RPSBLAST alignment for GI: 254781066 and conserved domain: TIGR00459

>gnl|CDD|129551 TIGR00459, aspS_bact, aspartyl-tRNA synthetase, bacterial type. In a multiple sequence alignment of representative asparaginyl-tRNA synthetases (asnS), archaeal/eukaryotic type aspartyl-tRNA synthetases (aspS_arch), and bacterial type aspartyl-tRNA synthetases (aspS_bact), there is a striking similarity between asnS and aspS_arch in gap pattern and in sequence, and a striking divergence of aspS_bact. Consequently, a separate model was built for each of the three groups. This model, aspS_bact, represents aspartyl-tRNA synthetases from the Bacteria and from mitochondria. In some species, this enzyme aminoacylates tRNA for both Asp and Asn; Asp-tRNA(asn) is subsequently transamidated to Asn-tRNA(asn). This model generates very low scores for the archaeal type of aspS and for asnS; scores between the trusted and noise cutoffs represent fragmentary sequences. Length = 583
 Score = 44.0 bits (104), Expect = 5e-05
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 6/69 (8%)

Query: 288 FEKEMQEKK----KIYNETYPIDEDFLACLTEM--PQSSGIAMGFDRLVMLVTGANNINE 341
            + E+Q+K      I  E       FL    +   P  +G A+G DRL+ML+TG +NI +
Sbjct: 487 HDPEVQKKVFEILGIDPEEAREKFGFLLEAFKYGTPPHAGFALGLDRLMMLLTGTDNIRD 546

Query: 342 VIWTPFSQS 350
           VI  P + +
Sbjct: 547 VIAFPKTTA 555