RPSBLAST alignment for GI: 254781064 and conserved domain: PLN03082

>gnl|CDD|178631 PLN03082, PLN03082, Iron-sulfur cluster assembly; Provisional. Length = 163
 Score = 71.1 bits (174), Expect = 6e-14
 Identities = 41/114 (35%), Positives = 68/114 (59%), Gaps = 7/114 (6%)

Query: 3   DIVTMTEAAVYRIKEIVFNSQGKAQG--IRISLKKGGCAGLEYMVDLVTDNPVDGDDLI- 59
           D V MT+  + R+KE+   S+  A+   +R+S++ GGC+G +Y+ +L  D+  + DD + 
Sbjct: 53  DAVHMTDNCIRRLKEL-QTSEPSAEDKMLRLSVETGGCSGFQYVFEL--DDKTNSDDRVF 109

Query: 60  EKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFH-NPNQVSACGCGQSVEIK 112
           EKDGVK+ +D+ S  ++ G  +D+  E + S FV   NP+ V  C C  S  +K
Sbjct: 110 EKDGVKLVVDNISYDFVKGATVDYVEELIRSAFVVSTNPSAVGGCSCKSSFMVK 163