RPSBLAST alignment of GI: 254781064 and SCOP domain: d1nwba_

Alignment
>d1nwba_ b.124.1.1 (A:) Hypothetical protein Aq_1857 {Aquifex aeolicus [TaxId: 63363]} Length = 101
 Score = 80.2 bits (197), Expect = 4e-17
 Identities = 31/94 (32%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

Query: 4   IVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDG 63
           I  +T+ AV  IK++   +  +   +RI +  GGC+G +Y +          D + E DG
Sbjct: 9   IFKVTDKAVEEIKKVAQENNIENPILRIRVVPGGCSGFQYAMGFDDTVEEG-DHVFEYDG 67

Query: 64  VKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNP 97
           VKV ID  S+ Y+ G E+D+  + +  GF   NP
Sbjct: 68  VKVVIDPFSMPYVNGAELDYVVDFMGGGFTIRNP 101

SCOP domain information

class: All beta proteins
fold: HesB-like domain
superfamily: HesB-like domain
family: HesB-like domain
domain: Hypothetical protein Aq 1857
species: Aquifex aeolicus [TaxId: 63363]