + + F  +NPN  ++CGCG S  I
Sbjct: 64  VVLVDSASVPFLAGSEVDFIDDLIGASFRVNNPNASASCGCGTSFSI 110


>gi|16126252|ref|NP_420816.1| HesB/YadR/YfhF family protein [Caulobacter crescentus CB15]
 gi|221235025|ref|YP_002517461.1| HesB protein family [Caulobacter crescentus NA1000]
 gi|13423480|gb|AAK23984.1| HesB/YadR/YfhF family protein [Caulobacter crescentus CB15]
 gi|220964197|gb|ACL95553.1| HesB protein family [Caulobacter crescentus NA1000]
          Length = 110

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/112 (40%), Positives = 65/112 (58%), Gaps = 3/112 (2%)

Query: 1   MSDI-VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI 59
           M+ I +T++E A  RIK I   ++G+A  +R+++  GGC+G +Y  DLV     D D  +
Sbjct: 1   MTQIDLTLSENAARRIKAI-GEAEGRALMLRVAVDGGGCSGFQYRFDLVDSV-EDDDLKV 58

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           E+DG    +D  SL  + G+EIDF  E   + F   NPN  S+CGCG S  I
Sbjct: 59  ERDGAAALVDVVSLALLKGSEIDFVDELAGAEFRIRNPNAKSSCGCGVSFSI 110


>gi|71280094|ref|YP_267877.1| iron-sulfur cluster assembly protein [Colwellia psychrerythraea
           34H]
 gi|71145834|gb|AAZ26307.1| iron-sulfur cluster assembly protein [Colwellia psychrerythraea
           34H]
          Length = 107

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMT AA  R++  +  ++GK  G+R+ +K  GC+GL Y+++ V D   D      KD V
Sbjct: 3   VTMTPAAAERVQSFM-QNRGKGLGLRLGIKTTGCSGLAYVLEFVDDLNEDDQLFNIKD-V 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + ID+ SL+Y+ G E+DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  NIIIDAKSLVYLDGIELDFTKEGLNEGFKFTNPNAKGECGCGESFNV 107


>gi|322795676|gb|EFZ18355.1| hypothetical protein SINV_04847 [Solenopsis invicta]
          Length = 130

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV +IKEI+ +   +  G+++ +++ GC GL Y +D   +     +++I +DGV
Sbjct: 26  LTLTPIAVKKIKEILKDK-SEYIGLKVGVRQRGCNGLSYTLDYAKEKSKLDEEVI-QDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +++ID  + L +LGTE+D+   KL S F+F+NPN    CGCG+S  +
Sbjct: 84  RIFIDRKAQLSLLGTEMDYTENKLSSEFIFNNPNIKGTCGCGESFSV 130


>gi|198283351|ref|YP_002219672.1| iron-sulfur cluster assembly accessory protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218667051|ref|YP_002425937.1| iron-sulfur cluster assembly accessory protein [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198247872|gb|ACH83465.1| iron-sulfur cluster assembly accessory protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218519264|gb|ACK79850.1| iron-sulfur cluster assembly accessory protein [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 122

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 59/111 (53%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A+  +K ++     +A G+R+++  GGC+G +Y + L  +   +   +   +G
Sbjct: 1   MLILTEKAIDVVKNLLA-ENPEASGLRVAVTGGGCSGYQYGMGLEAEAGAEDTVVAI-EG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
           V V++D+AS   + G  ID+  E   SGF F NPN    CGCG S      
Sbjct: 59  VPVYVDNASATLLNGVVIDYVDELSGSGFRFENPNATGTCGCGSSFTTGDE 109


>gi|297182044|gb|ADI18218.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF0200_40H22]
          Length = 112

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T++A+ ++  ++          R+ ++ GGC+G +Y          DGD   ++ GV
Sbjct: 7   LQLTDSAISQLNTLIATKDNPELRFRVYVQGGGCSGFQYGFQFEEAG-ADGDMEFDRGGV 65

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y+ G E+DF  + + + FV +NPN  + CGCG S  I
Sbjct: 66  KLVVDPLSLQYLSGAEVDFIDDLMGTRFVVNNPNASTTCGCGASFGI 112


>gi|319794402|ref|YP_004156042.1| iron-sulfur cluster assembly protein isca [Variovorax paradoxus
           EPS]
 gi|315596865|gb|ADU37931.1| iron-sulfur cluster assembly protein IscA [Variovorax paradoxus
           EPS]
          Length = 107

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TEAA   +   +   +GK  G+R+ +K  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   VTLTEAAARHVTRYL-GKRGKGVGVRLGVKTTGCSGLAYKLEYV-DEFTPEDVVFEDHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GT++DF  E L  GF F NPN+   CGCG+S  I
Sbjct: 61  KVLVDPKSLAYIDGTQLDFVREGLNEGFKFINPNERDRCGCGESFRI 107


>gi|197105432|ref|YP_002130809.1| HesB/YadR/YfhF family protein [Phenylobacterium zucineum HLK1]
 gi|196478852|gb|ACG78380.1| HesB/YadR/YfhF family protein [Phenylobacterium zucineum HLK1]
          Length = 111

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++ AA  RI+ +          +R++++ GGC+G +Y  DLV     D   +   DG 
Sbjct: 7   VTLSPAAAERIRALGEAEGRP-VMLRVAVEGGGCSGFQYQFDLVDQPQADDLKVER-DGA 64

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
              +D  SL  + G+EIDF  E   + F   NPN  S+CGCG S  I
Sbjct: 65  AALVDVVSLALLKGSEIDFVDELAGAEFRIRNPNARSSCGCGVSFSI 111


>gi|189183478|ref|YP_001937263.1| HesB protein [Orientia tsutsugamushi str. Ikeda]
 gi|189180249|dbj|BAG40029.1| HesB protein [Orientia tsutsugamushi str. Ikeda]
          Length = 124

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 64/107 (59%), Gaps = 1/107 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T++  A  RIKE++   +  + GI++ +K GGC+G  Y ++       D D++I  
Sbjct: 16  KQVITISSRAAKRIKELLAKREKPSLGIKVGIKTGGCSGYSYYIEYADVK-GDFDEVIID 74

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            GV V +D  ++LY++GT +D+   K  SGF F NPN+   CGCG+S
Sbjct: 75  KGVTVLVDQKAILYLVGTTMDYIEGKFNSGFEFSNPNEKHRCGCGKS 121


>gi|57335909|emb|CAH25356.1| hypothetical protein [Guillardia theta]
          Length = 211

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 63/107 (58%), Gaps = 1/107 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLI-EKD 62
           I+ +T+ A+ +I+++  N   +   +R+ ++ GGC+G+ Y+++      VD  D   + +
Sbjct: 103 IIRLTQPAISQIQKLRTNRGEQEVVLRVGVRAGGCSGMSYVMEFEDAKNVDESDTELKFE 162

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           G +V +D  SL+++ G E+D+    +  GF F NPN  S CGCGQS 
Sbjct: 163 GFRVVVDPKSLMFIFGMELDYSDALIGGGFKFSNPNAASTCGCGQSF 209


>gi|319784068|ref|YP_004143544.1| FeS assembly scaffold SufA [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169956|gb|ADV13494.1| FeS assembly scaffold SufA [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 126

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 59/113 (52%), Positives = 78/113 (69%), Gaps = 2/113 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++TMTE A  R++EIV      A GIR+ +KKGGCAG+EY VDLVT+     D +   DG
Sbjct: 6   VITMTEKAADRVREIVATRDN-AHGIRLGIKKGGCAGMEYTVDLVTEPNTKDDHIER-DG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
             V++   + L++ GTE+DF+   L +GF FHNPNQ SACGCG+SVE+K ADL
Sbjct: 64  AHVYVAPEAALFLFGTEMDFEQTTLRTGFTFHNPNQSSACGCGESVELKPADL 116


>gi|90415205|ref|ZP_01223139.1| hypothetical protein GB2207_07816 [marine gamma proteobacterium
           HTCC2207]
 gi|90332528|gb|EAS47698.1| hypothetical protein GB2207_07816 [marine gamma proteobacterium
           HTCC2207]
          Length = 117

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +TE AV ++  +          +R+ +  GGC+G +Y      D   + D  + +DGV
Sbjct: 12  LNITEQAVTKVDALKVEEGNDDLKLRVYVTGGGCSGFQYGFSFE-DVMAEDDTAVTRDGV 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V IDS S  Y++G+ +D++   + S F+  NPN  + CGCG S  I
Sbjct: 71  TVLIDSLSYQYLVGSTVDYEVGLMGSRFLITNPNASTTCGCGASFSI 117


>gi|313675675|ref|YP_004053671.1| iron-sulfur cluster assembly accessory protein [Marivirga tractuosa
           DSM 4126]
 gi|312942373|gb|ADR21563.1| iron-sulfur cluster assembly accessory protein [Marivirga tractuosa
           DSM 4126]
          Length = 108

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 62/109 (56%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQG-KAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++ +T+ A  R+ ++       +   +R+S+K GGC+GL Y +    +   DGD++ E  
Sbjct: 1   MIIVTDKAKDRLGKLRSEEGHAENSNVRVSVKGGGCSGLMYDLSFD-EEVKDGDEIFEDK 59

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVK+ +D  S+LY+LGT +DF       GF F NPN    CGCG+S  I
Sbjct: 60  GVKLLVDKKSMLYLLGTTLDFSDGLNGKGFQFINPNATRTCGCGESFSI 108


>gi|317130095|ref|YP_004096377.1| iron-sulfur cluster assembly accessory protein [Bacillus
           cellulosilyticus DSM 2522]
 gi|315475043|gb|ADU31646.1| iron-sulfur cluster assembly accessory protein [Bacillus
           cellulosilyticus DSM 2522]
          Length = 117

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 62/106 (58%), Gaps = 2/106 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TEAA  +IK ++   +G+A+ +R+ +K GGC+GL Y +        D D+   K G
Sbjct: 2   MINITEAAASQIKTMM-EEEGEAKYLRVGVKGGGCSGLSYGMGFE-TEVTDKDETFVKHG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           ++V +D+ S   +   +ID+K   +  GF   NPN +++CGCG S 
Sbjct: 60  IQVVVDNESAPMLKDVQIDYKQNMMGGGFTIDNPNAIASCGCGSSF 105


>gi|239815135|ref|YP_002944045.1| iron-sulfur cluster assembly protein IscA [Variovorax paradoxus
           S110]
 gi|239801712|gb|ACS18779.1| iron-sulfur cluster assembly protein IscA [Variovorax paradoxus
           S110]
          Length = 107

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TEAA   +   +   +GK  G+R+ +K  GC+GL Y ++ V D     D + E  GV
Sbjct: 3   VTLTEAAARHVTRYL-GKRGKGVGVRLGVKTTGCSGLAYKLEYV-DEFAPEDVVFEDHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GT++DF  E L  GF F NPN+   CGCG+S  I
Sbjct: 61  KVLVDPKSLAYIDGTQLDFVREGLNEGFKFINPNERDRCGCGESFRI 107


>gi|255727102|ref|XP_002548477.1| hypothetical protein CTRG_02774 [Candida tropicalis MYA-3404]
 gi|240134401|gb|EER33956.1| hypothetical protein CTRG_02774 [Candida tropicalis MYA-3404]
          Length = 269

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 70/110 (63%), Gaps = 3/110 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T++  AV  ++ ++  +Q + + IRI ++  GC+GL Y ++ V       D+L+E+
Sbjct: 163 KALITLSPTAVEHLRALL--NQPEPKLIRIGVRNRGCSGLTYNLEYVDKPGK-FDELVEQ 219

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGVKV IDS +L  ++G+E+D+  +KL S F+F NPN    CGCG+S  +
Sbjct: 220 DGVKVLIDSKALFSIVGSEMDWLDDKLSSKFIFKNPNSKGTCGCGESFMV 269


>gi|226498924|ref|NP_001149674.1| iron-sulfur assembly protein IscA [Zea mays]
 gi|195629336|gb|ACG36309.1| iron-sulfur assembly protein IscA [Zea mays]
          Length = 188

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 59/107 (55%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKDG 63
           +++TE A+  + + +   + +   +RI +K+GGC+G+ Y ++         DD ++E DG
Sbjct: 69  ISLTEKALKHLNK-MRAERNEDLCLRIGVKQGGCSGMSYTMEFENRADASPDDSVVEYDG 127

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             +  D  SLL+M G E+D+    +  GF F NPN    CGCG+S  
Sbjct: 128 FAIVCDPKSLLFMFGMELDYSNALIGGGFSFQNPNATKTCGCGKSFA 174


>gi|71907581|ref|YP_285168.1| HesB/YadR/YfhF:Iron-sulphur cluster assembly protein IscA
           [Dechloromonas aromatica RCB]
 gi|71847202|gb|AAZ46698.1| HesB/YadR/YfhF:Iron-sulfur cluster assembly protein IscA
           [Dechloromonas aromatica RCB]
          Length = 107

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+++ A   +   +   +GK  G+R+ ++  GC+G+ Y ++ V +     D + E++GV
Sbjct: 3   VTLSDKAAQHVANFLTK-RGKGIGLRLGVRTSGCSGMAYKLEFVDEV-NPDDLVFEQNGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D+ SL Y+ G E+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIVDAKSLPYLDGMELDFAREGLNEGFKFNNPNVKDQCGCGESFNV 107


>gi|260950671|ref|XP_002619632.1| hypothetical protein CLUG_00791 [Clavispora lusitaniae ATCC 42720]
 gi|238847204|gb|EEQ36668.1| hypothetical protein CLUG_00791 [Clavispora lusitaniae ATCC 42720]
          Length = 266

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 67/110 (60%), Gaps = 3/110 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T++  AV  ++ ++     +   IRI ++  GC+GL Y ++ V       D+L+E+
Sbjct: 160 KALITLSPGAVEHLRALLDQPNPQ--LIRIGVRNRGCSGLTYHLEYVDKPGK-FDELVEQ 216

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGV+V IDS +L  ++G+E+D+  +KL S F+F NPN    CGCG+S  +
Sbjct: 217 DGVQVLIDSKALFSIVGSEMDWIDDKLSSRFIFKNPNSKGTCGCGESFMV 266


>gi|71066034|ref|YP_264761.1| HesB/YadR/YfhF family protein [Psychrobacter arcticus 273-4]
 gi|71039019|gb|AAZ19327.1| possible HesB/YadR/YfhF family protein [Psychrobacter arcticus
           273-4]
          Length = 106

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ MTE A   ++E + +++GK +GIR+ ++  GC+GL Y+++ V     +        G
Sbjct: 1   MIEMTERAAQHVREFL-DNRGKGEGIRVGIRTAGCSGLAYVLEFVDIPDENDTRYESL-G 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V ++ID  SL+Y+ G  +D++ E L  GF F NPNQ   CGCG+S  +
Sbjct: 59  VSIFIDPKSLVYLDGLLMDYEKEGLNEGFKFSNPNQKGECGCGESFTV 106


>gi|297180968|gb|ADI17171.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF0070_08D07]
          Length = 109

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 55/111 (49%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M++I+ +T+AAV +   I  N       +R+ +  GGC G  Y   +  +   D   L  
Sbjct: 1   MTNII-VTDAAVSKFLSITENDSESELNLRVFVTGGGCNGFSYGFTVDNEVCPDDTLLQ- 58

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           + G+ + +DS S  Y+ G ++D+  +   S F   NPN  S CGCG S  I
Sbjct: 59  QGGINLVVDSMSFPYLAGAKVDYSEDLNGSRFYVDNPNASSTCGCGNSFSI 109


>gi|148653429|ref|YP_001280522.1| iron-sulfur cluster assembly protein IscA [Psychrobacter sp.
           PRwf-1]
 gi|148572513|gb|ABQ94572.1| iron-sulfur cluster assembly protein IscA [Psychrobacter sp.
           PRwf-1]
          Length = 106

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   +K+ + N     +GIR++++  GC+GL Y+++ V D     +     +G
Sbjct: 1   MIELTERAAKHVKDYLDNRGH-GEGIRVAIRTAGCSGLAYVLEFVDDPDSSDEKFE-SNG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V +++D  S++Y+ G  +D+ TE L  GF F NPNQ   CGCG+S  +
Sbjct: 59  VNIFVDPKSMVYLDGLLMDYVTEGLNEGFKFTNPNQKGECGCGESFTV 106


>gi|220908295|ref|YP_002483606.1| iron-sulfur cluster assembly accessory protein [Cyanothece sp. PCC
           7425]
 gi|219864906|gb|ACL45245.1| iron-sulfur cluster assembly accessory protein [Cyanothece sp. PCC
           7425]
          Length = 117

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDL-VTDNPVDGDDLIEKDG 63
           + MT+AA+  + E+          +R+ ++ GGC+G+ Y +D     N    D++ + DG
Sbjct: 11  IMMTDAALKHVLELREKQGQD-LCLRVGVRGGGCSGMSYTMDFEDPANIRPEDEVCDYDG 69

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            KV  D  S+LY+ G  +D+    +  GF F NPN    CGCG S  
Sbjct: 70  FKVVSDPKSMLYIYGLVLDYSNALIGGGFKFTNPNATQTCGCGTSFS 116


>gi|88797571|ref|ZP_01113160.1| hypothetical protein MED297_10476 [Reinekea sp. MED297]
 gi|88779743|gb|EAR10929.1| hypothetical protein MED297_10476 [Reinekea sp. MED297]
          Length = 114

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 1/108 (0%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           D + +T AAV +++++V         +R+ +  GGCAG +Y      + P + D LI+K+
Sbjct: 7   DPLNITPAAVAKVQDLVREEDNPELMLRVFVTGGGCAGFQYGFTFD-EEPAEDDTLIDKN 65

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           G++  IDS S+ Y+ G+ +D+      S F+  NP+  + CGCG S  
Sbjct: 66  GIRFVIDSLSVQYLGGSTVDYTEGLEGSKFIIENPSAETTCGCGSSFS 113


>gi|330446682|ref|ZP_08310334.1| iron-sulfur cluster assembly protein IscA [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328490873|dbj|GAA04831.1| iron-sulfur cluster assembly protein IscA [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 107

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA  R+   +  S+GK  G+R+ ++  GC+G+ Y+++ V +         EK GV
Sbjct: 3   ITITEAAASRVSTFLA-SRGKGLGLRLGVRTSGCSGMAYILEFVDELDEGDQVFEEK-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D+ SL+Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIVDAKSLVYLEGTELDFAKEGLNEGFKFNNPNVSSECGCGESFNV 107


>gi|127513243|ref|YP_001094440.1| iron-sulfur cluster assembly protein IscA [Shewanella loihica PV-4]
 gi|126638538|gb|ABO24181.1| iron-sulfur cluster assembly protein IscA [Shewanella loihica PV-4]
          Length = 107

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT AA  R++  + N +GK  G+R+ LK  GC+G+ Y+++ V +   D +     DGV
Sbjct: 3   ITMTPAAADRVRSFLAN-RGKGIGLRLGLKTSGCSGMAYVLEFVDELNDDDEVYEI-DGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID+ S +Y+ G E+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIIDAKSFIYLQGIELDFVKEGLNEGFQFNNPNAKGECGCGESFTV 107


>gi|148273024|ref|YP_001222585.1| hypothetical protein CMM_1843 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147830954|emb|CAN01899.1| conserved hypothetical protein [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 120

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 33/104 (31%), Positives = 57/104 (54%), Gaps = 1/104 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T+ A  ++K ++     +   +R++++ GGC+GL Y +    +  +DGD  ++ DGV+V
Sbjct: 18  LTDTAASKVKSLLQQEGREDLRLRVAVQPGGCSGLIYQLYFD-ERELDGDATVDFDGVEV 76

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            +D  S+ Y+ G  IDF+      GF   NPN   +C CG S  
Sbjct: 77  IVDKMSVPYLDGATIDFEDTIQKQGFTIDNPNAGGSCACGDSFH 120


>gi|326480948|gb|EGE04958.1| hypothetical protein TEQG_08677 [Trichophyton equinum CBS 127.97]
          Length = 252

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T  A+ +++++V       + IRI +K  GC+GL Y ++ V + P   D+++E+DGV
Sbjct: 149 VSLTPTALSKLRDLVSQ--PDPKLIRIGVKNRGCSGLSYHLEYV-EKPAPFDEVVEQDGV 205

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS +L  ++G+E+D+  + L S FVF+NPN    CGCG+S  +
Sbjct: 206 KVLIDSKALFSIIGSEMDWHEDPLSSRFVFNNPNIKDECGCGESFMV 252


>gi|302498837|ref|XP_003011415.1| hypothetical protein ARB_02265 [Arthroderma benhamiae CBS 112371]
 gi|291174966|gb|EFE30775.1| hypothetical protein ARB_02265 [Arthroderma benhamiae CBS 112371]
          Length = 251

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T  A+ +++++V       + IRI +K  GC+GL Y ++ V + P   D+++E+DGV
Sbjct: 148 VSLTPTALSKLRDLVSQ--PDPKLIRIGVKNRGCSGLSYHLEYV-EKPAPFDEVVEQDGV 204

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS +L  ++G+E+D+  + L S FVF+NPN    CGCG+S  +
Sbjct: 205 KVLIDSKALFSIIGSEMDWHEDPLSSRFVFNNPNIKDECGCGESFMV 251


>gi|296808263|ref|XP_002844470.1| iron sulfur assembly protein 1 [Arthroderma otae CBS 113480]
 gi|238843953|gb|EEQ33615.1| iron sulfur assembly protein 1 [Arthroderma otae CBS 113480]
          Length = 254

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T  A+ +++++V       + IRI +K  GC+GL Y ++ V + P   D+++E+DGV
Sbjct: 151 VSLTPTALSKLRDLVSQ--PDPKLIRIGVKNRGCSGLSYHLEYV-EKPAPFDEVVEQDGV 207

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS +L  ++G+E+D+  + L S FVF+NPN    CGCG+S  +
Sbjct: 208 KVLIDSKALFSIIGSEMDWHEDPLSSRFVFNNPNIKDECGCGESFMV 254


>gi|225849948|ref|YP_002730182.1| iron-sulfur cluster assembly accessory protein [Persephonella
           marina EX-H1]
 gi|225645906|gb|ACO04092.1| iron-sulfur cluster assembly accessory protein [Persephonella
           marina EX-H1]
          Length = 113

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 54/105 (51%)

Query: 6   TMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVK 65
           T+TE A   IK+I      +   +R+ +  GGC+G +Y +    +   +   +  ++GVK
Sbjct: 8   TVTETAANEIKKIADEQGIENPILRVRVVPGGCSGFQYAMGFDEEITENDKVVELENGVK 67

Query: 66  VWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           + ID  S  Y+ G  +D+  + +  GF   NPN  ++CGCG S  
Sbjct: 68  IAIDEFSAPYIGGAVLDYVQDFMGGGFTIKNPNAANSCGCGNSFS 112


>gi|296135541|ref|YP_003642783.1| iron-sulfur cluster assembly protein IscA [Thiomonas intermedia
           K12]
 gi|294339670|emb|CAZ88030.1| Iron-binding protein iscA (Iron-sulfur cluster assembly protein)
           [Thiomonas sp. 3As]
 gi|295795663|gb|ADG30453.1| iron-sulfur cluster assembly protein IscA [Thiomonas intermedia
           K12]
          Length = 107

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 61/111 (54%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  VT+TE A  +++  +        G+R+ +K  GC+G+ Y ++ V     +      
Sbjct: 1   MS--VTLTERAAEQVQRHLAKRGA-GLGVRLGIKTTGCSGMAYKLEFVDQASEEDQVFD- 56

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             GVK+ +D  SL Y+ GTE+DF  + L  GF F+NPN+   CGCG+S  +
Sbjct: 57  SHGVKILVDPKSLAYVDGTELDFVRQGLNEGFQFNNPNEKDRCGCGESFRV 107


>gi|114600081|ref|XP_001134901.1| PREDICTED: similar to GK004 isoform 2 [Pan troglodytes]
          Length = 163

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 67/108 (62%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV  IK+++ +   +  G+++ ++  GC GL Y ++          + I +DGV
Sbjct: 25  LTLTPSAVNTIKQLLKDK-PEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDKEFI-QDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK 112
           +V+I+  + L +LGTE+D+  +KL S FVF+NPN    CGCG+S  I+
Sbjct: 83  RVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNIR 130


>gi|289677958|ref|ZP_06498848.1| iron-sulfur cluster assembly protein IscA [Pseudomonas syringae pv.
           syringae FF5]
          Length = 109

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   ++  +   +GK  G+R+ ++  GC+GL Y+++ V +     D + E  GV
Sbjct: 5   ISMTEAAANHVRRSLEG-RGKGDGVRLGVRTTGCSGLAYVLEFVDEA-ASEDTVFELHGV 62

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 63  KVIIDPKSLVYLDGTELDFVREGLNEGFKFNNPNSRGECGCGESFNV 109


>gi|115466390|ref|NP_001056794.1| Os06g0146400 [Oryza sativa Japonica Group]
 gi|55297134|dbj|BAD68777.1| hesB-like domain-containing protein-like [Oryza sativa Japonica
           Group]
 gi|113594834|dbj|BAF18708.1| Os06g0146400 [Oryza sativa Japonica Group]
 gi|125554058|gb|EAY99663.1| hypothetical protein OsI_21642 [Oryza sativa Indica Group]
 gi|125596046|gb|EAZ35826.1| hypothetical protein OsJ_20119 [Oryza sativa Japonica Group]
 gi|215678575|dbj|BAG92230.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 186

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKDG 63
           +++TE A+  + + +   + +   +RI +++GGC+G+ Y ++    +    DD ++E DG
Sbjct: 67  ISLTEKALKHLNK-MRAERNEDLCLRIGVRQGGCSGMSYTMEFEDRSNASPDDSVVEYDG 125

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             +  D  SLL+M G E+D+    +  GF F NPN    CGCG+S  
Sbjct: 126 FAIVCDPKSLLFMFGMELDYSDALIGGGFAFQNPNATKTCGCGKSFA 172


>gi|326492748|dbj|BAJ90230.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326513234|dbj|BAK06857.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 191

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 60/111 (54%), Gaps = 2/111 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTD-NPVDGDDLIEKDG 63
           +++TE A+  +   +   + +   +RI +K+GGC+G+ Y ++  +  +    D +IE +G
Sbjct: 72  ISLTEKALKHLNR-MRAEKNEDLCLRIGVKQGGCSGMSYTMEFESRGSANPDDSVIEYEG 130

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
             +  D  SLL+M G E+D+    +  GF F NPN    CGCG+S    + 
Sbjct: 131 FTIVCDPKSLLFMFGMELDYSDALIGGGFNFQNPNATKTCGCGKSFATSKE 181


>gi|321454597|gb|EFX65762.1| hypothetical protein DAPPUDRAFT_303520 [Daphnia pulex]
          Length = 130

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 62/105 (59%), Gaps = 2/105 (1%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T +AV ++K++         G++I +K+ GC G  Y +D         D+ + +DGV++
Sbjct: 28  LTPSAVNQVKKLFEGQ-NDYIGLKIGVKQRGCNGFSYTLDFA-SKKEKFDEEVLQDGVRI 85

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  + L++LGTE+D+   +L S FVF+NPN    CGCG+S  +
Sbjct: 86  LVDMKAQLHLLGTEMDYVENELSSEFVFNNPNIKGTCGCGESFSV 130


>gi|37523951|ref|NP_927328.1| hypothetical protein gll4382 [Gloeobacter violaceus PCC 7421]
 gi|35214957|dbj|BAC92323.1| gll4382 [Gloeobacter violaceus PCC 7421]
          Length = 124

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD-G 63
           + MTE+A+  +  +     G    +R+ +K GGC+GL Y +D   ++ V   D +    G
Sbjct: 18  IQMTESALAEVMRLRERRGGD-LMLRVGVKGGGCSGLSYTMDFEEESNVTAHDEVFDHSG 76

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            KV  D  SLL++ G  +D+  E L  GF F+NPN   +C CG S  
Sbjct: 77  FKVVSDKKSLLFLYGLVLDYSDELLGGGFKFNNPNAERSCSCGSSFS 123


>gi|226946076|ref|YP_002801149.1| Iron-sulfur biogenesis protein [Azotobacter vinelandii DJ]
 gi|2271523|gb|AAC24474.1| IscA [Azotobacter vinelandii]
 gi|226721003|gb|ACO80174.1| Iron-sulfur biogenesis protein [Azotobacter vinelandii DJ]
          Length = 107

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VTMTEAA   I+  + + +GK +GIR+ ++  GC+GL Y+++ V +     D + E  GV
Sbjct: 3   VTMTEAAARHIRRSL-DGRGKGEGIRLGVRTSGCSGLAYVLEFVDEV-ASEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  I
Sbjct: 61  KVIVDPKSLVYLDGTELDFVREGLNEGFKFNNPNVRGECGCGESFNI 107


>gi|297170377|gb|ADI21411.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF0010_21A16]
          Length = 115

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 1/110 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              + +++ A+ +IK ++         +R+ +  GGC+G +Y   L  +   +   +   
Sbjct: 7   PQELNVSDQAIAKIKNLLDEETKDNLSLRVFVTGGGCSGFQYGFKLDDELDSEDTTISSC 66

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            GV V IDS S+ Y+ G+ +D+  +   S F+  NPN ++ CGCG S  I
Sbjct: 67  -GVSVVIDSLSMQYIYGSTLDYTEDLEGSKFIIDNPNALTTCGCGSSFSI 115


>gi|195611042|gb|ACG27351.1| iron-sulfur assembly protein IscA [Zea mays]
 gi|195628228|gb|ACG35944.1| iron-sulfur assembly protein IscA [Zea mays]
 gi|195637160|gb|ACG38048.1| iron-sulfur assembly protein IscA [Zea mays]
          Length = 188

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 59/107 (55%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKDG 63
           +++TE A+  + + +   + +   +RI +K+GGC+G+ Y ++         DD ++E DG
Sbjct: 69  ISLTEKALKHLNK-MRAERNEDLCLRIGVKQGGCSGMSYTMEFENRADASPDDSVVEYDG 127

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             +  D  SLL+M G E+D+    +  GF F NPN    CGCG+S  
Sbjct: 128 FAIVCDPKSLLFMFGMELDYSNALIGGGFSFQNPNATKTCGCGKSFA 174


>gi|84496130|ref|ZP_00994984.1| hypothetical protein JNB_01385 [Janibacter sp. HTCC2649]
 gi|84382898|gb|EAP98779.1| hypothetical protein JNB_01385 [Janibacter sp. HTCC2649]
          Length = 129

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 57/106 (53%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T+ A  ++K ++     +   +R+ ++ GGC+GL Y +     + +DGD + + DGV
Sbjct: 25  VLLTDLAAGKVKSLLAQEGREDLRLRVGVQPGGCSGLIYQLYFDERS-LDGDLVRDFDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +V ID  S  Y++G  IDF       GF   NPN  S+C CG S  
Sbjct: 84  EVVIDRMSAPYLVGATIDFSDTIEKQGFTIDNPNAGSSCACGDSFS 129


>gi|332560380|ref|ZP_08414702.1| Iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides WS8N]
 gi|332278092|gb|EGJ23407.1| Iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides WS8N]
          Length = 118

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 48/114 (42%), Positives = 73/114 (64%), Gaps = 3/114 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              VT+T AA  +I  ++     K  G+RI +KKGGCAG+EY +D V  +    D+ +E+
Sbjct: 7   KQAVTLTPAAAKQIARLMQKQDSK--GLRIGVKKGGCAGMEYTMDYV-ADINPMDETVEQ 63

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           DG +V I   + +++ GTEID++T  + SGF F NPN V ACGCG+S++ + A+
Sbjct: 64  DGARVMIAPMAQMFLFGTEIDYETGLIESGFKFRNPNVVDACGCGESIKFREAE 117


>gi|297181535|gb|ADI17721.1| uncharacterized conserved protein [uncultured Oceanospirillales
           bacterium HF0130_25G24]
          Length = 125

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 29/108 (26%), Positives = 53/108 (49%), Gaps = 1/108 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I++ T++A  +++ ++         +R+ +  GGC+G +Y      D   D   +  K G
Sbjct: 19  ILSFTDSAADKVRSLISEEANDNLKLRVFVTGGGCSGFQYGFSFDEDIQEDDTVIKNK-G 77

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             + +DS S  Y++G ++D+      + FV  NP   + CGCG S  I
Sbjct: 78  ASLLVDSLSYQYLVGAKVDYLEGLEGARFVVDNPMAATTCGCGASFSI 125


>gi|329850336|ref|ZP_08265181.1| iron-sulfur cluster assembly accessory family protein
           [Asticcacaulis biprosthecum C19]
 gi|328840651|gb|EGF90222.1| iron-sulfur cluster assembly accessory family protein
           [Asticcacaulis biprosthecum C19]
          Length = 121

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 56/111 (50%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  +T+T +A   +  +   +      +R++++ GGC+G +Y++DL        D  I 
Sbjct: 13  MSHNITLTASAAKHLNHLSAEAGHP-VMLRVTVEGGGCSGFQYVLDLTDSA-APEDSQIT 70

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            DG    +D  S   M G+ ID+  E + S F   NP  V++CGCG S  +
Sbjct: 71  NDGATALVDDVSAPLMAGSMIDYVEELVGSQFKILNPLAVASCGCGTSFAL 121


>gi|256825447|ref|YP_003149407.1| Iron-sulfur cluster assembly accessory protein [Kytococcus
           sedentarius DSM 20547]
 gi|256688840|gb|ACV06642.1| Iron-sulfur cluster assembly accessory protein [Kytococcus
           sedentarius DSM 20547]
          Length = 119

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 53/106 (50%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T  A  ++K ++         +RI ++ GGC+GL Y +    +  +DGD   +  GV
Sbjct: 15  VTLTPVAAEKVKSLLDQEGRDDLRLRIGVQPGGCSGLIYQLYFD-ERTLDGDATRDFGGV 73

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +V +D  S  Y+ G  IDF       GF   NPN  S+C CG S  
Sbjct: 74  EVVVDRMSAPYLEGAAIDFADTIEKQGFTIDNPNAGSSCACGDSFS 119


>gi|170781784|ref|YP_001710116.1| putative DNA-binding protein [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|169156352|emb|CAQ01500.1| putative DNA-binding protein [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 120

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 33/104 (31%), Positives = 57/104 (54%), Gaps = 1/104 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T+ A  ++K ++     +   +R++++ GGC+GL Y +    +  +DGD  ++ DGV+V
Sbjct: 18  LTDTAASKVKSLLQQEGREDLRLRVAVQPGGCSGLIYQLYFD-ERELDGDATVDFDGVEV 76

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            +D  S+ Y+ G  IDF+      GF   NPN   +C CG S  
Sbjct: 77  IVDKMSVPYLDGATIDFEDTIQKQGFTIDNPNAGGSCACGDSFH 120


>gi|221066574|ref|ZP_03542679.1| iron-sulfur cluster assembly protein IscA [Comamonas testosteroni
           KF-1]
 gi|264678866|ref|YP_003278773.1| iron-sulfur cluster assembly protein IscA [Comamonas testosteroni
           CNB-2]
 gi|299532423|ref|ZP_07045815.1| iron-sulfur cluster assembly protein IscA [Comamonas testosteroni
           S44]
 gi|220711597|gb|EED66965.1| iron-sulfur cluster assembly protein IscA [Comamonas testosteroni
           KF-1]
 gi|262209379|gb|ACY33477.1| iron-sulfur cluster assembly protein IscA [Comamonas testosteroni
           CNB-2]
 gi|298719661|gb|EFI60626.1| iron-sulfur cluster assembly protein IscA [Comamonas testosteroni
           S44]
          Length = 107

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   +   + + +GK  G+R+ +K  GC+GL Y ++ V +   D        G+
Sbjct: 3   ISMTEAAARHVNRYL-SRRGKGIGVRLGVKTTGCSGLAYKLEYVDEVQPDDVVFE-DHGI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+DF  E L  GF FHNPN+   CGCG+S  I
Sbjct: 61  KVLIDPKSLAYIDGTELDFVREGLNEGFKFHNPNERDRCGCGESFRI 107


>gi|46138745|ref|XP_391063.1| hypothetical protein FG10887.1 [Gibberella zeae PH-1]
          Length = 239

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 67/107 (62%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T +AV +++E++   + K   I++ ++  GC+GL Y ++ V       D+ +E+DGV
Sbjct: 136 MKLTPSAVEQLRELLDQPEPK--LIKVGVRNRGCSGLAYHLEYVDKPGA-FDETVEQDGV 192

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS +L  ++G+E+D+  +KL   FVF NPN    CGCG+S  +
Sbjct: 193 KVLIDSKALFSIIGSEMDYVEDKLNQRFVFKNPNIKEECGCGESFMV 239


>gi|189218481|ref|YP_001939122.1| Fe-S cluster assembly scaffold protein [Methylacidiphilum
           infernorum V4]
 gi|189185339|gb|ACD82524.1| Fe-S cluster assembly scaffold protein [Methylacidiphilum
           infernorum V4]
          Length = 135

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V ++ +AV +I+ ++   +     +RI +  GGC+G +Y          +GD L EK GV
Sbjct: 24  VELSGSAVQKIRSLIEEEKDTELKLRIFITGGGCSGFQYNFAFD-KQIEEGDILYEKGGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            + ID  S +Y+ G+ ID++     + FV HNPN  S C CG S  
Sbjct: 83  WLVIDPQSHMYLKGSVIDYEENLEGARFVIHNPNAGSTCSCGSSFS 128


>gi|104780231|ref|YP_606729.1| iron-sulfur cluster assembly protein IscA [Pseudomonas entomophila
           L48]
 gi|95109218|emb|CAK13915.1| iron-sulfur cluster assembly protein IscA [Pseudomonas entomophila
           L48]
          Length = 107

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   I+  + + +GK +GIR+ ++  GC+GL Y+++ V +   +        GV
Sbjct: 3   ISMTEAAANHIRRSL-DGRGKGEGIRLGVRTTGCSGLAYVLEFVDELAEEDQVFEN-HGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFVKEGLNEGFKFNNPNVRGECGCGESFNV 107


>gi|91977267|ref|YP_569926.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisB5]
 gi|91683723|gb|ABE40025.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisB5]
          Length = 110

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 62/106 (58%), Gaps = 2/106 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E A  RI EI+         +RIS++ GGC+G +Y  D V     D D +I +DG 
Sbjct: 6   VTISERAARRIGEILKGEGN-GAMLRISVEGGGCSGFQYKFD-VDRAQTDDDLVIARDGA 63

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            V +DSAS+ ++ G+E+DF  + + + F  +NPN  S CGCG S  
Sbjct: 64  VVLVDSASVPFLAGSEVDFVDDLIGASFRVNNPNATSGCGCGTSFS 109


>gi|54297298|ref|YP_123667.1| iron-sulfur cluster insertion protein ErpA [Legionella pneumophila
           str. Paris]
 gi|81370652|sp|Q5X5H7|ERPA_LEGPA RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|53751083|emb|CAH12494.1| hypothetical protein lpp1343 [Legionella pneumophila str. Paris]
          Length = 130

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 50/117 (42%), Gaps = 5/117 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVD-----GDDLI 59
           +  + +A  ++ E++         +R+S+  GGC+G +Y          D          
Sbjct: 13  IHFSVSAADKVAELIKEEDNSNLNLRVSITGGGCSGFQYGFSFDEQINDDDTIIIQQCSD 72

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            K  VK+ IDS S  Y+   EID+        FV  NPN  + CGCG S  I   D+
Sbjct: 73  GKSSVKLLIDSMSYQYLHDAEIDYIKGIQGEQFVIRNPNAKTTCGCGSSFSIGDEDV 129


>gi|26987580|ref|NP_743005.1| iron-sulfur cluster assembly protein IscA [Pseudomonas putida
           KT2440]
 gi|148546118|ref|YP_001266220.1| iron-sulfur cluster assembly protein IscA [Pseudomonas putida F1]
 gi|167031902|ref|YP_001667133.1| iron-sulfur cluster assembly protein IscA [Pseudomonas putida GB-1]
 gi|325272146|ref|ZP_08138577.1| iron-sulfur cluster assembly protein IscA [Pseudomonas sp. TJI-51]
 gi|24982256|gb|AAN66469.1|AE016276_4 iron-binding protein IscA [Pseudomonas putida KT2440]
 gi|148510176|gb|ABQ77036.1| iron-sulfur cluster assembly protein IscA [Pseudomonas putida F1]
 gi|166858390|gb|ABY96797.1| iron-sulfur cluster assembly protein IscA [Pseudomonas putida GB-1]
 gi|313497213|gb|ADR58579.1| IscA [Pseudomonas putida BIRD-1]
 gi|324102709|gb|EGC00125.1| iron-sulfur cluster assembly protein IscA [Pseudomonas sp. TJI-51]
          Length = 107

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   I+  + + +GK +GIR+ ++  GC+GL Y+++ V +   D D + E  GV
Sbjct: 3   ISMTEAAANHIRRSL-DGRGKGEGIRLGVRTTGCSGLAYVLEFVDEL-ADEDQVFENHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFVKEGLNEGFKFNNPNVRGECGCGESFNV 107


>gi|297183414|gb|ADI19547.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF0770_27E13]
          Length = 116

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V  T+AA  ++  ++   +     +R+ +  GGCAG +Y      +      +++++ GV
Sbjct: 12  VIFTDAAAMKVGALLTEEENPDLNLRVYVTGGGCAGFQYGFSFDKNKDEGDTEVVKR-GV 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           ++ +D  S+ Y++G EIDF+ +   + FV  NPN  + C CG S  
Sbjct: 71  RLIVDPMSIQYLMGAEIDFQEDLQGARFVIKNPNAATTCSCGSSFS 116


>gi|299770355|ref|YP_003732381.1| iron-sulfur cluster assembly protein IscA [Acinetobacter sp. DR1]
 gi|298700443|gb|ADI91008.1| iron-sulfur cluster assembly protein IscA [Acinetobacter sp. DR1]
          Length = 106

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V       +   +  G
Sbjct: 1   MIHLTENAATHISNYLKN-RGKGEGIRVGVKTSGCSGLAYVLEFVDSVDEHDEVFEQF-G 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  S +Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSHVYLEGLEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|24642263|ref|NP_573062.1| lethal (1) G0136 [Drosophila melanogaster]
 gi|194894350|ref|XP_001978048.1| GG17904 [Drosophila erecta]
 gi|195355387|ref|XP_002044173.1| GM22570 [Drosophila sechellia]
 gi|195478946|ref|XP_002100707.1| GE17212 [Drosophila yakuba]
 gi|19528139|gb|AAL90184.1| AT26381p [Drosophila melanogaster]
 gi|22832286|gb|AAF48498.2| lethal (1) G0136 [Drosophila melanogaster]
 gi|190649697|gb|EDV46975.1| GG17904 [Drosophila erecta]
 gi|194129462|gb|EDW51505.1| GM22570 [Drosophila sechellia]
 gi|194188231|gb|EDX01815.1| GE17212 [Drosophila yakuba]
 gi|220958998|gb|ACL92042.1| l(1)G0136-PA [synthetic construct]
 gi|220960216|gb|ACL92644.1| l(1)G0136-PA [synthetic construct]
          Length = 130

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 67/106 (63%), Gaps = 2/106 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV RIK ++   +    G+++ +++ GC GL Y +D  +      ++++ +DGV
Sbjct: 26  LTLTPAAVLRIKTLL-QDKPDMVGLKVGVRQRGCNGLSYTLDYASQKDKLDEEVV-QDGV 83

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           KV+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  
Sbjct: 84  KVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFS 129


>gi|146420893|ref|XP_001486399.1| hypothetical protein PGUG_02070 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 264

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 71/110 (64%), Gaps = 3/110 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T++ +A+  +K ++   + K   IRI +K  GC+GL Y ++ V++     D+++E+
Sbjct: 158 KALITLSPSAIEHLKGLLDQPEPK--LIRIGVKNRGCSGLTYHLEYVSEPGK-FDEVVEQ 214

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGVKV IDS +L  ++G+E+++  +KL S F+F NPN    CGCG+S  +
Sbjct: 215 DGVKVVIDSKALFSIVGSEMEWLDDKLSSRFIFKNPNSKGTCGCGESFMV 264


>gi|83858474|ref|ZP_00951996.1| HesB/YadR/YfhF [Oceanicaulis alexandrii HTCC2633]
 gi|83853297|gb|EAP91149.1| HesB/YadR/YfhF [Oceanicaulis alexandrii HTCC2633]
          Length = 119

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 73/115 (63%), Gaps = 3/115 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              VT+TEAA  R+K+++         +R+ +K GGCAG+EY++D V +     + +   
Sbjct: 6   PKAVTLTEAAATRVKKLMA--DRDLGYLRVGVKNGGCAGMEYVMDYVAEPDPLDERVE-D 62

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            GV++ +D+ SLL++LG +ID++   L++ FVF NPN+  ACGCG+SV +  A +
Sbjct: 63  QGVEIVVDAKSLLFLLGAQIDYEVTPLHAKFVFRNPNETDACGCGESVTLVPAQV 117


>gi|195566952|ref|XP_002107039.1| GD17232 [Drosophila simulans]
 gi|194204436|gb|EDX18012.1| GD17232 [Drosophila simulans]
          Length = 125

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 67/106 (63%), Gaps = 2/106 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T AAV RIK ++   +    G+++ +++ GC GL Y +D  +      ++++ +DGV
Sbjct: 21  LTLTPAAVLRIKTLL-QDKPDMVGLKVGVRQRGCNGLSYTLDYASQKDKLDEEVV-QDGV 78

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           KV+ID  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  
Sbjct: 79  KVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFS 124


>gi|152978542|ref|YP_001344171.1| iron-sulfur cluster assembly protein IscA [Actinobacillus
           succinogenes 130Z]
 gi|150840265|gb|ABR74236.1| iron-sulfur cluster assembly protein IscA [Actinobacillus
           succinogenes 130Z]
          Length = 107

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++E A+ R++  +  ++G   G+R+ +K  GC+GL Y+++ V     D D + ++D V
Sbjct: 3   ITLSETALNRVRTFL-QNRGSGIGLRLGVKTSGCSGLAYVLEFVDQL-SDEDQIFQQDDV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL+Y+ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KIIVDKKSLVYLDGTQLDFVKEGLNEGFKFTNPNIKDQCGCGESFSV 107


>gi|121604472|ref|YP_981801.1| iron-sulfur cluster assembly protein IscA [Polaromonas
           naphthalenivorans CJ2]
 gi|120593441|gb|ABM36880.1| iron-sulfur cluster assembly protein IscA [Polaromonas
           naphthalenivorans CJ2]
          Length = 107

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++T AA   +++ +        G+R+++K  GC+G  Y ++ V D     D   E  G 
Sbjct: 3   ISLTPAAARHVEKSLAKRGS-GIGLRLAVKTSGCSGFAYALEFV-DAMTADDQAFETHGT 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ IDS SL  + GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  KIIIDSRSLAMLDGTELDFVREGLNEGFKFNNPNAKANCGCGESFAV 107


>gi|126461373|ref|YP_001042487.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221638359|ref|YP_002524621.1| Iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides KD131]
 gi|126103037|gb|ABN75715.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221159140|gb|ACM00120.1| Iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides KD131]
          Length = 118

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 48/114 (42%), Positives = 73/114 (64%), Gaps = 3/114 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              VT+T AA  +I  ++     K  G+RI +KKGGCAG+EY +D V  +    D+ +E+
Sbjct: 7   KQAVTLTPAAAKQIARLMQKQDSK--GLRIGVKKGGCAGMEYTMDYV-SDINPMDETVEQ 63

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           DG +V I   + +++ GTEID++T  + SGF F NPN V ACGCG+S++ + A+
Sbjct: 64  DGARVMIAPMAQMFLFGTEIDYETGLIESGFKFRNPNVVDACGCGESIKFREAE 117


>gi|329889576|ref|ZP_08267919.1| chain B, Crystal Structure Of Isca Native [Brevundimonas diminuta
           ATCC 11568]
 gi|328844877|gb|EGF94441.1| chain B, Crystal Structure Of Isca Native [Brevundimonas diminuta
           ATCC 11568]
          Length = 115

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 45/110 (40%), Positives = 71/110 (64%), Gaps = 1/110 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA  R++EI+ N++    G+R+ +K  GCAG EY      +     + + +K GV
Sbjct: 1   MTLTDAAAARVREIMDNAEKDYVGLRVGVKNSGCAGQEYTFAYAEEALPLDEVVEDK-GV 59

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            + I+  ++L+++GTEID++  KL S FVF NPN+  ACGCG+SV I  A
Sbjct: 60  TILIEPKAVLFLIGTEIDYEVTKLASKFVFRNPNETDACGCGESVTIIPA 109


>gi|298705983|emb|CBJ29104.1| iron-sulfur assembly protein [Ectocarpus siliculosus]
          Length = 175

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 64/113 (56%), Gaps = 2/113 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKA-QGIRISLKKGGCAGLEYMVDLVTDN-PVDGDDL 58
           M  IV +   A+  ++E+  +   +    +R+ ++ GGC+GL Y++DLV      + D +
Sbjct: 63  MEKIVNIRPKAMDHLQELRRSQGTEGDIFLRMGVRSGGCSGLSYIMDLVKKEEITEDDMV 122

Query: 59  IEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            E DG K  ID  S+LY+ G E+DF    +  GF F NPN  S+CGCG+S  +
Sbjct: 123 EEYDGFKCVIDPKSVLYLYGLELDFSDALIGGGFQFQNPNAESSCGCGKSFGV 175


>gi|91788053|ref|YP_549005.1| iron-sulfur cluster assembly protein IscA [Polaromonas sp. JS666]
 gi|91697278|gb|ABE44107.1| iron-sulfur cluster assembly protein IscA [Polaromonas sp. JS666]
          Length = 107

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 44/111 (39%), Positives = 65/111 (58%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  VT+T+AA   +   +   +GK  G+R+ +K  GC+GL Y ++   D     D + E
Sbjct: 1   MS--VTLTDAAARHVTRYMAK-RGKGVGVRLGVKTTGCSGLAYKLEYA-DEIAPEDVVFE 56

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +GVKV +D  S+ Y+ GT++DF  E L  GF F NPN+   CGCG+S  +
Sbjct: 57  DNGVKVLVDPKSMAYIDGTQLDFVREGLNEGFKFINPNERDRCGCGESFRV 107


>gi|225023265|ref|ZP_03712457.1| hypothetical protein EIKCOROL_00117 [Eikenella corrodens ATCC
           23834]
 gi|224943910|gb|EEG25119.1| hypothetical protein EIKCOROL_00117 [Eikenella corrodens ATCC
           23834]
          Length = 116

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 55/111 (49%), Gaps = 2/111 (1%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           SD +  TE+   ++ E++         +R+ +  GGC+G +Y      +   D D  IEK
Sbjct: 7   SDPIIFTESCCNKVAELIAEENNPDLKLRVFVNGGGCSGFQYGFTFD-EIVNDDDFQIEK 65

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFH-NPNQVSACGCGQSVEI 111
            G+   ID  S  Y+LG EID+      S FV   NPN V+ CGCG S  +
Sbjct: 66  SGLVFLIDPMSYQYLLGAEIDYTEGLQGSQFVIRSNPNAVTTCGCGSSFSV 116


>gi|302550869|ref|ZP_07303211.1| FeS assembly scaffold SufA [Streptomyces viridochromogenes DSM
           40736]
 gi|302468487|gb|EFL31580.1| FeS assembly scaffold SufA [Streptomyces viridochromogenes DSM
           40736]
          Length = 118

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 53/106 (50%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AA  ++K ++         +R++++ GGC+GL Y +     + +DGD   +  GV
Sbjct: 14  IILTDAAADKVKTLLDQEGRDDLALRVAVQPGGCSGLRYQLFFDERS-LDGDVEKDFGGV 72

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           KV  D  S  Y+ G  IDF       GF   NPN   +C CG S  
Sbjct: 73  KVVTDRMSAPYLGGATIDFVDTIEKQGFTIDNPNATGSCACGDSFS 118


>gi|77462496|ref|YP_352000.1| hypothetical protein RSP_1948 [Rhodobacter sphaeroides 2.4.1]
 gi|77386914|gb|ABA78099.1| Protein of unknown function, HesB/YadR/YfhF [Rhodobacter
           sphaeroides 2.4.1]
          Length = 118

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 48/114 (42%), Positives = 73/114 (64%), Gaps = 3/114 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              VT+T AA  +I  ++     K  G+RI +KKGGCAG+EY +D V  +    D+ +E+
Sbjct: 7   KQAVTLTPAAAKQIARLMQKQGSK--GLRIGVKKGGCAGMEYTMDYV-SDINPMDETVEQ 63

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           DG +V I   + +++ GTEID++T  + SGF F NPN V ACGCG+S++ + A+
Sbjct: 64  DGARVMIAPMAQMFLFGTEIDYETGLIESGFKFRNPNVVDACGCGESIKFREAE 117


>gi|238883113|gb|EEQ46751.1| hypothetical protein CAWG_05116 [Candida albicans WO-1]
          Length = 269

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 69/110 (62%), Gaps = 3/110 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T+T +AV  ++ ++   Q   + IRI ++  GC+GL Y ++ V       D+L+E+
Sbjct: 163 KALITLTSSAVQHLQGLL--DQPDPKLIRIGVRNRGCSGLTYNLEYVDKPGK-FDELVEQ 219

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGVKV IDS +L  ++G+E+D+  +KL S F+F NPN    CGCG+S  +
Sbjct: 220 DGVKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGESFMV 269


>gi|68473290|ref|XP_719203.1| hypothetical protein CaO19.12967 [Candida albicans SC5314]
 gi|68473523|ref|XP_719086.1| hypothetical protein CaO19.5521 [Candida albicans SC5314]
 gi|46440887|gb|EAL00188.1| hypothetical protein CaO19.5521 [Candida albicans SC5314]
 gi|46441010|gb|EAL00310.1| hypothetical protein CaO19.12967 [Candida albicans SC5314]
          Length = 269

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 69/110 (62%), Gaps = 3/110 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T+T +AV  ++ ++   Q   + IRI ++  GC+GL Y ++ V       D+L+E+
Sbjct: 163 KALITLTSSAVQHLQGLL--DQPDPKLIRIGVRNRGCSGLTYNLEYVDKPGK-FDELVEQ 219

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGVKV IDS +L  ++G+E+D+  +KL S F+F NPN    CGCG+S  +
Sbjct: 220 DGVKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGESFMV 269


>gi|330794256|ref|XP_003285196.1| hypothetical protein DICPUDRAFT_28921 [Dictyostelium purpureum]
 gi|325084917|gb|EGC38335.1| hypothetical protein DICPUDRAFT_28921 [Dictyostelium purpureum]
          Length = 138

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/113 (32%), Positives = 68/113 (60%), Gaps = 1/113 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKA-QGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
             I +MT++A+ R+KEI+ +++     G+R+ +K+ GC+G+ Y +D  T      + ++ 
Sbjct: 15  KAIFSMTDSAIKRVKEIMKDNKIDNCIGLRLGVKQRGCSGMSYTLDFATTKNKFDETVVA 74

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
              + + +DS +LL ++GTE+D+  E +   F+F NPN  + CGCG+S   K 
Sbjct: 75  DKDINIIVDSKALLSVIGTEMDYIEEPIKKEFIFINPNATNTCGCGESFSTKD 127


>gi|262278960|ref|ZP_06056745.1| iron-sulfur cluster assembly protein IscA [Acinetobacter
           calcoaceticus RUH2202]
 gi|262259311|gb|EEY78044.1| iron-sulfur cluster assembly protein IscA [Acinetobacter
           calcoaceticus RUH2202]
          Length = 106

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 62/108 (57%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   I   + N +GK +GIR+ +K  GC+GL Y+++ V           +  G
Sbjct: 1   MIHLTENAATHISNYLKN-RGKGEGIRVGVKTSGCSGLAYVLEFVDSIDEHDQVFEQF-G 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           VKV++D  S +Y+ G E+D+    L  GF F+NPN+   CGCG+S  +
Sbjct: 59  VKVFVDPKSSVYLEGLEMDYVKNGLNEGFEFNNPNKKGECGCGESFTV 106


>gi|170723495|ref|YP_001751183.1| iron-sulfur cluster assembly protein IscA [Pseudomonas putida W619]
 gi|169761498|gb|ACA74814.1| iron-sulfur cluster assembly protein IscA [Pseudomonas putida W619]
          Length = 107

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   ++  +   +GK +GIR+ ++  GC+GL Y+++ V +   D D + E  GV
Sbjct: 3   ISMTEAAANHVRRSLEG-RGKGEGIRLGVRTTGCSGLAYVLEFVDEL-ADEDTVFENHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFVKEGLNEGFKFNNPNVRGECGCGESFNV 107


>gi|314962408|gb|EFT06509.1| iron-sulfur cluster assembly accessory protein [Propionibacterium
           acnes HL082PA1]
          Length = 117

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 46/106 (43%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AA  ++K ++         +R++++ GGC+GL Y +     +           G 
Sbjct: 13  IILTDAAAAKVKSLLDQEGRDDLALRLAVQPGGCSGLRYQLFFDERHLEGDVVKTYGGG- 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            V  D  S  Y+ G  IDF       GF   NPN  S C CG S  
Sbjct: 72  DVVTDRMSAPYLAGATIDFMDTIEKQGFTIDNPNATSTCACGDSFH 117


>gi|190891946|ref|YP_001978488.1| hypothetical protein RHECIAT_CH0002356 [Rhizobium etli CIAT 652]
 gi|190697225|gb|ACE91310.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 130

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 58/113 (51%), Positives = 84/113 (74%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +++MT+ A  R+K IV N+  +A+G+R+ +KKGGCAG+EY +DLVT+     D +   DG
Sbjct: 5   VMSMTDGAAARVKAIVENAGPEAKGVRVGIKKGGCAGMEYTIDLVTEPNAKDDLIER-DG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            +VW++ +++LY+LGTE+ F+   L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  ARVWVEPSAVLYLLGTEMGFEQTTLRSGFTFTNPNQTSACGCGESVELKPADL 116


>gi|297171445|gb|ADI22446.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF0500_05P21]
          Length = 116

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 57/106 (53%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V  T+AA  ++  ++   +  +  +R+ +  GGCAG +Y      +      +++++ GV
Sbjct: 12  VIFTDAAAMKVGTLLTEEENPSLNLRVYVTGGGCAGFQYGFSFDENKDEGDTEVVKR-GV 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           ++ +D  S+ Y++G EIDF+ +   + FV  NPN  + C CG S  
Sbjct: 71  RLIVDPMSIQYLMGAEIDFQEDLQGARFVIKNPNASTTCSCGSSFS 116


>gi|218672061|ref|ZP_03521730.1| FeS assembly scaffold SufA [Rhizobium etli GR56]
          Length = 130

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 59/113 (52%), Positives = 84/113 (74%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +++MT+ A  R+K IV NS  +A+G+R+ +KKGGCAG+EY +DLVT+     D +   DG
Sbjct: 5   VMSMTDGAAARVKAIVENSGPEAKGVRVGIKKGGCAGMEYTIDLVTEPNAKDDLIER-DG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            +VW++ +++LY+LGTE+ F+   L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  ARVWVEPSAVLYLLGTEMGFEQTTLRSGFTFTNPNQTSACGCGESVELKPADL 116


>gi|209694308|ref|YP_002262236.1| iron-binding protein IscA (iron-sulfur cluster assembly protein)
           [Aliivibrio salmonicida LFI1238]
 gi|208008259|emb|CAQ78404.1| iron-binding protein IscA (iron-sulfur cluster assembly protein)
           [Aliivibrio salmonicida LFI1238]
          Length = 107

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TEAA  R++  + N +GK  G+R+ ++  GC+G+ Y+++ V D   + +   +  GV
Sbjct: 3   ISVTEAAASRVQTFLEN-RGKGIGLRLGVRTSGCSGMAYILEFVDDLNEEDEVFEKF-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID  SL YM GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIIDPKSLAYMDGTELDFAKEGLNEGFKFNNPNVKSECGCGESFNV 107


>gi|190345989|gb|EDK37972.2| hypothetical protein PGUG_02070 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 264

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 71/110 (64%), Gaps = 3/110 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T++ +A+  +K ++   + K   IRI +K  GC+GL Y ++ V++     D+++E+
Sbjct: 158 KALITLSPSAIEHLKGLLDQPEPK--LIRIGVKNRGCSGLTYHLEYVSEPGK-FDEVVEQ 214

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGVKV IDS +L  ++G+E+++  +KL S F+F NPN    CGCG+S  +
Sbjct: 215 DGVKVVIDSKALFSIVGSEMEWLDDKLSSRFIFKNPNSKGTCGCGESFMV 264


>gi|209549488|ref|YP_002281405.1| FeS assembly scaffold SufA [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209535244|gb|ACI55179.1| FeS assembly scaffold SufA [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 130

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 59/113 (52%), Positives = 84/113 (74%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +++MT+ A  R+K IV NS  +A+G+R+ +KKGGCAG+EY +DLVT+     D +   DG
Sbjct: 5   VMSMTDGAAARVKAIVENSGPEAKGVRVGIKKGGCAGMEYTIDLVTEPNAKDDLIER-DG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            +VW++ +++LY+LGTE+ F+   L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  ARVWVEPSAVLYLLGTEMGFEQTTLRSGFTFTNPNQTSACGCGESVELKPADL 116


>gi|332968737|gb|EGK07789.1| type I restriction-modification system [Desmospora sp. 8437]
          Length = 118

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 36/115 (31%), Positives = 63/115 (54%), Gaps = 3/115 (2%)

Query: 4   IVTMTEAAVYRIKEIVFNSQG-KAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           ++ ++E A ++IKE++   +  + Q +R+ +K GGC+G  Y +    +      +L   +
Sbjct: 1   MIELSERACHKIKEMLKEEENPEEQFLRVGVKGGGCSGFTYSMGFDENKSDKDTELDL-N 59

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV-EIKRADL 116
           G++V ID  S   + G +ID+K   +  GF  HNPN ++ CGCG S    K A +
Sbjct: 60  GIRVLIDRESEPLIRGLQIDYKESMMGGGFTIHNPNAIATCGCGTSFRTAKDAGV 114


>gi|146342271|ref|YP_001207319.1| Iron-binding protein IscA [Bradyrhizobium sp. ORS278]
 gi|146195077|emb|CAL79102.1| Iron-binding protein IscA (iron-sulfur cluster assembly protein)
           [Bradyrhizobium sp. ORS278]
          Length = 106

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +T++AV  ++  +  S     G+RI ++ GGCAGL+Y + LV       D +IE++G
Sbjct: 1   MINLTDSAVNAVRNAITTSDKPVDGLRIMVEAGGCAGLKYNMGLV-SGSEPEDTVIEREG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           V+V +D  SL Y+ GT IDF      SGF F NPN  S+CGCG+S  
Sbjct: 60  VRVLVDHKSLEYLEGTTIDFVVALEGSGFTFENPNAKSSCGCGKSFA 106


>gi|89072691|ref|ZP_01159256.1| Putative hesB family protein [Photobacterium sp. SKA34]
 gi|89051511|gb|EAR56965.1| Putative hesB family protein [Photobacterium sp. SKA34]
          Length = 107

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V +         EK GV
Sbjct: 3   ITITEAAAGRVSTFLAN-RGKGLGLRLGVRTSGCSGMAYILEFVDELDEGDQVFEEK-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL+Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIVDPKSLVYLEGTELDFAKEGLNEGFQFNNPNVSSECGCGESFNV 107


>gi|15640769|ref|NP_230399.1| hesB family protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|147674050|ref|YP_001216235.1| HesB/YadR/YfhF family protein [Vibrio cholerae O395]
 gi|153216256|ref|ZP_01950356.1| HesB/YadR/YfhF family protein [Vibrio cholerae 1587]
 gi|153800576|ref|ZP_01955162.1| HesB/YadR/YfhF family protein [Vibrio cholerae MZO-3]
 gi|153817291|ref|ZP_01969958.1| HesB/YadR/YfhF family protein [Vibrio cholerae NCTC 8457]
 gi|153822717|ref|ZP_01975384.1| HesB/YadR/YfhF family protein [Vibrio cholerae B33]
 gi|153824624|ref|ZP_01977291.1| HesB/YadR/YfhF family protein [Vibrio cholerae MZO-2]
 gi|153829407|ref|ZP_01982074.1| HesB/YadR/YfhF family protein [Vibrio cholerae 623-39]
 gi|227080929|ref|YP_002809480.1| hesB family protein [Vibrio cholerae M66-2]
 gi|229505636|ref|ZP_04395146.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae BX 330286]
 gi|229510692|ref|ZP_04400171.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae B33]
 gi|229513111|ref|ZP_04402577.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae TMA 21]
 gi|229517814|ref|ZP_04407258.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae RC9]
 gi|229523427|ref|ZP_04412834.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae TM 11079-80]
 gi|229530120|ref|ZP_04419510.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae 12129(1)]
 gi|229608654|ref|YP_002879302.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae MJ-1236]
 gi|254225015|ref|ZP_04918629.1| HesB/YadR/YfhF family protein [Vibrio cholerae V51]
 gi|254285468|ref|ZP_04960432.1| HesB/YadR/YfhF family protein [Vibrio cholerae AM-19226]
 gi|254847887|ref|ZP_05237237.1| HesB/YadR/YfhF family protein [Vibrio cholerae MO10]
 gi|258619949|ref|ZP_05714989.1| hesB family protein [Vibrio mimicus VM573]
 gi|258627180|ref|ZP_05721968.1| hesB family protein [Vibrio mimicus VM603]
 gi|261212150|ref|ZP_05926436.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           sp. RC341]
 gi|262161309|ref|ZP_06030420.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae INDRE 91/1]
 gi|262168802|ref|ZP_06036497.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae RC27]
 gi|262172179|ref|ZP_06039857.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           mimicus MB-451]
 gi|262190468|ref|ZP_06048719.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae CT 5369-93]
 gi|262402865|ref|ZP_06079426.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           sp. RC586]
 gi|297581149|ref|ZP_06943073.1| HesB/YadR/YfhF family protein [Vibrio cholerae RC385]
 gi|298499117|ref|ZP_07008924.1| iron-sulfur cluster assembly protein IscA [Vibrio cholerae MAK 757]
 gi|9655195|gb|AAF93915.1| hesB family protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|124114401|gb|EAY33221.1| HesB/YadR/YfhF family protein [Vibrio cholerae 1587]
 gi|124123865|gb|EAY42608.1| HesB/YadR/YfhF family protein [Vibrio cholerae MZO-3]
 gi|125622402|gb|EAZ50722.1| HesB/YadR/YfhF family protein [Vibrio cholerae V51]
 gi|126512207|gb|EAZ74801.1| HesB/YadR/YfhF family protein [Vibrio cholerae NCTC 8457]
 gi|126519748|gb|EAZ76971.1| HesB/YadR/YfhF family protein [Vibrio cholerae B33]
 gi|146315933|gb|ABQ20472.1| HesB/YadR/YfhF family protein [Vibrio cholerae O395]
 gi|148875127|gb|EDL73262.1| HesB/YadR/YfhF family protein [Vibrio cholerae 623-39]
 gi|149741842|gb|EDM55871.1| HesB/YadR/YfhF family protein [Vibrio cholerae MZO-2]
 gi|150424330|gb|EDN16267.1| HesB/YadR/YfhF family protein [Vibrio cholerae AM-19226]
 gi|227008817|gb|ACP05029.1| hesB family protein [Vibrio cholerae M66-2]
 gi|227012574|gb|ACP08784.1| hesB family protein [Vibrio cholerae O395]
 gi|229333894|gb|EEN99380.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae 12129(1)]
 gi|229339790|gb|EEO04805.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae TM 11079-80]
 gi|229344529|gb|EEO09503.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae RC9]
 gi|229350004|gb|EEO14958.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae TMA 21]
 gi|229350657|gb|EEO15598.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae B33]
 gi|229357859|gb|EEO22776.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae BX 330286]
 gi|229371309|gb|ACQ61732.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae MJ-1236]
 gi|254843592|gb|EET22006.1| HesB/YadR/YfhF family protein [Vibrio cholerae MO10]
 gi|258580482|gb|EEW05443.1| hesB family protein [Vibrio mimicus VM603]
 gi|258587682|gb|EEW12391.1| hesB family protein [Vibrio mimicus VM573]
 gi|260838758|gb|EEX65409.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           sp. RC341]
 gi|261893255|gb|EEY39241.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           mimicus MB-451]
 gi|262022920|gb|EEY41626.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae RC27]
 gi|262029059|gb|EEY47712.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae INDRE 91/1]
 gi|262033640|gb|EEY52129.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae CT 5369-93]
 gi|262351647|gb|EEZ00780.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           sp. RC586]
 gi|297534465|gb|EFH73302.1| HesB/YadR/YfhF family protein [Vibrio cholerae RC385]
 gi|297543450|gb|EFH79500.1| iron-sulfur cluster assembly protein IscA [Vibrio cholerae MAK 757]
 gi|327483536|gb|AEA77943.1| Iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae LMA3894-4]
          Length = 107

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E A  R+K  + +++GK  G+R+ +K  GC+G+ Y+++ V D   +        GV
Sbjct: 3   VTLSETAASRVKTFL-DNRGKGIGLRLGVKTTGCSGMAYVLEFVDDLNEEDHVFE-SHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID+ S++Y+ GT++D+K E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDTKSMVYLDGTQLDYKKEGLNEGFEFNNPNVKSECGCGESFNV 107


>gi|82701828|ref|YP_411394.1| HesB/YadR/YfhF [Nitrosospira multiformis ATCC 25196]
 gi|82409893|gb|ABB74002.1| HesB/YadR/YfhF [Nitrosospira multiformis ATCC 25196]
          Length = 114

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 36/114 (31%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  +T+TE A  +I++ +   +GK   +R+ +KK GC+G  Y      +          
Sbjct: 1   MS--ITLTENAAKQIQKQLAK-RGKGLALRVGVKKVGCSGFAYTYAYADELRESDRMFES 57

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            +   V +D   L ++ G+ IDF  E L   F F NPN  + CGCG+S  +K  
Sbjct: 58  CN-AHVVVDVDFLPFLDGSRIDFVREGLNESFRFENPNVDNTCGCGESFSVKEE 110


>gi|227495538|ref|ZP_03925854.1| HesB family protein [Actinomyces coleocanis DSM 15436]
 gi|226831085|gb|EEH63468.1| HesB family protein [Actinomyces coleocanis DSM 15436]
          Length = 114

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T+ A  +++ ++         +R+S+  GGC+GL Y +                 GV
Sbjct: 10  VILTDVAAAKVRSLLEQENRDDLRLRVSVSPGGCSGLIYSLYFDERLLEGDAVRD-FGGV 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +V +D  S+ Y+ G  IDF       GF   NPN  S C CG+S  
Sbjct: 69  EVVVDRMSVPYLNGATIDFADTIEKQGFTIDNPNAGSTCACGESFS 114


>gi|225849222|ref|YP_002729386.1| hypothetical protein SULAZ_1419 [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644394|gb|ACN99444.1| conserved hypothetical protein [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 115

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 33/104 (31%), Positives = 52/104 (50%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +TE A   IK I   +Q +   +R+ +  GGC+G +Y +    +   +   +    GVK+
Sbjct: 10  VTETAAKEIKRIADENQIENPILRVRVVPGGCSGFQYAMGFDDEVSENDRVVEADHGVKI 69

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            ID  S  Y+ G  +D+  + +  GF   NPN V +CGCG S  
Sbjct: 70  VIDEFSAPYINGAVLDYVMDFMGGGFTIKNPNAVGSCGCGNSFS 113


>gi|115391347|ref|XP_001213178.1| iron sulfur assembly protein 1 [Aspergillus terreus NIH2624]
 gi|114194102|gb|EAU35802.1| iron sulfur assembly protein 1 [Aspergillus terreus NIH2624]
          Length = 244

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 70/107 (65%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T  AV ++++++   + K   IR+ +K  GC+GL Y ++ V + P   D+++E+DGV
Sbjct: 141 MKLTPVAVEQLRKLLSQPEPK--MIRVGVKNRGCSGLAYHLEYV-EKPGMFDEVVEQDGV 197

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS +L  ++G+E+D++ +KL   FVF NPN    CGCG+S  +
Sbjct: 198 KVLIDSKALFSIIGSEMDWQEDKLSRRFVFRNPNIKEQCGCGESFMV 244


>gi|241956608|ref|XP_002421024.1| iron sulfur assembly protein, putative [Candida dubliniensis CD36]
 gi|223644367|emb|CAX41180.1| iron sulfur assembly protein, putative [Candida dubliniensis CD36]
          Length = 265

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 69/110 (62%), Gaps = 3/110 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T+T +AV  ++ ++   Q   + IRI ++  GC+GL Y ++ V       D+L+E+
Sbjct: 159 KALITLTSSAVQHLQGLL--DQPDPKLIRIGVRNRGCSGLTYNLEYVDKPGK-FDELVEQ 215

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGVKV IDS +L  ++G+E+D+  +KL S F+F NPN    CGCG+S  +
Sbjct: 216 DGVKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGESFMV 265


>gi|50955131|ref|YP_062419.1| hypothetical protein Lxx15060 [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|50951613|gb|AAT89314.1| conserved hypothetical protein [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 118

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 33/104 (31%), Positives = 56/104 (53%), Gaps = 1/104 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T+ A  ++K ++         +R++++ GGC+GL Y +    +  +DGD  ++ DGV+V
Sbjct: 16  LTDTAAVKVKSLLEQEGRDDLRLRVAVQPGGCSGLIYQLYFD-ERMLDGDAAVDFDGVEV 74

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            +D  S+ Y+ G  IDF+      GF   NPN   +C CG S  
Sbjct: 75  IVDKMSVPYLDGATIDFEDTIQKQGFTIDNPNAAGSCACGDSFH 118


>gi|255036907|ref|YP_003087528.1| iron-sulfur cluster assembly accessory protein [Dyadobacter
           fermentans DSM 18053]
 gi|254949663|gb|ACT94363.1| iron-sulfur cluster assembly accessory protein [Dyadobacter
           fermentans DSM 18053]
          Length = 108

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 58/109 (53%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +VT++++A  +I E+       +   IR+ +  GGC+GL Y ++         D + E  
Sbjct: 1   MVTVSDSAKNKIVELRKADGFEEDYQIRVGVLGGGCSGLTYNLEF-NSESKPNDMVFEDK 59

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           GVK+ +D  SLLY+ GT +DF       GF F NPN    CGCG+S  +
Sbjct: 60  GVKIIVDKKSLLYLAGTTLDFSDGLNGKGFQFINPNATRTCGCGESFAV 108


>gi|126729729|ref|ZP_01745542.1| Iron-sulfur cluster assembly family protein [Sagittula stellata
           E-37]
 gi|126709848|gb|EBA08901.1| Iron-sulfur cluster assembly family protein [Sagittula stellata
           E-37]
          Length = 107

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 55/106 (51%), Gaps = 4/106 (3%)

Query: 6   TMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVK 65
            +TE A  R+ EI    QGKA  +R++++ GGC+G +Y + L      D       + V 
Sbjct: 6   KVTERAFERLSEIGAADQGKA--LRVAVEGGGCSGFQYDISLDAPATDDLVIAEGPEKV- 62

Query: 66  VWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
             +D  SL ++ G  IDF  E + + F   NPN  S+CGCG S  I
Sbjct: 63  -VVDPVSLPFLSGATIDFTDELIGARFTIDNPNATSSCGCGTSFSI 107


>gi|152967205|ref|YP_001362989.1| iron-sulfur cluster assembly accessory protein [Kineococcus
           radiotolerans SRS30216]
 gi|151361722|gb|ABS04725.1| iron-sulfur cluster assembly accessory protein [Kineococcus
           radiotolerans SRS30216]
          Length = 122

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T+ A  +++ ++         +RI+++ GGC+GL Y +    +  +DGD L + DGV
Sbjct: 18  VLLTDVAATKVRTLLEQEGRDDLRLRIAVQPGGCSGLIYQLYFD-ERTLDGDALRDFDGV 76

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +V +D  S  Y+ G  IDF       GF   NPN  S+C CG S  
Sbjct: 77  EVVVDKMSTPYLDGATIDFADTIEKQGFTIDNPNAGSSCACGDSFS 122


>gi|148284615|ref|YP_001248705.1| iron-sulfur cluster assembly accessory protein [Orientia
           tsutsugamushi str. Boryong]
 gi|146740054|emb|CAM80170.1| iron-sulfur cluster assembly accessory protein [Orientia
           tsutsugamushi str. Boryong]
          Length = 124

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 65/107 (60%), Gaps = 1/107 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T++  A  RIKE++   +  + GI++ +K GGC+G  Y ++       D D++I  
Sbjct: 16  KQVITISSRAAKRIKELLAKREKPSLGIKVGIKTGGCSGYSYYIEYADVK-GDFDEVIID 74

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQS 108
            GV V +D  ++LY++GT +D+   K  SGF F NPN+ + CGCG+S
Sbjct: 75  KGVTVLVDQKAILYLVGTTMDYIEGKFNSGFEFSNPNEKNRCGCGKS 121


>gi|294628931|ref|ZP_06707491.1| HesB/YadR/YfhF family protein [Streptomyces sp. e14]
 gi|292832264|gb|EFF90613.1| HesB/YadR/YfhF family protein [Streptomyces sp. e14]
          Length = 118

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AA  ++K ++         +R++++ GGC+GL Y +     + +DGD + +  GV
Sbjct: 14  IVLTDAAASKVKALLDQEGRDDLALRVAVQPGGCSGLRYQLFFDERS-LDGDVVKDFGGV 72

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           KV  D  S  Y+ G  IDF       GF   NPN   +C CG S  
Sbjct: 73  KVVTDRMSAPYLGGATIDFVDTIEKQGFTIDNPNATGSCACGDSFS 118


>gi|327295258|ref|XP_003232324.1| iron sulfur assembly protein [Trichophyton rubrum CBS 118892]
 gi|326465496|gb|EGD90949.1| iron sulfur assembly protein [Trichophyton rubrum CBS 118892]
          Length = 269

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V++T  A+ +++++V       + IRI +K  GC+GL Y ++ V + P   D+++E+DGV
Sbjct: 149 VSLTPTALSKLRDLVSQ--PDPKLIRIGVKNRGCSGLSYHLEYV-EKPAPFDEVVEQDGV 205

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS +L  ++G+E+D+  + L S FVF+NPN    CGCG+S   
Sbjct: 206 KVLIDSKALFSIIGSEVDWHEDPLSSRFVFNNPNIKDECGCGESFMF 252


>gi|302803678|ref|XP_002983592.1| hypothetical protein SELMODRAFT_118247 [Selaginella moellendorffii]
 gi|300148835|gb|EFJ15493.1| hypothetical protein SELMODRAFT_118247 [Selaginella moellendorffii]
          Length = 111

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKDG 63
           +T+++ A+  ++++  +   K   +R+ +++GGC+G+ Y++D      V  DD ++E++G
Sbjct: 5   ITLSDKALSHLQKLRADQ-KKDLCLRVGVRQGGCSGMSYIMDFEDRGNVRSDDSVMEQEG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             +  D  SLLY+ G ++D+    +  GF F NPN  S CGCG+S  
Sbjct: 64  FTMVCDPKSLLYLFGMQLDYSDALIGGGFSFKNPNATSTCGCGKSFA 110


>gi|56964696|ref|YP_176427.1| hypothetical protein ABC2932 [Bacillus clausii KSM-K16]
 gi|56910939|dbj|BAD65466.1| conserved hypothetical protein [Bacillus clausii KSM-K16]
          Length = 117

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T++A  +I+ +       +  +RI +K GGC+GL Y +    +   +   +   +G
Sbjct: 1   MITLTDSAASQIEAMKKEEGDASLMLRIGVKGGGCSGLSYAMGFDNEQDEEDTKIHV-NG 59

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           + V ID  S   + G  ID+K   +  GF   NPN ++ CGCG S 
Sbjct: 60  IDVLIDKESEPIVKGLVIDYKQNMMGGGFTLDNPNAIANCGCGASF 105


>gi|229525396|ref|ZP_04414801.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae bv. albensis VL426]
 gi|229338977|gb|EEO03994.1| iron binding protein IscA for iron-sulfur cluster assembly [Vibrio
           cholerae bv. albensis VL426]
          Length = 107

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E A  R+K  + +++GK  G+R+ +K  GC+G+ Y+++ V D   +        GV
Sbjct: 3   VTLSETAASRVKTFL-DNRGKGIGLRLGVKTTGCSGMAYVLEFVDDVNEEDHVFE-SHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID+ S++Y+ GT++D+K E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIIDTKSMVYLDGTQLDYKKEGLNEGFEFNNPNVKSECGCGESFNV 107


>gi|56697353|ref|YP_167721.1| Iron-sulfur cluster assembly family protein [Ruegeria pomeroyi
           DSS-3]
 gi|56679090|gb|AAV95756.1| Iron-sulfur cluster assembly family protein [Ruegeria pomeroyi
           DSS-3]
          Length = 107

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 62/106 (58%), Gaps = 4/106 (3%)

Query: 6   TMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVK 65
            +T+ A  R+ EI    QG+A  +R++++ GGC+G +Y  ++  D P   D ++E  G +
Sbjct: 6   KVTDRAFARLAEIGAADQGQA--LRVAVEGGGCSGFQY--EIALDAPKSDDLVLEGQGQR 61

Query: 66  VWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V +D+ SL ++    IDF  E + + FV  NPN  ++CGCG S  I
Sbjct: 62  VVVDAVSLPFLENAVIDFSEELIGARFVIDNPNATASCGCGTSFSI 107


>gi|54294274|ref|YP_126689.1| iron-sulfur cluster insertion protein ErpA [Legionella pneumophila
           str. Lens]
 gi|81368710|sp|Q5WWW0|ERPA_LEGPL RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|53754106|emb|CAH15579.1| hypothetical protein lpl1339 [Legionella pneumophila str. Lens]
          Length = 130

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 49/116 (42%), Gaps = 5/116 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVD-----GDDLI 59
           +  + +A  ++ E++         +R+S+  GGC+G +Y          D          
Sbjct: 13  INFSVSAADKVAELIKEEDNSDLNLRVSITGGGCSGFQYGFSFDEQINDDDTVIIQQCSD 72

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            K  VK+ IDS S  Y+   EID+        FV  NPN  + CGCG S  I   D
Sbjct: 73  GKSSVKLLIDSMSYQYLHDAEIDYIKGIQGEQFVIRNPNAKTTCGCGSSFSIGDED 128


>gi|88856528|ref|ZP_01131185.1| hypothetical protein A20C1_02244 [marine actinobacterium PHSC20C1]
 gi|88814182|gb|EAR24047.1| hypothetical protein A20C1_02244 [marine actinobacterium PHSC20C1]
          Length = 118

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 52/106 (49%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +TEAA  +++ ++         +R++++ GGC+GL Y +            +   DGV
Sbjct: 13  VALTEAATDKVRSLMSQEGRDDLRLRLAVQPGGCSGLIYQLYFDERILDGDVSVDFGDGV 72

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           +V +D  S+ Y+ G  IDF+      GF   NPN   +C CG S  
Sbjct: 73  EVVVDKMSVPYLDGASIDFEDTIQKQGFTIDNPNAEGSCACGDSFH 118


>gi|319407167|emb|CBI80806.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 107

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +++ A  +I +I+     K   +RIS++ GGC+G  Y  DLV     + D +I+K G 
Sbjct: 3   VNISDIAAKQIAQILAEQPRKT-ALRISVEGGGCSGFSYKYDLV-SESKEDDFIIKKGGA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V+IDS SL +M G EIDF  + +   F  HNPN  S+CGCG S  I
Sbjct: 61  VVFIDSISLAFMEGAEIDFVDDLMGQSFQIHNPNATSSCGCGVSFSI 107


>gi|325108418|ref|YP_004269486.1| iron-sulfur cluster assembly accessory protein [Planctomyces
           brasiliensis DSM 5305]
 gi|324968686|gb|ADY59464.1| iron-sulfur cluster assembly accessory protein [Planctomyces
           brasiliensis DSM 5305]
          Length = 110

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 61/106 (57%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIV-FNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           VT+TE A   IK ++   ++ +   +RI ++ GGC+G +Y + L        D++ E+ G
Sbjct: 3   VTVTEKAANEIKRVLGEQAKPETTVLRIGVRAGGCSGFQYNLALDDQFDAAKDEVSEQHG 62

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           VKV +D  S+LY+ GT +D+       GF F NPN V +CGCG S 
Sbjct: 63  VKVAVDKKSMLYLDGTVVDYYDGLEKRGFSFENPNVVKSCGCGSSF 108


>gi|225163431|ref|ZP_03725748.1| iron-sulfur cluster assembly accessory protein [Opitutaceae
           bacterium TAV2]
 gi|224801973|gb|EEG20252.1| iron-sulfur cluster assembly accessory protein [Opitutaceae
           bacterium TAV2]
          Length = 105

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 58/106 (54%), Gaps = 2/106 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T++  A  +I+++  ++    Q +R+ ++ GGC+G +Y +          D  +E +G
Sbjct: 1   MITLSPRAADQIRQMQRDNAATGQPLRVLVEDGGCSGHQYGMSFDDPR--PDDTRMESEG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           V + +D ASL ++ GT IDF       GF   NPN  + CGCG+S 
Sbjct: 59  VPIVVDPASLKHLDGTHIDFDDGLQGRGFEIKNPNAKNTCGCGKSF 104


>gi|156537934|ref|XP_001608294.1| PREDICTED: similar to AT26381p [Nasonia vitripennis]
          Length = 130

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 67/105 (63%), Gaps = 2/105 (1%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           +T  AV +IKEI+ +   +  G+++ +++ GC GL Y +D  TD     ++++ +DGV+V
Sbjct: 28  LTSNAVNKIKEILKDK-PEYIGLKVGVRQRGCNGLSYTLDYATDKSKLDEEVV-QDGVRV 85

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            ID  + L +LGTE+D+   KL S FVF+NPN    CGCG+S  +
Sbjct: 86  IIDRKAQLSLLGTEMDYIENKLSSEFVFNNPNIKGTCGCGESFSV 130


>gi|300724153|ref|YP_003713470.1| putative regulator [Xenorhabdus nematophila ATCC 19061]
 gi|75396868|sp|Q8GLE6|ISCA_XENNA RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|23345069|gb|AAN17747.1| IscA [Xenorhabdus nematophila]
 gi|297630687|emb|CBJ91352.1| putative regulator believed to be involved in Fe-S cluster assembly
           and activation [Xenorhabdus nematophila ATCC 19061]
          Length = 107

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE+A  RI   + +++GK  G+R+ ++  GC+G+ Y+++       +     +K GV
Sbjct: 3   ISLTESAAQRIVAFL-DNRGKGVGLRLGVRTSGCSGMAYVLEFADVVNEEDQVFEDK-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  S+LY+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KVIVDGKSILYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFHV 107


>gi|297182354|gb|ADI18521.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF4000_19M20]
          Length = 114

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 56/107 (52%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +++TE AV +I  +    + +   +R+ +  GGC+G +Y      +   +   +  KDG 
Sbjct: 10  LSLTEGAVKKINSLSKREENR-VNLRVYVTGGGCSGFQYGFSFDHEVDEEDTCIT-KDGA 67

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            + ID  S  Y++G+ ID+  +   S F+  NPN  + CGCG+S  I
Sbjct: 68  NLVIDPLSFQYLVGSTIDYSEDLAGSKFIVKNPNATTTCGCGESFSI 114


>gi|284030701|ref|YP_003380632.1| iron-sulfur cluster assembly accessory protein [Kribbella flavida
           DSM 17836]
 gi|283809994|gb|ADB31833.1| iron-sulfur cluster assembly accessory protein [Kribbella flavida
           DSM 17836]
          Length = 120

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 53/106 (50%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+ A  ++K ++         +R++++ GGC+GL Y +    +  +DGD + + DGV
Sbjct: 16  IALTDGAAAKVKALLDQEGRDDLALRVAVQPGGCSGLRYQLFFD-ERQLDGDVVADFDGV 74

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            V  D  S  Y+ G  IDF       GF   NPN   +C CG S  
Sbjct: 75  SVVTDRMSAPYLKGASIDFVDTIEKQGFTIDNPNATGSCACGDSFN 120


>gi|159899213|ref|YP_001545460.1| iron-sulfur cluster assembly accessory protein [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159892252|gb|ABX05332.1| iron-sulfur cluster assembly accessory protein [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 147

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 54/113 (47%), Gaps = 2/113 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQ-GKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +VT+T +A  R+  I    +      +R+ +  GGC+GL+Y +           +     
Sbjct: 18  LVTVTASAANRLLSIKQEKELSDEYALRVFVAGGGCSGLQYGMSFDDQTNEGDTEFFA-S 76

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           G++V +D  S  Y+ G  ID+    +  GF   NPN  S+CGCG S + K  +
Sbjct: 77  GLRVIVDPMSAQYIGGASIDYIDSLMGGGFKIDNPNATSSCGCGSSFKPKNGE 129


>gi|68448477|ref|NP_001020349.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Danio rerio]
 gi|81170637|sp|Q4QRC6|ISCA1_DANRE RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|67678098|gb|AAH97234.1| Zgc:114185 [Danio rerio]
          Length = 129

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV ++K+++ N   +  G+++ ++  GC GL Y +D    N    D+ + +DGV
Sbjct: 25  LTLTPSAVNKVKQLLDNK-PEYIGLKVGVRTRGCNGLTYTLDYT-KNKEQSDEEVLQDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+DF   KL S FVF+NPN    CGCG+S  I
Sbjct: 83  RVFIEKKAQLTLLGTEMDFVETKLSSEFVFNNPNIKGTCGCGESFNI 129


>gi|326333577|ref|ZP_08199817.1| HesB/YadR/YfhF family protein [Nocardioidaceae bacterium Broad-1]
 gi|325948686|gb|EGD40786.1| HesB/YadR/YfhF family protein [Nocardioidaceae bacterium Broad-1]
          Length = 117

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +++ A  ++K ++         +RIS++ GGC+GL Y +    +  +DGD + + DGV
Sbjct: 13  INLSDVAAAKVKSLLEQEGRDDLSLRISVQPGGCSGLRYQLFFD-ERTLDGDVVTDFDGV 71

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            V +D  S+ Y+ G  IDF       GF   NPN   +C CG S  
Sbjct: 72  SVVVDRMSVPYLNGAMIDFVDSIEKQGFTIDNPNATGSCACGDSFH 117


>gi|229087448|ref|ZP_04219582.1| hypothetical protein bcere0022_40140 [Bacillus cereus Rock3-44]
 gi|228695870|gb|EEL48721.1| hypothetical protein bcere0022_40140 [Bacillus cereus Rock3-44]
          Length = 130

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 1/106 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A Y+IK+++ +++   + +R+++  GGC+GL Y +    +   D   L    G
Sbjct: 14  MINVTEQAAYQIKDMLKDAEDGEKYVRLAVHGGGCSGLSYGLGFEREPNEDDTVLEFF-G 72

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           V+  ID  S   + G  ID+K   L  GF   NPN +++CGCG S 
Sbjct: 73  VEFVIDKESAPIVKGVNIDYKQSMLGGGFTIDNPNAIASCGCGSSF 118


>gi|255582815|ref|XP_002532181.1| Iron-sulfur assembly protein IscA, chloroplast precursor, putative
           [Ricinus communis]
 gi|223528129|gb|EEF30199.1| Iron-sulfur assembly protein IscA, chloroplast precursor, putative
           [Ricinus communis]
          Length = 178

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDD-LIEKDG 63
           +++TE A+  + + +   + +   +RI +K+GGC+G+ Y ++    +    DD +IE +G
Sbjct: 70  ISVTENALNHLNK-MRKDRDEDLCLRIGVKQGGCSGMSYTMEFENRSNARPDDSVIEYNG 128

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
             +  D  SLL++ G ++D+    +  GF F NPN    CGCG+S  
Sbjct: 129 FVIVCDPKSLLFVFGMQLDYSDALIGGGFSFKNPNATQTCGCGKSFA 175


>gi|254503725|ref|ZP_05115876.1| FeS assembly scaffold SufA [Labrenzia alexandrii DFL-11]
 gi|222439796|gb|EEE46475.1| FeS assembly scaffold SufA [Labrenzia alexandrii DFL-11]
          Length = 117

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 56/112 (50%), Positives = 84/112 (75%), Gaps = 1/112 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+AA  R+ E+V N+   A G+R+ +KKGGCAG+EY +DLV +     D + +K G 
Sbjct: 1   MTLTDAAAERVCELVDNADKPALGLRVGIKKGGCAGMEYAMDLVEEASPGDDVIEDK-GA 59

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           K+++D +++L++LGTE+DF+  K  SGFVF NPN+VSACGCG+SV ++ ADL
Sbjct: 60  KIFVDPSAVLFLLGTEMDFEVTKFRSGFVFKNPNEVSACGCGESVSLQAADL 111


>gi|332971656|gb|EGK10605.1| iron-sulfur cluster assembly protein IscA [Psychrobacter sp.
           1501(2011)]
          Length = 106

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 64/108 (59%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A   + + + N++G  +GIR+ ++  GC+GL Y+++ V +     +      G
Sbjct: 1   MIELTERAAKHVTDYL-NNRGHGEGIRVGIRTAGCSGLAYVLEFVDEPDSVDEKFE-SHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           V +++D  S++Y+ G  +D+ TE L  GF F NPNQ   CGCG+S  +
Sbjct: 59  VNIFVDPKSMVYLDGLLMDYVTEGLNEGFKFTNPNQKGECGCGESFTV 106


>gi|90579376|ref|ZP_01235186.1| Putative hesB family protein [Vibrio angustum S14]
 gi|90440209|gb|EAS65390.1| Putative hesB family protein [Vibrio angustum S14]
          Length = 107

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V +         EK GV
Sbjct: 3   ITITEAAASRVSTFLAN-RGKGLGLRLGVRTSGCSGMAYILEFVDELDEGDQVFDEK-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D+ SL+Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  KIIVDAKSLVYLDGTELDFAKEGLNEGFQFNNPNVSSECGCGESFNV 107


>gi|300022778|ref|YP_003755389.1| iron-sulfur cluster assembly accessory protein [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299524599|gb|ADJ23068.1| iron-sulfur cluster assembly accessory protein [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 107

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 56/107 (52%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+TE A  RI EI  +  G    +R+S++ GGC+G +Y  DL      D   +    G 
Sbjct: 3   VTVTEQAATRISEIAGSEPGSPV-LRVSVEGGGCSGFQYKFDLTNARAADDFVIERA-GA 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V ID  SL YM G EIDF  + + + F   NP   ++CGCG S  +
Sbjct: 61  VVVIDPVSLQYMEGAEIDFVDDLIGAAFKIKNPVATASCGCGTSFSV 107


>gi|307610091|emb|CBW99632.1| hypothetical protein LPW_14001 [Legionella pneumophila 130b]
          Length = 130

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 49/116 (42%), Gaps = 5/116 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVD-----GDDLI 59
           +  + +A  ++ E++         +R+S+  GGC+G +Y          D          
Sbjct: 13  IHFSVSAADKVAELIKEEDNSDLNLRVSITGGGCSGFQYGFSFDEQINDDDTVIIQQCSD 72

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            K  VK+ IDS S  Y+   EID+        FV  NPN  + CGCG S  I   D
Sbjct: 73  GKSSVKLLIDSMSYQYLHDAEIDYIKGIQGEQFVIRNPNAKTTCGCGSSFSIGDED 128


>gi|242769736|ref|XP_002341832.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Talaromyces stipitatus ATCC 10500]
 gi|218725028|gb|EED24445.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Talaromyces stipitatus ATCC 10500]
          Length = 240

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 66/107 (61%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV +++ ++       + IR+ +K  GC+GL Y ++ V       D+++E+DGV
Sbjct: 137 MTLTPTAVSQLRSMLSQ--PDPKMIRVGVKNRGCSGLAYNLEYVDKPGK-FDEVVEQDGV 193

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS +L  ++G+E+D+  +KL   FVF NPN    CGCG+S  +
Sbjct: 194 KVLIDSKALFSIIGSEMDWHEDKLSQRFVFRNPNIKEQCGCGESFMV 240


>gi|118589110|ref|ZP_01546517.1| hypothetical protein SIAM614_13698 [Stappia aggregata IAM 12614]
 gi|118438439|gb|EAV45073.1| hypothetical protein SIAM614_13698 [Stappia aggregata IAM 12614]
          Length = 113

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+++ A  RI  I+         +R+S++ GGC+GL+Y  D+V     D D +IEK+G 
Sbjct: 9   VTVSDRAAKRIAAILSKE-PDCSMLRVSVEGGGCSGLQYKYDVVDSR-EDDDLVIEKNGA 66

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V IDS SL YM G+EIDF  + +   F  +NPN V+ CGCG S  I
Sbjct: 67  TVLIDSISLQYMGGSEIDFVDDLIGQSFQINNPNAVAGCGCGTSFTI 113


>gi|47226595|emb|CAG08611.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 129

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T +AV RI+ ++   + +  G+++ +K  GC GL Y +D   +     ++++ +DGV
Sbjct: 25  LTLTPSAVNRIR-LLLEDRPEYIGLKVGVKTRGCNGLTYTLDYTKEKHKSDEEVL-QDGV 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           +V+I+  + L +LGTE+DF   KL S F+F+NPN    CGCG+S  +
Sbjct: 83  RVFIEKKAQLTLLGTEMDFVETKLTSEFIFNNPNIKGTCGCGESFSV 129


>gi|146312666|ref|YP_001177740.1| iron-sulfur cluster assembly protein [Enterobacter sp. 638]
 gi|166973717|sp|A4WDA9|ISCA_ENT38 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|145319542|gb|ABP61689.1| iron-sulfur cluster assembly protein IscA [Enterobacter sp. 638]
          Length = 107

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V +     D + E  GV
Sbjct: 3   ITLSDSAAARVSSFLEN-RGKGYGLRLGVRTSGCSGMAYVLEFVDEP-ATDDTVFEDKGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL ++ GT++DF  E L  GF F NPN    CGCG+S  +
Sbjct: 61  KVVIDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV 107


>gi|148255784|ref|YP_001240369.1| hypothetical protein BBta_4426 [Bradyrhizobium sp. BTAi1]
 gi|146407957|gb|ABQ36463.1| hypothetical protein BBta_4426 [Bradyrhizobium sp. BTAi1]
          Length = 113

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 61/105 (58%), Gaps = 2/105 (1%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
           ++E A  RI EI+     +   +RIS++ GGC+G +Y  D+      D D +I +D   V
Sbjct: 11  ISERAARRIGEILGKE-TEGAMLRISVEGGGCSGFQYKFDIDRAK-ADDDLVIARDRAVV 68

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D AS+ ++ G+E+DF  + + + F  +NPN  ++CGCG S  +
Sbjct: 69  LVDPASVPFLAGSEVDFVDDLMGASFRINNPNATASCGCGTSFSV 113


>gi|312891369|ref|ZP_07750886.1| iron-sulfur cluster assembly accessory protein [Mucilaginibacter
           paludis DSM 18603]
 gi|311296063|gb|EFQ73215.1| iron-sulfur cluster assembly accessory protein [Mucilaginibacter
           paludis DSM 18603]
          Length = 108

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 61/109 (55%), Gaps = 2/109 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQG-IRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKD 62
           +VT+T+ A  +I  ++ ++       +R+S++ GGC+GL Y +D   +         +K 
Sbjct: 1   MVTITDKAKSKIDHLMQDAGMDTSYFLRVSVQGGGCSGLSYNLDFDNEEKKGDQFFEDK- 59

Query: 63  GVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           G+++ +D  S LY+ GTE+DF       GF FHNPN    CGCG+S  +
Sbjct: 60  GIRMALDMKSFLYLAGTELDFSDGLNGKGFNFHNPNATRTCGCGESFSV 108


>gi|221633531|ref|YP_002522756.1| HesB/YadR/YfhF [Thermomicrobium roseum DSM 5159]
 gi|221156918|gb|ACM06045.1| HesB/YadR/YfhF [Thermomicrobium roseum DSM 5159]
          Length = 127

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 57/109 (52%), Gaps = 1/109 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           + ++TMT  AV R+K+ +         +R+ +  GGC+GL+Y + L      D       
Sbjct: 4   TTLITMTPEAVRRLKQFMDEQGMPEAYLRVFVAPGGCSGLQYGMALEESAEEDDFTFEI- 62

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           DGV+V +D  S  Y+ G EID+    +  GF  HNPN V+ C CG S +
Sbjct: 63  DGVRVIVDPFSATYLEGAEIDYVNSLMGGGFTVHNPNAVATCACGHSFD 111


>gi|329941024|ref|ZP_08290304.1| iron-sulfur cluster assembly accessory protein [Streptomyces
           griseoaurantiacus M045]
 gi|329300318|gb|EGG44216.1| iron-sulfur cluster assembly accessory protein [Streptomyces
           griseoaurantiacus M045]
          Length = 118

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AA  ++K ++         +R++++ GGC+GL Y +     + +DGD   +  GV
Sbjct: 14  IILTDAAASKVKALLDQEGRDDLALRVAVQPGGCSGLRYQLFFDERS-LDGDVKKDFGGV 72

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            V  D  S  Y+ G  +DF       GF   NPN   +C CG S  
Sbjct: 73  AVVTDRMSAPYLGGATVDFVDTIEKQGFTIDNPNATGSCACGDSFS 118


>gi|327191052|gb|EGE58105.1| FeS assembly scaffold SufA [Rhizobium etli CNPAF512]
          Length = 130

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 60/113 (53%), Positives = 84/113 (74%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +++MTE A  R+K IV NS  +A+G+R+ +KKGGCAG+EY +DLVT+     D +   DG
Sbjct: 5   VMSMTEGAAARVKAIVENSGPEAKGVRVGIKKGGCAGMEYTIDLVTEPNAKDDLIER-DG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            +VW++ +++LY+LGTE+ F+   L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  ARVWVEPSAVLYLLGTEMGFEQTTLRSGFTFTNPNQTSACGCGESVELKPADL 116


>gi|218463662|ref|ZP_03503753.1| FeS assembly scaffold SufA [Rhizobium etli Kim 5]
          Length = 130

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 59/113 (52%), Positives = 84/113 (74%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           +++MT+ A  R+K IV NS  +A+G+R+ +KKGGCAG+EY +DLVT+     D +   DG
Sbjct: 5   VMSMTDGAAARVKAIVENSGPEAKGVRVGIKKGGCAGMEYTIDLVTEPNAKDDLIER-DG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            +VW++ +++LY+LGTE+ F+   L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  ARVWVEPSAVLYLLGTEMGFEQTTLRSGFTFTNPNQTSACGCGESVELKPADL 116


>gi|218245292|ref|YP_002370663.1| iron-sulfur cluster assembly accessory protein [Cyanothece sp. PCC
           8801]
 gi|257058327|ref|YP_003136215.1| iron-sulfur cluster assembly accessory protein [Cyanothece sp. PCC
           8802]
 gi|218165770|gb|ACK64507.1| iron-sulfur cluster assembly accessory protein [Cyanothece sp. PCC
           8801]
 gi|256588493|gb|ACU99379.1| iron-sulfur cluster assembly accessory protein [Cyanothece sp. PCC
           8802]
          Length = 118

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 31/108 (28%), Positives = 58/108 (53%), Gaps = 2/108 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDL-VTDNPVDGDDLIEKDG 63
           + +T+ A+  +  ++   Q     +R+ +++GGC+G+ Y++D        + D++ + +G
Sbjct: 12  IQLTDTALKHVL-LLREQQRTDLCLRVGVRQGGCSGMSYIMDFEDESKITEHDEVFDYEG 70

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            K+  D  SLLY+ G  +D+    +  GF F NPN    CGCG S  +
Sbjct: 71  FKIVCDRKSLLYLYGLVLDYSNAMIGGGFQFTNPNATQTCGCGTSFAV 118


>gi|297170309|gb|ADI21345.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF0010_10D20]
          Length = 115

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +TE A+ +I  +      K+  +R+ +  GGC+G +Y          +   +   DG 
Sbjct: 10  IFLTENAISKILSLREEESNKSLMLRVFVTGGGCSGFQYGFKFDDQKDDEDTLVD-FDGA 68

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V +D  S+ Y+ G+ ID+      + FV  NPN  + CGCG S  I
Sbjct: 69  DVVVDPLSMQYVFGSTIDYVQNLEGAKFVVDNPNAATQCGCGASFSI 115


>gi|254444882|ref|ZP_05058358.1| hypothetical protein VDG1235_3125 [Verrucomicrobiae bacterium
           DG1235]
 gi|198259190|gb|EDY83498.1| hypothetical protein VDG1235_3125 [Verrucomicrobiae bacterium
           DG1235]
          Length = 106

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 55/108 (50%), Gaps = 2/108 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE+AV ++  +      K   +R+ +  GGC GL Y +  V         +    G
Sbjct: 1   MIKLTESAVAKVAALARKESDKP-FLRVGIAGGGCNGLSYKMRFVEAARKGDIFVD-FGG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +V +DS S LY+ GT +D+    +  GF F NPN  S+C CG+S  +
Sbjct: 59  AQVIVDSKSALYLKGTHLDYSDALISGGFKFSNPNATSSCSCGESFSV 106


>gi|52841618|ref|YP_095417.1| iron-sulfur cluster insertion protein ErpA [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|81377543|sp|Q5ZVQ2|ERPA_LEGPH RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|52628729|gb|AAU27470.1| hypothetical protein lpg1388 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|59041115|gb|AAW83809.1| unknown [Legionella pneumophila]
          Length = 130

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 49/116 (42%), Gaps = 5/116 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVD-----GDDLI 59
           +  + +A  ++ E++         +R+S+  GGC+G +Y          D          
Sbjct: 13  IHFSVSAADKVAELIKEEDNSNLNLRVSITGGGCSGFQYGFSFDEQINDDDTIVIQQCSD 72

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            K  VK+ +DS S  Y+   EID+        FV  NPN  + CGCG S  I   D
Sbjct: 73  GKSSVKLLVDSMSYQYLHDAEIDYIKGIQGEQFVIRNPNAKTTCGCGSSFSIGDED 128


>gi|322434574|ref|YP_004216786.1| iron-sulfur cluster assembly accessory protein [Acidobacterium sp.
           MP5ACTX9]
 gi|321162301|gb|ADW68006.1| iron-sulfur cluster assembly accessory protein [Acidobacterium sp.
           MP5ACTX9]
          Length = 127

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V MT+AA+ ++KEI+        G+RI +  GGC+G +Y +     + +    L   D +
Sbjct: 22  VKMTDAAIGKVKEIMATQDPIPAGLRIGVVGGGCSGFQYSMSFENQSGMMDKVLRFAD-L 80

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV++D+ S +Y+ G  +D+      +GF F NP   S CGCG S  +
Sbjct: 81  KVFVDATSAMYLNGCVVDYVETLEAAGFKFENPTVKSTCGCGSSFSV 127


>gi|116252322|ref|YP_768160.1| HesB nitrogen fixation family protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115256970|emb|CAK08064.1| putative HesB nitrogen fixation family protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 130

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 62/113 (54%), Positives = 83/113 (73%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I++MT+ A  R+K IV NS   A+G+R+ +KKGGCAG+EY +DLVT+     D +   DG
Sbjct: 5   IMSMTDGAAARVKAIVENSGPDAKGVRVGIKKGGCAGMEYTIDLVTEPNAKDDLIER-DG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            KVW++ ++ LY+LGTE+ F+T  L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  AKVWVEPSAALYLLGTEMGFETTTLRSGFTFTNPNQTSACGCGESVELKPADL 116


>gi|307104394|gb|EFN52648.1| hypothetical protein CHLNCDRAFT_14993 [Chlorella variabilis]
          Length = 106

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 68/107 (63%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T+AAV R+KE++     +   +++ +K  GC G+ Y ++         D+++E++GV
Sbjct: 3   LELTDAAVERVKELLHKRNKE--FLKLGVKTRGCNGMAYTLNYADSK-GRFDEVVEQEGV 59

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  +L+++LGT++D+  ++L S F+F NPN    CGCG+S  +
Sbjct: 60  KVLIDPGALMHVLGTKMDWVEDRLRSEFIFVNPNAKGTCGCGESFTV 106


>gi|49187795|ref|YP_031048.1| hesB/yadR/yfhF family protein [Bacillus anthracis str. Sterne]
 gi|49481005|ref|YP_038957.1| hypothetical protein BT9727_4646 [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|222098387|ref|YP_002532445.1| hesb/yadr/yfhf family protein [Bacillus cereus Q1]
 gi|228917566|ref|ZP_04081110.1| hypothetical protein bthur0012_47720 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|229199083|ref|ZP_04325766.1| hypothetical protein bcere0001_45960 [Bacillus cereus m1293]
 gi|49181722|gb|AAT57098.1| hesB/yadR/yfhF family protein [Bacillus anthracis str. Sterne]
 gi|49332561|gb|AAT63207.1| conserved hypothetical protein [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|221242446|gb|ACM15156.1| hesB/yadR/yfhF family protein [Bacillus cereus Q1]
 gi|228584354|gb|EEK42489.1| hypothetical protein bcere0001_45960 [Bacillus cereus m1293]
 gi|228842046|gb|EEM87149.1| hypothetical protein bthur0012_47720 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 130

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 60/106 (56%), Gaps = 1/106 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A ++IK+++ +++   + +R+++  GGC+GL Y +    +   D   L    G
Sbjct: 14  MIEVTEQAAFQIKDMLKDAEDGEKYVRLAVHGGGCSGLSYGLGFEVEPKEDDTVLEFF-G 72

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           V+  ID  S   + G +ID+K   L  GF   NPN +++CGCG S 
Sbjct: 73  VEFVIDKESAPIVKGVKIDYKQSMLGGGFTIDNPNAIASCGCGSSF 118


>gi|134098237|ref|YP_001103898.1| HesB/YadR/YfhF [Saccharopolyspora erythraea NRRL 2338]
 gi|291004342|ref|ZP_06562315.1| HesB/YadR/YfhF [Saccharopolyspora erythraea NRRL 2338]
 gi|133910860|emb|CAM00973.1| HesB/YadR/YfhF [Saccharopolyspora erythraea NRRL 2338]
          Length = 121

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 54/106 (50%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T++A  + K ++         +RI+++ GGCAGL Y +    +  +DGD   + +G+
Sbjct: 17  VTLTDSAAKKAKALLEQEGRDDMHLRIAVQPGGCAGLRYQLFFD-ERTLDGDARRDFEGL 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            V +D  S  Y+ G  IDF       GF   NPN   +C CG S  
Sbjct: 76  GVVVDRMSAPYVEGATIDFVDTIEKQGFTIDNPNAGGSCACGDSFH 121


>gi|56479097|ref|YP_160686.1| IscA protein involved in Fe-S cluster synthesis [Aromatoleum
           aromaticum EbN1]
 gi|56315140|emb|CAI09785.1| IscA protein involved in Fe-S cluster synthesis [Aromatoleum
           aromaticum EbN1]
          Length = 107

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 61/107 (57%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++  A   + E +   +GK  GIR+ +K  GC+G+ Y ++ V D   +        GV
Sbjct: 3   VTLSTNAAKHVSEFMAK-RGKGVGIRLGVKTSGCSGMAYRLEFVDDMHDEDLIFE-SHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL Y+ GTE+DF  E L  GF F+NPN   ACGCG+S  +
Sbjct: 61  KVIVDPQSLAYLDGTELDFVREGLNEGFKFNNPNVKDACGCGESFNV 107


>gi|50288207|ref|XP_446532.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49525840|emb|CAG59459.1| unnamed protein product [Candida glabrata]
          Length = 250

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 70/110 (63%), Gaps = 3/110 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             ++T++  A+Y +K ++   + + + IR+  K  GC+GL Y +  +T+     D+++E+
Sbjct: 144 KAVITLSPKAIYHLKALL--DEPEPKLIRVGAKNRGCSGLTYDLQYITEPGK-FDEVVEQ 200

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DGVK+ IDS +L  ++G+E+D+  +KL S FVF NPN    CGCG+S  +
Sbjct: 201 DGVKIVIDSKALFSVVGSEMDWVDDKLASKFVFKNPNSKGTCGCGESFMV 250


>gi|22298410|ref|NP_681657.1| hypothetical protein tll0867 [Thermosynechococcus elongatus BP-1]
 gi|22294589|dbj|BAC08419.1| ycf57 [Thermosynechococcus elongatus BP-1]
          Length = 118

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDL-VTDNPVDGDDLIEKDG 63
           + MTEAA+  + E+      K   +R+ +K GGCAG+ Y +D     N    D++ + DG
Sbjct: 12  IMMTEAALKHLLELRDKHG-KDLCLRVGVKGGGCAGMSYTMDFEDPANIRPDDEVFDYDG 70

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            KV  D  S+LY+ G  +D+    +  GF F NPN    CGCG S  
Sbjct: 71  FKVVSDPKSMLYIYGLVLDYSNALIGGGFKFTNPNATQTCGCGTSFS 117


>gi|217970605|ref|YP_002355839.1| iron-sulfur cluster assembly protein IscA [Thauera sp. MZ1T]
 gi|217507932|gb|ACK54943.1| iron-sulfur cluster assembly protein IscA [Thauera sp. MZ1T]
          Length = 107

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 46/107 (42%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT++E+A   +   +   +GK  GIR+ +K  GC+G+ Y ++ V D   D D++ E  GV
Sbjct: 3   VTLSESAARHVSNFIAK-RGKGFGIRLGVKTSGCSGMAYKLEFV-DQTEDEDEVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVVIDPKSLAYLDGTELDFVKEGLNEGFKFNNPNVKDQCGCGESFNV 107


>gi|330722244|gb|EGH00126.1| Iron binding protein IscA for iron-sulfur cluster assembly [gamma
           proteobacterium IMCC2047]
          Length = 107

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 59/107 (55%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT  A   + + +   +GK  G+R+ ++  GC+GL Y+++ V              GV
Sbjct: 3   ITMTATAAEHVTKHLA-QRGKGIGVRVGVRTSGCSGLAYVLEFVDKADEGDQIFE-DHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SL Y+ GTE+DF TE L  GF F NPN    CGCG+S  +
Sbjct: 61  KIVVDEKSLAYLDGTELDFVTEGLNEGFKFTNPNVSGECGCGESFNV 107


>gi|119717370|ref|YP_924335.1| iron-sulfur cluster assembly accessory protein [Nocardioides sp.
           JS614]
 gi|119538031|gb|ABL82648.1| iron-sulfur cluster assembly accessory protein [Nocardioides sp.
           JS614]
          Length = 120

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 1/109 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           +D + ++  A  ++K ++         +RIS++ GGC+GL Y +     + +DGD + + 
Sbjct: 13  TDQINLSPVAATKVKSLLEQEGRDDLALRISVQPGGCSGLRYQLFFDERS-LDGDVVTDF 71

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           DGV V +D  S+ Y+ G  IDF       GF   NPN   +C CG S  
Sbjct: 72  DGVSVVVDRMSVPYLNGAMIDFVDSIEKQGFTIDNPNASGSCACGDSFH 120


>gi|238921051|ref|YP_002934566.1| iron-sulfur cluster assembly protein IscA, [Edwardsiella ictaluri
           93-146]
 gi|259493871|sp|C5BEU3|ISCA_EDWI9 RecName: Full=Iron-binding protein iscA; AltName: Full=Iron-sulfur
           cluster assembly protein
 gi|238870620|gb|ACR70331.1| iron-sulfur cluster assembly protein IscA, putative [Edwardsiella
           ictaluri 93-146]
          Length = 107

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 66/107 (61%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TM+++A  R++  + N +GK  G+R+ +K  GC+G+ Y+++ V     D        GV
Sbjct: 3   ITMSDSAAKRVQTFLTN-RGKGLGLRLGVKTSGCSGMAYVLEFVDVLNEDDVVFE-DQGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV +D  SL+Y+ GTE+DF  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  KVIVDGKSLVYLDGTELDFVKEGLNEGFKFNNPNVKNECGCGESFNV 107


>gi|313109230|ref|ZP_07795198.1| putative iron-binding protein IscA [Pseudomonas aeruginosa 39016]
 gi|310881700|gb|EFQ40294.1| putative iron-binding protein IscA [Pseudomonas aeruginosa 39016]
          Length = 107

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   ++  +   +GK +GIR+ ++  GC+GL Y+++ V +     D + E  GV
Sbjct: 3   ISMTEAAAKHVQRSLEG-RGKGEGIRLGVRTTGCSGLAYVLEFVDEL-AAEDLVFENHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFTREGLNEGFKFNNPNVRGECGCGESFNV 107


>gi|260575186|ref|ZP_05843186.1| iron-sulfur cluster assembly accessory protein [Rhodobacter sp.
           SW2]
 gi|259022446|gb|EEW25742.1| iron-sulfur cluster assembly accessory protein [Rhodobacter sp.
           SW2]
          Length = 119

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 46/112 (41%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              VT+T  A  +I  ++      AQG+RI +KKGGCAG+EY +D VT+       +  +
Sbjct: 7   KQAVTLTPQAATQIARLMAKQG--AQGLRIGVKKGGCAGMEYTLDYVTEVNPLDALVE-Q 63

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKR 113
           DG +V I   + ++++GTEID++T  L +GF F NPN   ACGCG+S++ K 
Sbjct: 64  DGARVLIAPMAQMFLIGTEIDYQTSLLDAGFKFRNPNVAEACGCGESIKFKD 115


>gi|149183078|ref|ZP_01861530.1| hypothetical protein BSG1_14058 [Bacillus sp. SG-1]
 gi|148849207|gb|EDL63405.1| hypothetical protein BSG1_14058 [Bacillus sp. SG-1]
          Length = 125

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 40/109 (36%), Positives = 65/109 (59%), Gaps = 1/109 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MSD+V +TEAA  +IK+++  ++ +   IR+S+K GGC+GL Y +    +   D   L  
Sbjct: 6   MSDVVVITEAAALQIKDMMKQNEEEGAFIRVSIKGGGCSGLSYGMGFEHEAGEDDVQLE- 64

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           ++G+KV ++      + GT+ID+K   +  GF   NPN ++ CGCG S 
Sbjct: 65  QNGIKVVVNKQDAPILNGTKIDYKQSMMGGGFTIDNPNAIANCGCGSSF 113


>gi|24373819|ref|NP_717862.1| HesB/YadR/YfhF family protein [Shewanella oneidensis MR-1]
 gi|113970079|ref|YP_733872.1| iron-sulfur cluster assembly protein IscA [Shewanella sp. MR-4]
 gi|114047320|ref|YP_737870.1| iron-sulfur cluster assembly protein IscA [Shewanella sp. MR-7]
 gi|117920721|ref|YP_869913.1| iron-sulfur cluster assembly protein IscA [Shewanella sp. ANA-3]
 gi|24348217|gb|AAN55306.1|AE015668_7 HesB/YadR/YfhF family protein [Shewanella oneidensis MR-1]
 gi|113884763|gb|ABI38815.1| iron-sulfur cluster assembly protein IscA [Shewanella sp. MR-4]
 gi|113888762|gb|ABI42813.1| iron-sulfur cluster assembly protein IscA [Shewanella sp. MR-7]
 gi|117613053|gb|ABK48507.1| iron-sulfur cluster assembly protein IscA [Shewanella sp. ANA-3]
          Length = 107

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TMT AA  R++  + N +GK  G+R+ LK  GC+G+ Y+++ V     D +     DGV
Sbjct: 3   ITMTPAATERVRSFLAN-RGKGIGLRLGLKTSGCSGMAYVLEFVDALNDDDEVYDI-DGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID+ S +Y+ G E+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KIIIDAKSFIYLQGIELDFVKEGLNEGFQFNNPNAKGECGCGESFTV 107


>gi|311693246|gb|ADP96119.1| FeS cluster insertion [marine bacterium HP15]
          Length = 117

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 1/105 (0%)

Query: 7   MTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKV 66
            +++AV +++E++   +     +R+ +  GGC+G +Y          +   +   DGV +
Sbjct: 14  FSDSAVAKVRELIEEEENPELKLRVFVTGGGCSGFQYGFSFDESQDEEDTVIER-DGVSL 72

Query: 67  WIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +D  S  Y++G  ID++     S FV  NPN  S CGCG S  I
Sbjct: 73  LVDPMSYQYLVGATIDYQEGLQGSQFVVQNPNASSTCGCGSSFSI 117


>gi|224823934|ref|ZP_03697043.1| iron-sulfur cluster assembly protein IscA [Lutiella nitroferrum
           2002]
 gi|224604389|gb|EEG10563.1| iron-sulfur cluster assembly protein IscA [Lutiella nitroferrum
           2002]
          Length = 107

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++E A   ++  +   +GK  GIR+ +K  GC+G+ Y ++ V     D D   +  GV
Sbjct: 3   ITLSERAADHVRNFIAK-RGKGLGIRLGVKTSGCSGMAYKLEFVDVA-SDEDVTFQSHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            V+ D+ SL Y+ GTE+D+  E L  GF F+NPN  + CGCG+S  +
Sbjct: 61  TVFTDAKSLAYLDGTELDYAKEGLNEGFQFNNPNVKNECGCGESFNV 107


>gi|153878768|ref|ZP_02004679.1| Iron-sulphur cluster biosynthesis [Beggiatoa sp. PS]
 gi|152064768|gb|EDN65321.1| Iron-sulphur cluster biosynthesis [Beggiatoa sp. PS]
          Length = 107

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T+ A   +++ +  S+GK  G+R+ +K  GC+G+ Y+++   +   +        G+
Sbjct: 3   LTLTDTAAKHVQKSL-TSRGKGVGLRLGVKTSGCSGMAYVMEFADEISENDQVFESL-GI 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +D  SLLY+ GTE+DF  E L  GF F+NPN    CGCG+S  I
Sbjct: 61  KILVDPKSLLYIDGTELDFVREGLNEGFQFNNPNIKDECGCGESFNI 107


>gi|94676722|ref|YP_588679.1| HesB family protein [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
 gi|160380664|sp|Q1LTN5|ERPA_BAUCH RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|94219872|gb|ABF14031.1| HesB family protein [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
          Length = 115

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 32/114 (28%), Positives = 54/114 (47%), Gaps = 5/114 (4%)

Query: 1   MSDIV----TMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGD 56
           M++++     +T++A+ RIK ++          R+ +  GGC+GL+Y          +  
Sbjct: 1   MNEMIRFPLQLTDSAINRIKTLIAEEANPHLKFRVYITGGGCSGLQYGFTFDDKVNEEDI 60

Query: 57  DLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            +  K GV + +D  SL Y+LG  +D+      S F   NPN  + C CG S  
Sbjct: 61  AIE-KQGVVLIVDPISLQYLLGGLVDYSEGLKGSRFFIINPNVQTTCSCGSSFS 113


>gi|148560346|ref|YP_001258912.1| hesb protein [Brucella ovis ATCC 25840]
 gi|148371603|gb|ABQ61582.1| hesb protein [Brucella ovis ATCC 25840]
          Length = 168

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 61/111 (54%), Positives = 87/111 (78%), Gaps = 2/111 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++T+T+AA  R+ EI+ + +  A GIR+ +KKGGCAG+EY ++LVT+    GDDLIEKDG
Sbjct: 48  VITLTDAAANRVHEIMTSRE-DALGIRVGVKKGGCAGMEYTIELVTEA-KAGDDLIEKDG 105

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            KV+I   ++L++LGT++DF+   L +GFVF+NPNQ SACGCG+SVE+K A
Sbjct: 106 AKVFIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVELKPA 156


>gi|146276396|ref|YP_001166555.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145554637|gb|ABP69250.1| iron-sulfur cluster assembly accessory protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 118

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 73/114 (64%), Gaps = 3/114 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
              VT+T AA  +I  ++     K  G+RI +KKGGCAG+EY +D V  +    D+ +E+
Sbjct: 7   KQAVTLTPAAARQIARLMQKQGSK--GLRIGVKKGGCAGMEYTMDYV-ADINPMDETVEQ 63

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           +G +V I   + +++ GTEID++T  + SGF F NPN V ACGCG+S++ + A+
Sbjct: 64  EGARVMIAPMAQMFLFGTEIDYETGLIESGFKFRNPNVVDACGCGESIKFRDAE 117


>gi|54307947|ref|YP_128967.1| putative hesB family protein [Photobacterium profundum SS9]
 gi|46912373|emb|CAG19165.1| Putative hesB family protein [Photobacterium profundum SS9]
          Length = 107

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 70/107 (65%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+TEAA  R+   + N +GK  G+R+ ++  GC+G+ Y+++ V D   + +   EK GV
Sbjct: 3   ITITEAAASRVATFLKN-RGKGFGLRLGVRTSGCSGMAYVLEFVDDINEEDEVFEEK-GV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           ++ ID+ SL+Y+ GTE+DF  E L  GF F+NPN  S CGCG+S  +
Sbjct: 61  RIVIDAKSLVYLDGTELDFAKEGLNEGFQFNNPNVSSECGCGESFNV 107


>gi|297171167|gb|ADI22177.1| uncharacterized conserved protein [uncultured gamma proteobacterium
           HF0200_24F15]
          Length = 112

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           V +T+ AV R+  ++   +     +R+ ++ GGC+G +Y      +   D  +    +G+
Sbjct: 7   VEVTQNAVQRLMHLIAVKKKPNLMLRVFVQGGGCSGFQYGFQFEEETEEDDLEFER-NGI 65

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ ID+ S  Y++G EIDF  + + + FV  NPN  + CGCG S  I
Sbjct: 66  KLLIDTMSFQYLMGCEIDFIDDLMGTRFVVSNPNATTTCGCGSSFAI 112


>gi|164685901|ref|ZP_01945413.2| iron-sulfur cluster assembly accessory protein [Coxiella burnetii
           'MSU Goat Q177']
 gi|164601423|gb|EAX33904.2| iron-sulfur cluster assembly accessory protein [Coxiella burnetii
           'MSU Goat Q177']
          Length = 134

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 14/123 (11%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNP-------VD 54
              +  TEAA  ++K+++         +R+ +  GGC+G +Y                  
Sbjct: 11  PPTLVFTEAAARKVKDLIDEENNPYLNLRVFITGGGCSGFQYGFTFDEAINSDDLVIEKQ 70

Query: 55  GDDLIEKDG-------VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQ 107
            ++  + +G       VK+ +D  SL Y+ G EID++ +   + FV  NPN  + CGCG 
Sbjct: 71  LEEEDDDEGGTGQMALVKLLVDPLSLQYLQGAEIDYREDVSGAQFVIRNPNAKTTCGCGS 130

Query: 108 SVE 110
           S  
Sbjct: 131 SFA 133


>gi|15599007|ref|NP_252501.1| iron-binding protein IscA [Pseudomonas aeruginosa PAO1]
 gi|107103332|ref|ZP_01367250.1| hypothetical protein PaerPA_01004401 [Pseudomonas aeruginosa PACS2]
 gi|116051837|ref|YP_789320.1| putative iron-binding protein IscA [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152988741|ref|YP_001346685.1| iron-sulfur cluster assembly protein IscA [Pseudomonas aeruginosa
           PA7]
 gi|218889904|ref|YP_002438768.1| putative iron-binding protein IscA [Pseudomonas aeruginosa LESB58]
 gi|254236716|ref|ZP_04930039.1| hypothetical protein PACG_02726 [Pseudomonas aeruginosa C3719]
 gi|254242503|ref|ZP_04935825.1| hypothetical protein PA2G_03253 [Pseudomonas aeruginosa 2192]
 gi|296387672|ref|ZP_06877147.1| iron-sulfur cluster assembly protein IscA [Pseudomonas aeruginosa
           PAb1]
 gi|9949986|gb|AAG07199.1|AE004799_5 probable iron-binding protein IscA [Pseudomonas aeruginosa PAO1]
 gi|115587058|gb|ABJ13073.1| putative iron-binding protein IscA [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126168647|gb|EAZ54158.1| hypothetical protein PACG_02726 [Pseudomonas aeruginosa C3719]
 gi|126195881|gb|EAZ59944.1| hypothetical protein PA2G_03253 [Pseudomonas aeruginosa 2192]
 gi|150963899|gb|ABR85924.1| iron-sulfur cluster assembly protein IscA [Pseudomonas aeruginosa
           PA7]
 gi|218770127|emb|CAW25889.1| probable iron-binding protein IscA [Pseudomonas aeruginosa LESB58]
          Length = 107

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           ++MTEAA   ++  +   +GK +GIR+ ++  GC+GL Y+++ V +     D + E  GV
Sbjct: 3   ISMTEAAAKHVQRSLEG-RGKGEGIRLGVRTTGCSGLAYVLEFVDEL-AAEDLVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFTREGLNEGFKFNNPNVRGECGCGESFNV 107


>gi|225682593|gb|EEH20877.1| iron sulfur assembly protein [Paracoccidioides brasiliensis Pb03]
          Length = 260

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV  +++++F    K   IR+ +K  GC+GL Y ++ V       D+++E+DGV
Sbjct: 157 LTITPEAVSHLRKLIFFLDPK--LIRVGVKNRGCSGLSYNLEYVDKP-APFDEVVEQDGV 213

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+ +DS +L  ++G+E+D++ +KL S FVF NPN    CGCG+S  +
Sbjct: 214 KILVDSKALFSIIGSEMDWQEDKLASRFVFKNPNIKDQCGCGESFMV 260


>gi|172058325|ref|YP_001814785.1| iron-sulfur cluster assembly accessory protein [Exiguobacterium
           sibiricum 255-15]
 gi|171990846|gb|ACB61768.1| iron-sulfur cluster assembly accessory protein [Exiguobacterium
           sibiricum 255-15]
          Length = 116

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 60/106 (56%), Gaps = 2/106 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TEAA  ++KE++  +    Q +R+ ++ GGC+GL Y +   ++   + D   E+ G
Sbjct: 1   MIHLTEAAALQVKEMMLQAPDDEQNLRMLVQGGGCSGLSYGMGFDSE--KETDLTFEQHG 58

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           VKV +D      + G E+D+K   L  GF   NPN ++ CGCG S 
Sbjct: 59  VKVIVDQKDYPVVKGLEVDYKQSMLGGGFTITNPNAIATCGCGTSF 104


>gi|254293812|ref|YP_003059835.1| iron-sulfur cluster assembly accessory protein [Hirschia baltica
           ATCC 49814]
 gi|254042343|gb|ACT59138.1| iron-sulfur cluster assembly accessory protein [Hirschia baltica
           ATCC 49814]
          Length = 121

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 45/114 (39%), Positives = 74/114 (64%), Gaps = 3/114 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             IVT+++AA  R+KEI+      A  +R+ +K GGCAG+EY++D         D+ +  
Sbjct: 7   PKIVTLSDAAAKRVKEIMSERG--AGFLRVGVKNGGCAGMEYVMDYAQAP-EPLDERVAD 63

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
           + V++ +D+ ++L++LG++ID++   L+S FVF NPNQ  ACGCG+SV I   +
Sbjct: 64  NDVEIVVDAKAVLFLLGSQIDYEVSPLHSKFVFRNPNQTDACGCGESVTIAPFE 117


>gi|241204821|ref|YP_002975917.1| FeS assembly scaffold SufA [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240858711|gb|ACS56378.1| FeS assembly scaffold SufA [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 130

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 61/113 (53%), Positives = 83/113 (73%), Gaps = 1/113 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I++MT+ A  R+K IV NS   A+G+R+ +KKGGCAG+EY +DLVT+     D +   DG
Sbjct: 5   IMSMTDGAAARVKAIVENSGADAKGVRVGIKKGGCAGMEYTIDLVTEPNAKDDLIER-DG 63

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
            +VW++ ++ LY+LGTE+ F+T  L SGF F NPNQ SACGCG+SVE+K ADL
Sbjct: 64  ARVWVEPSAALYLLGTEMGFETTTLRSGFTFTNPNQTSACGCGESVELKPADL 116


>gi|308454527|ref|XP_003089882.1| hypothetical protein CRE_21045 [Caenorhabditis remanei]
 gi|308267972|gb|EFP11925.1| hypothetical protein CRE_21045 [Caenorhabditis remanei]
          Length = 129

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV RI+ ++      A  ++I +++ GC GL Y ++   +     D+ +E+DG+
Sbjct: 25  LTLTNDAVNRIRVLLAQQ-NDANALKIGVRQKGCNGLTYTLEYARERQK-FDEEVEQDGI 82

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KVWI+  + L +LG+E+D+ T+KL S FVF NPN    CGCG+S  I
Sbjct: 83  KVWIEPKAQLSLLGSEMDYVTDKLSSEFVFRNPNIKGTCGCGESFSI 129


>gi|146308524|ref|YP_001188989.1| iron-sulfur cluster assembly protein IscA [Pseudomonas mendocina
           ymp]
 gi|330504688|ref|YP_004381557.1| iron-sulfur cluster assembly protein IscA [Pseudomonas mendocina
           NK-01]
 gi|145576725|gb|ABP86257.1| iron-sulfur cluster assembly protein IscA [Pseudomonas mendocina
           ymp]
 gi|328918974|gb|AEB59805.1| iron-sulfur cluster assembly protein IscA [Pseudomonas mendocina
           NK-01]
          Length = 107

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 67/107 (62%), Gaps = 2/107 (1%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +TM+EAA   ++  +   +GK +GIR+ ++  GC+GL Y+++ V +     D + E  GV
Sbjct: 3   ITMSEAAARHVQRSLEG-RGKGEGIRLGVRTTGCSGLAYVLEFVDEL-AAEDQVFESHGV 60

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV ID  SL+Y+ GTE+DF  E L  GF F+NPN    CGCG+S  +
Sbjct: 61  KVIIDPKSLVYLDGTELDFVKEGLNEGFKFNNPNVRGECGCGESFNV 107


>gi|72161415|ref|YP_289072.1| HesB/YadR/YfhF [Thermobifida fusca YX]
 gi|71915147|gb|AAZ55049.1| HesB/YadR/YfhF [Thermobifida fusca YX]
          Length = 116

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           VT+T+AAV ++K ++         +R+ +  GGC+GL Y +                +GV
Sbjct: 12  VTLTDAAVEKVKSLLAQEGRDDLRLRLGVAPGGCSGLRYQLYFDERTLDGDIITDH-NGV 70

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
           ++ +D  S+ Y++G  IDF       GF   NP+  ++C CG S  
Sbjct: 71  ELAVDRYSMPYLMGATIDFVDTIEKQGFTIDNPSAQNSCACGDSFH 116


>gi|121605188|ref|YP_982517.1| iron-sulfur cluster assembly protein IscA [Polaromonas
           naphthalenivorans CJ2]
 gi|120594157|gb|ABM37596.1| iron-sulfur cluster assembly protein IscA [Polaromonas
           naphthalenivorans CJ2]
          Length = 107

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 44/111 (39%), Positives = 65/111 (58%), Gaps = 4/111 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  VT+T+AA   +   +   +GK  G+R+ +K  GC+GL Y ++   D     D + E
Sbjct: 1   MS--VTLTDAAARHVTRYMTK-RGKGVGVRLGVKTTGCSGLAYKLEYA-DEIAPEDVVFE 56

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
            +GVKV +D  S+ Y+ GT++DF  E L  GF F NPN+   CGCG+S  +
Sbjct: 57  DNGVKVLVDPKSMAYIDGTQLDFVREGLNEGFKFINPNERDRCGCGESFRV 107


>gi|52140589|ref|YP_086239.1| hypothetical protein BCZK4666 [Bacillus cereus E33L]
 gi|118480025|ref|YP_897176.1| hypothetical protein BALH_4472 [Bacillus thuringiensis str. Al
           Hakam]
 gi|51974058|gb|AAU15608.1| conserved hypothetical protein [Bacillus cereus E33L]
 gi|118419250|gb|ABK87669.1| conserved hypothetical protein [Bacillus thuringiensis str. Al
           Hakam]
          Length = 130

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 60/106 (56%), Gaps = 1/106 (0%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           ++ +TE A ++IK+++ +++   + +R+++  GGC+GL Y +    +   D   L    G
Sbjct: 14  MIEVTEQAAFQIKDMLKDAEDGEKYVRLAVHGGGCSGLSYGLGFEVEPKEDDTVLEFF-G 72

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSV 109
           V+  ID  S   + G +ID+K   L  GF   NPN +++CGCG S 
Sbjct: 73  VEFVIDKESAPIVKGVKIDYKQSMLGGGFTIDNPNAIASCGCGSSF 118


>gi|254578016|ref|XP_002494994.1| ZYRO0B00968p [Zygosaccharomyces rouxii]
 gi|238937884|emb|CAR26061.1| ZYRO0B00968p [Zygosaccharomyces rouxii]
          Length = 255

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 68/110 (61%), Gaps = 3/110 (2%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
             +++++  A+  ++ ++   + K   IRI +   GC+GL Y +  +T+     D+++E+
Sbjct: 149 KALISLSPRAMTHLRSLLDQPEPK--LIRIGVTNRGCSGLSYDLQYITEPGK-YDEIVEQ 205

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           DG+KV +DS +L  ++G+E+D+  ++L S FVF NPN    CGCG+S  +
Sbjct: 206 DGIKVIVDSKALFSVVGSEMDWIDDRLSSRFVFRNPNSKGTCGCGESFMV 255


>gi|256390862|ref|YP_003112426.1| iron-sulfur cluster assembly accessory protein [Catenulispora
           acidiphila DSM 44928]
 gi|256357088|gb|ACU70585.1| iron-sulfur cluster assembly accessory protein [Catenulispora
           acidiphila DSM 44928]
          Length = 121

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 52/106 (49%), Gaps = 1/106 (0%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T  A  ++K ++         +R++++ GGC+GL Y +     + +DGD +   DGV
Sbjct: 17  IILTAEAASKVKSLLEQEGRDDLSLRVAVQPGGCSGLRYQLYFDDRS-LDGDVVAGFDGV 75

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVE 110
            V  D  S  Y+ G  +DF       GF   NPN  S+C CG S  
Sbjct: 76  NVVTDRMSAPYLEGATVDFVDTIEKQGFTIDNPNAGSSCACGDSFS 121


>gi|148358919|ref|YP_001250126.1| hypothetical protein LPC_0804 [Legionella pneumophila str. Corby]
 gi|296106967|ref|YP_003618667.1| hypothetical protein lpa_02042 [Legionella pneumophila 2300/99
           Alcoy]
 gi|160385710|sp|A5IBN0|ERPA_LEGPC RecName: Full=Iron-sulfur cluster insertion protein erpA
 gi|148280692|gb|ABQ54780.1| conserved hypothetical protein; IscA [Legionella pneumophila str.
           Corby]
 gi|295648868|gb|ADG24715.1| putative conserved protein [Legionella pneumophila 2300/99 Alcoy]
          Length = 130

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 49/116 (42%), Gaps = 5/116 (4%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVD-----GDDLI 59
           +  + +A  ++ E++         +R+S+  GGC+G +Y          D          
Sbjct: 13  IHFSVSAADKVAELIKEEDNSNLNLRVSITGGGCSGFQYGFSFDEQINDDDTIIIQQCSD 72

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRAD 115
            K  VK+ IDS S  Y+   EID+        FV  NPN  + CGCG S  I   D
Sbjct: 73  GKSSVKLLIDSMSYQYLHDAEIDYIKGIQGEQFVIRNPNAKTTCGCGSSFSIGDED 128


>gi|259487334|tpe|CBF85927.1| TPA: iron-sulfur cluster assembly accessory protein Isa1, putative
           (AFU_orthologue; AFUA_4G10690) [Aspergillus nidulans
           FGSC A4]
          Length = 242

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           + +T  AV ++++++     + + IR+ +K  GC+GL Y ++ V       D+++E+DGV
Sbjct: 139 MKLTPIAVEQLRKLLSQ--PEPRLIRVGVKNRGCSGLAYHLEYVDKPGT-FDEVVEQDGV 195

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS +L  ++G+E+D++ +KL + FVF NPN    CGCG+S  +
Sbjct: 196 KVLIDSKALFSIIGSEMDWQEDKLSARFVFRNPNIKEECGCGESFMV 242


>gi|212542107|ref|XP_002151208.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Penicillium marneffei ATCC 18224]
 gi|210066115|gb|EEA20208.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Penicillium marneffei ATCC 18224]
          Length = 240

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 66/107 (61%), Gaps = 3/107 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T+T  AV +++ ++       + IR+ +K  GC+GL Y ++ V       D+++E+DGV
Sbjct: 137 MTLTPTAVSQLQSMLSQ--PDPKMIRVGVKNRGCSGLAYSLEYVDKPGK-FDEVVEQDGV 193

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           KV IDS +L  ++G+E+D+  +KL   FVF NPN    CGCG+S  +
Sbjct: 194 KVLIDSKALFSIIGSEMDWHEDKLSQRFVFRNPNI