RPSBLAST alignment for GI: 254781066 and conserved domain: PLN02903

>gnl|CDD|178491 PLN02903, PLN02903, aminoacyl-tRNA ligase. Length = 652
 Score = 41.3 bits (97), Expect = 4e-04
 Identities = 18/36 (50%), Positives = 23/36 (63%)

Query: 317 PQSSGIAMGFDRLVMLVTGANNINEVIWTPFSQSNQ 352
           P   GIA G DRLVML+ GA +I +VI  P + + Q
Sbjct: 590 PPHGGIAYGLDRLVMLLAGAKSIRDVIAFPKTTTAQ 625