RPSBLAST alignment of GI: 254781066 and protein with PDBid: 1c0a

>1c0a_A Aspartyl tRNA synthetase; protein-RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* Length = 585
 Score = 81.4 bits (200), Expect = 3e-16
 Identities = 25/123 (20%), Positives = 44/123 (35%), Gaps = 5/123 (4%)

Query: 231 GINCCTILDRYPAPESALANIYPADPRFTKRFELYACNIELCNACDELLDPIEQRHRFEK 290
           G+         P   +A       +      +++     E+      + +   Q+  F  
Sbjct: 443 GLTAMHHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGI 502

Query: 291 EMQEKKKIYNETYPIDEDFLACLTE-MPQSSGIAMGFDRLVMLVTGANNINEVIWTPFSQ 349
               ++    E        L  L    P  +G+A G DRL ML+TG +NI +VI  P + 
Sbjct: 503 LGINEE----EQREKFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTT 558

Query: 350 SNQ 352
           +  
Sbjct: 559 AAA 561