BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781068|ref|YP_003065481.1| hypothetical protein CLIBASIA_04850 [Candidatus Liberibacter asiaticus str. psy62] (43 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254781068|ref|YP_003065481.1| hypothetical protein CLIBASIA_04850 [Candidatus Liberibacter asiaticus str. psy62] gi|254040745|gb|ACT57541.1| hypothetical protein CLIBASIA_04850 [Candidatus Liberibacter asiaticus str. psy62] Length = 43 Score = 89.4 bits (220), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 43/43 (100%), Positives = 43/43 (100%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER Sbjct: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 >gi|54294135|ref|YP_126550.1| hypothetical protein lpl1199 [Legionella pneumophila str. Lens] gi|53753967|emb|CAH15438.1| hypothetical protein lpl1199 [Legionella pneumophila str. Lens] Length = 382 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/43 (44%), Positives = 31/43 (72%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D SPIA AI+ IGGV+ FD++ + +++ +NI+NP Q+ R Sbjct: 47 VDEKSPIAQAIEKNNIGGVILFDFNQQSQTFNKNIENPEQVNR 89 >gi|317154368|ref|YP_004122416.1| glycoside hydrolase family 3 domain-containing protein [Desulfovibrio aespoeensis Aspo-2] gi|316944619|gb|ADU63670.1| glycoside hydrolase family 3 domain protein [Desulfovibrio aespoeensis Aspo-2] Length = 379 Score = 45.1 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 21/43 (48%), Positives = 25/43 (58%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D SPI I+ R +GGVV FDYD S RNI P Q+ R Sbjct: 58 VDEQSPIVRDIRERNLGGVVLFDYDVALASPNRNIDTPAQVAR 100 >gi|298529404|ref|ZP_07016807.1| glycoside hydrolase family 3 domain protein [Desulfonatronospira thiodismutans ASO3-1] gi|298510840|gb|EFI34743.1| glycoside hydrolase family 3 domain protein [Desulfonatronospira thiodismutans ASO3-1] Length = 372 Score = 45.1 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 21/43 (48%), Positives = 29/43 (67%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D +SPI IQN +GGVV FDYD +S RN+++P QL + Sbjct: 49 VDENSPIVRDIQNGLVGGVVLFDYDVALESPARNVQSPDQLRK 91 >gi|21672931|ref|NP_660996.1| glycosy hydrolase family protein [Chlorobium tepidum TLS] gi|21645987|gb|AAM71338.1| glycosyl hydrolase, family 3 [Chlorobium tepidum TLS] Length = 372 Score = 44.3 bits (103), Expect = 0.005, Method: Compositional matrix adjust. Identities = 23/39 (58%), Positives = 26/39 (66%) Query: 5 SPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 S IA I+ R IGGVV FDYD KS RNI++P QL R Sbjct: 49 SAIAADIRERGIGGVVLFDYDVPSKSPIRNIESPEQLRR 87 >gi|78189925|ref|YP_380263.1| glycosy hydrolase family protein [Chlorobium chlorochromatii CaD3] gi|78172124|gb|ABB29220.1| glycosyl hydrolase, family 3 [Chlorobium chlorochromatii CaD3] Length = 374 Score = 43.5 bits (101), Expect = 0.009, Method: Composition-based stats. Identities = 23/43 (53%), Positives = 25/43 (58%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 + S I AIQ R IGGVV FDYD S RNI +P QL R Sbjct: 48 LAESPQIVAAIQKRHIGGVVLFDYDVPFASPTRNITSPSQLAR 90 >gi|52841424|ref|YP_095223.1| glycosy hydrolase family protein [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|52628535|gb|AAU27276.1| glycosyl hydrolase family 3 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] Length = 395 Score = 43.5 bits (101), Expect = 0.009, Method: Compositional matrix adjust. Identities = 18/43 (41%), Positives = 31/43 (72%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D SPIA AI+ IGGV+ FD++ + +++ +NI++P Q+ R Sbjct: 60 VDEKSPIAQAIEKNNIGGVILFDFNQQSQTFDKNIESPEQVNR 102 >gi|307609946|emb|CBW99474.1| hypothetical protein LPW_12471 [Legionella pneumophila 130b] Length = 378 Score = 43.5 bits (101), Expect = 0.010, Method: Compositional matrix adjust. Identities = 18/43 (41%), Positives = 31/43 (72%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D SPIA AI+ IGGV+ FD++ + +++ +NI++P Q+ R Sbjct: 43 VDEKSPIAQAIEKNNIGGVILFDFNQQSQTFDKNIESPEQVNR 85 >gi|194337785|ref|YP_002019579.1| Beta-N-acetylhexosaminidase [Pelodictyon phaeoclathratiforme BU-1] gi|194310262|gb|ACF44962.1| Beta-N-acetylhexosaminidase [Pelodictyon phaeoclathratiforme BU-1] Length = 375 Score = 42.4 bits (98), Expect = 0.022, Method: Composition-based stats. Identities = 20/33 (60%), Positives = 22/33 (66%) Query: 11 IQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 I+ RQIGGVV FDYD S RNI +P QL R Sbjct: 58 IRERQIGGVVLFDYDVPSHSTSRNISSPEQLAR 90 >gi|332701405|ref|ZP_08421493.1| Beta-N-acetylhexosaminidase [Desulfovibrio africanus str. Walvis Bay] gi|332551554|gb|EGJ48598.1| Beta-N-acetylhexosaminidase [Desulfovibrio africanus str. Walvis Bay] Length = 381 Score = 42.4 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 19/43 (44%), Positives = 28/43 (65%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D SPIA ++ ++GGV+ FDYD KS RN+++ QL R Sbjct: 54 LDEDSPIAQDVRTGRVGGVILFDYDVLLKSPVRNVQSKEQLTR 96 >gi|148358777|ref|YP_001249984.1| glycosyl hydrolase family transporter 3 [Legionella pneumophila str. Corby] gi|148280550|gb|ABQ54638.1| glycosyl hydrolase family 3 [Legionella pneumophila str. Corby] Length = 382 Score = 42.0 bits (97), Expect = 0.030, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 31/43 (72%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D SPIA AI+ IGGV+ FD++ + +++ +NI++P Q+ + Sbjct: 47 VDEKSPIAQAIEKNNIGGVILFDFNQQSQTFDKNIESPEQVNQ 89 >gi|296106822|ref|YP_003618522.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] gi|295648723|gb|ADG24570.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] Length = 378 Score = 42.0 bits (97), Expect = 0.032, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 31/43 (72%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D SPIA AI+ IGGV+ FD++ + +++ +NI++P Q+ + Sbjct: 43 VDEKSPIAQAIEKNNIGGVILFDFNQQSQTFDKNIESPEQVNQ 85 >gi|54297148|ref|YP_123517.1| hypothetical protein lpp1193 [Legionella pneumophila str. Paris] gi|53750933|emb|CAH12344.1| hypothetical protein lpp1193 [Legionella pneumophila str. Paris] Length = 382 Score = 42.0 bits (97), Expect = 0.032, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 31/43 (72%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D SPIA AI+ IGGV+ FD++ + +++ +NI++P Q+ + Sbjct: 47 VDEKSPIAQAIEKNNIGGVILFDFNQQSQTFDKNIESPEQVNQ 89 >gi|193213634|ref|YP_001999587.1| glycoside hydrolase family 3 domain-containing protein [Chlorobaculum parvum NCIB 8327] gi|193087111|gb|ACF12387.1| glycoside hydrolase family 3 domain protein [Chlorobaculum parvum NCIB 8327] Length = 373 Score = 41.6 bits (96), Expect = 0.032, Method: Compositional matrix adjust. Identities = 23/45 (51%), Positives = 30/45 (66%), Gaps = 2/45 (4%) Query: 1 MDSSSPIAL--AIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D+SS A A++ QIGGVV FDYD KS RNI++P Q+ R Sbjct: 43 LDASSDPAFEKALRAGQIGGVVLFDYDVPSKSPVRNIESPKQVRR 87 >gi|270157239|ref|ZP_06185896.1| glycosyl hydrolase [Legionella longbeachae D-4968] gi|289164364|ref|YP_003454502.1| N-acetyl-beta-glucosaminidase [Legionella longbeachae NSW150] gi|269989264|gb|EEZ95518.1| glycosyl hydrolase [Legionella longbeachae D-4968] gi|288857537|emb|CBJ11375.1| putative N-acetyl-beta-glucosaminidase [Legionella longbeachae NSW150] Length = 380 Score = 41.2 bits (95), Expect = 0.052, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 28/41 (68%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQL 41 ++S SPI I+ IGGV+ FDY++ +++ +NI+ P Q+ Sbjct: 44 VNSQSPIVKTIEKDNIGGVILFDYNYHSRNFDKNIETPEQV 84 >gi|118580772|ref|YP_902022.1| glycoside hydrolase family 3 protein [Pelobacter propionicus DSM 2379] gi|118503482|gb|ABK99964.1| glycoside hydrolase, family 3 domain protein [Pelobacter propionicus DSM 2379] Length = 393 Score = 40.8 bits (94), Expect = 0.063, Method: Composition-based stats. Identities = 19/39 (48%), Positives = 26/39 (66%) Query: 5 SPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 SPI++AI+ +GGVV FD + +RNI NP QL+R Sbjct: 72 SPISVAIREHGVGGVVLFDNNADLGVTERNISNPAQLKR 110 >gi|189347885|ref|YP_001944414.1| Beta-N-acetylhexosaminidase [Chlorobium limicola DSM 245] gi|189342032|gb|ACD91435.1| Beta-N-acetylhexosaminidase [Chlorobium limicola DSM 245] Length = 373 Score = 40.4 bits (93), Expect = 0.091, Method: Compositional matrix adjust. Identities = 21/37 (56%), Positives = 23/37 (62%) Query: 7 IALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 IA I+ R IGGVV FDYD KS RNI P QL + Sbjct: 52 IADDIRKRHIGGVVLFDYDVPLKSPVRNIAGPEQLSK 88 >gi|145220500|ref|YP_001131209.1| Beta-N-acetylhexosaminidase [Prosthecochloris vibrioformis DSM 265] gi|145206664|gb|ABP37707.1| Beta-N-acetylhexosaminidase [Chlorobium phaeovibrioides DSM 265] Length = 382 Score = 40.0 bits (92), Expect = 0.095, Method: Composition-based stats. Identities = 21/39 (53%), Positives = 24/39 (61%) Query: 3 SSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQL 41 SS I AI+ IGGVV FDYD +S RNI +P QL Sbjct: 51 SSPDIQRAIRENHIGGVVLFDYDVPSRSRPRNIVSPEQL 89 >gi|153872350|ref|ZP_02001271.1| conserved hypothetical protein [Beggiatoa sp. PS] gi|152071182|gb|EDN68727.1| conserved hypothetical protein [Beggiatoa sp. PS] Length = 403 Score = 40.0 bits (92), Expect = 0.12, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 26/33 (78%) Query: 11 IQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 I+NR IGG++ F+YD +KS RNI++P Q+++ Sbjct: 90 IRNRHIGGILLFNYDVAQKSPVRNIQSPAQVKK 122 >gi|307353677|ref|YP_003894728.1| glycoside hydrolase family 3 domain-containing protein [Methanoplanus petrolearius DSM 11571] gi|307156910|gb|ADN36290.1| glycoside hydrolase family 3 domain protein [Methanoplanus petrolearius DSM 11571] Length = 399 Score = 39.3 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 27/40 (67%) Query: 2 DSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQL 41 D+ S IA I+N ++GGV+ FD D S +RNIK+P Q+ Sbjct: 73 DNDSQIADDIRNGRVGGVILFDRDVALNSSERNIKSPEQV 112 >gi|95929642|ref|ZP_01312384.1| glycoside hydrolase, family 3-like [Desulfuromonas acetoxidans DSM 684] gi|95134339|gb|EAT15996.1| glycoside hydrolase, family 3-like [Desulfuromonas acetoxidans DSM 684] Length = 411 Score = 39.3 bits (90), Expect = 0.18, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 23/33 (69%) Query: 11 IQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 IQ R +GGV+ FDYD + + RNI +P QL++ Sbjct: 71 IQKRHLGGVILFDYDVQLRQSGRNIASPSQLKQ 103 >gi|189423788|ref|YP_001950965.1| beta-N-acetylhexosaminidase [Geobacter lovleyi SZ] gi|189420047|gb|ACD94445.1| Beta-N-acetylhexosaminidase [Geobacter lovleyi SZ] Length = 392 Score = 39.3 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 28/42 (66%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLE 42 +D S+ I I++ +IGG + FD D K K+Y RNI +P QL+ Sbjct: 68 LDDSNYIVRDIRDYRIGGTILFDRDAKLKTYGRNIVSPEQLQ 109 >gi|256830691|ref|YP_003159419.1| beta-N-acetylhexosaminidase [Desulfomicrobium baculatum DSM 4028] gi|256579867|gb|ACU91003.1| Beta-N-acetylhexosaminidase [Desulfomicrobium baculatum DSM 4028] Length = 382 Score = 38.9 bits (89), Expect = 0.23, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 28/41 (68%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQL 41 +D +SPI I+ +GGV+ FD D + +S +RNI++P Q+ Sbjct: 49 VDGASPILRDIREHNLGGVILFDRDVQLQSPERNIQSPEQV 89 >gi|153864860|ref|ZP_01997612.1| glycosyl hydrolase [Beggiatoa sp. SS] gi|152145645|gb|EDN72388.1| glycosyl hydrolase [Beggiatoa sp. SS] Length = 340 Score = 38.9 bits (89), Expect = 0.24, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 26/42 (61%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLE 42 M PI I+ IGGVV F+YD ++S RNI++P Q++ Sbjct: 94 MSHDDPIVQDIREHHIGGVVLFNYDVARQSPVRNIQSPQQVK 135 >gi|193213964|ref|YP_001995163.1| beta-N-acetylhexosaminidase [Chloroherpeton thalassium ATCC 35110] gi|193087441|gb|ACF12716.1| Beta-N-acetylhexosaminidase [Chloroherpeton thalassium ATCC 35110] Length = 384 Score = 38.9 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 26/38 (68%) Query: 4 SSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQL 41 SS + + I+ ++IGGV+ FDYD K RNI++P Q+ Sbjct: 62 SSKVIVDIRQQRIGGVILFDYDLPLKQASRNIQSPEQV 99 >gi|78187897|ref|YP_375940.1| glycosy hydrolase family protein [Chlorobium luteolum DSM 273] gi|78167799|gb|ABB24897.1| glycosyl hydrolase, family 3 [Chlorobium luteolum DSM 273] Length = 378 Score = 38.1 bits (87), Expect = 0.36, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%) Query: 10 AIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 AI ++IGGVV FDYD ++ RNI P QL+R Sbjct: 59 AIDRQRIGGVVLFDYDVPSRTPLRNITGPEQLQR 92 >gi|254495931|ref|ZP_05108839.1| glycosy hydrolase family protein [Legionella drancourtii LLAP12] gi|254354809|gb|EET13436.1| glycosy hydrolase family protein [Legionella drancourtii LLAP12] Length = 379 Score = 37.7 bits (86), Expect = 0.59, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 29/43 (67%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 ++S S I I IGGV+ FDY+ + +S+ +NI++P Q+++ Sbjct: 44 INSQSEIVKIIDKNNIGGVILFDYNAQTQSFDKNIESPAQVKQ 86 >gi|153872146|ref|ZP_02001121.1| glycosyl hydrolase, family 3 [Beggiatoa sp. PS] gi|152071386|gb|EDN68877.1| glycosyl hydrolase, family 3 [Beggiatoa sp. PS] Length = 436 Score = 37.0 bits (84), Expect = 0.86, Method: Compositional matrix adjust. Identities = 17/32 (53%), Positives = 23/32 (71%) Query: 11 IQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLE 42 IQ +GGV+ FDYD KS +RNIK+P Q++ Sbjct: 118 IQQFHLGGVILFDYDIVLKSSRRNIKSPRQVK 149 >gi|296444426|ref|ZP_06886391.1| Beta-N-acetylhexosaminidase [Methylosinus trichosporium OB3b] gi|296258073|gb|EFH05135.1| Beta-N-acetylhexosaminidase [Methylosinus trichosporium OB3b] Length = 330 Score = 36.6 bits (83), Expect = 1.0, Method: Composition-based stats. Identities = 15/26 (57%), Positives = 19/26 (73%) Query: 16 IGGVVRFDYDFKKKSYQRNIKNPIQL 41 +GGV+ FDYD K Y+RNI +P QL Sbjct: 31 LGGVILFDYDCIDKKYERNIFDPAQL 56 >gi|110597288|ref|ZP_01385576.1| Beta-N-acetylhexosaminidase [Chlorobium ferrooxidans DSM 13031] gi|110341124|gb|EAT59592.1| Beta-N-acetylhexosaminidase [Chlorobium ferrooxidans DSM 13031] Length = 389 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 20/38 (52%), Positives = 23/38 (60%) Query: 4 SSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQL 41 S IA I R+IGGVV FDYD + RNI +P QL Sbjct: 65 SPGIAEDILERRIGGVVLFDYDVPLHAPSRNISSPEQL 102 >gi|119358346|ref|YP_912990.1| glycoside hydrolase family 3 protein [Chlorobium phaeobacteroides DSM 266] gi|119355695|gb|ABL66566.1| glycoside hydrolase, family 3 domain protein [Chlorobium phaeobacteroides DSM 266] Length = 375 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 19/43 (44%), Positives = 26/43 (60%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 + S IA I+ ++IGGVV FDYD +S RNI P +L + Sbjct: 48 LAESPQIASDIRRQRIGGVVLFDYDVPSRSPIRNITTPSRLMK 90 >gi|189501346|ref|YP_001960816.1| Beta-N-acetylhexosaminidase [Chlorobium phaeobacteroides BS1] gi|189496787|gb|ACE05335.1| Beta-N-acetylhexosaminidase [Chlorobium phaeobacteroides BS1] Length = 373 Score = 36.2 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 21/33 (63%) Query: 11 IQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 I R +GGVV FDYD KS RNI + QL++ Sbjct: 56 ITKRHLGGVVLFDYDVPSKSTGRNITSREQLQK 88 >gi|194334961|ref|YP_002016821.1| beta-N-acetylhexosaminidase [Prosthecochloris aestuarii DSM 271] gi|194312779|gb|ACF47174.1| Beta-N-acetylhexosaminidase [Prosthecochloris aestuarii DSM 271] Length = 375 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 21/31 (67%) Query: 11 IQNRQIGGVVRFDYDFKKKSYQRNIKNPIQL 41 I +++IGGV+ FDYD S RNI +P QL Sbjct: 58 IASKRIGGVILFDYDVPSASTTRNIASPGQL 88 >gi|323700659|ref|ZP_08112571.1| glycoside hydrolase family 3 domain protein [Desulfovibrio sp. ND132] gi|323460591|gb|EGB16456.1| glycoside hydrolase family 3 domain protein [Desulfovibrio desulfuricans ND132] Length = 380 Score = 35.4 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 26/43 (60%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 ++ S I I+ R +GGV+ FDYD + QRNI++ Q+ R Sbjct: 59 VNQRSTIVRDIRERHLGGVILFDYDMFWGAGQRNIRSVEQVRR 101 >gi|77918922|ref|YP_356737.1| putative glycosyl hydrolase [Pelobacter carbinolicus DSM 2380] gi|77545005|gb|ABA88567.1| putative glycosyl hydrolase [Pelobacter carbinolicus DSM 2380] Length = 382 Score = 35.0 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 24/43 (55%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D PI I+ R +GGVV F+Y + NI++P QL R Sbjct: 54 LDKHHPILEDIKQRHLGGVVLFNYGPDRNHPAGNIRSPQQLRR 96 >gi|52841120|ref|YP_094919.1| glycosyl hydrolase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|54296905|ref|YP_123274.1| hypothetical protein lpp0946 [Legionella pneumophila str. Paris] gi|52628231|gb|AAU26972.1| glycosyl hydrolase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|53750690|emb|CAH12097.1| hypothetical protein lpp0946 [Legionella pneumophila str. Paris] Length = 358 Score = 34.7 bits (78), Expect = 4.4, Method: Compositional matrix adjust. Identities = 14/43 (32%), Positives = 26/43 (60%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 + +SP+A + N +GGV+ FD D Y +N++N Q+++ Sbjct: 21 LHDNSPVAQWLSNDGLGGVLLFDKDLSTGIYGKNLRNQAQIKQ 63 >gi|54293860|ref|YP_126275.1| hypothetical protein lpl0916 [Legionella pneumophila str. Lens] gi|53753692|emb|CAH15150.1| hypothetical protein lpl0916 [Legionella pneumophila str. Lens] Length = 358 Score = 34.7 bits (78), Expect = 4.5, Method: Compositional matrix adjust. Identities = 14/41 (34%), Positives = 24/41 (58%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQL 41 + +SP+A + N +GGV+ FD D Y +N++N Q+ Sbjct: 21 LHDNSPVAQWLSNDGLGGVLLFDKDLSTGIYGKNLRNQTQI 61 >gi|307609676|emb|CBW99184.1| hypothetical protein LPW_09671 [Legionella pneumophila 130b] Length = 358 Score = 34.3 bits (77), Expect = 5.6, Method: Compositional matrix adjust. Identities = 14/41 (34%), Positives = 24/41 (58%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQL 41 + +SP+A + N +GGV+ FD D Y +N++N Q+ Sbjct: 21 LHDNSPVAQWLSNDGLGGVLLFDKDLSTGIYGKNLRNQAQI 61 >gi|254457746|ref|ZP_05071174.1| B-N-acetylglucosaminidase, glycoside hydrolase family 3 protein [Campylobacterales bacterium GD 1] gi|207086538|gb|EDZ63822.1| B-N-acetylglucosaminidase, glycoside hydrolase family 3 protein [Campylobacterales bacterium GD 1] Length = 555 Score = 34.3 bits (77), Expect = 5.7, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 28/43 (65%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +++++ I IQ ++GGVV FD +KK+S +NI P QL+ Sbjct: 38 VNNNTEIVEYIQQYELGGVVLFDRFYKKRSQIKNIDTPEQLQE 80 >gi|254495607|ref|ZP_05108529.1| glycosyl hydrolase [Legionella drancourtii LLAP12] gi|254355177|gb|EET13790.1| glycosyl hydrolase [Legionella drancourtii LLAP12] Length = 358 Score = 34.3 bits (77), Expect = 6.6, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 23/38 (60%) Query: 5 SPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLE 42 SP+A + +GGV+ FD D +Y +N+KN Q++ Sbjct: 25 SPVAEWLSQDGLGGVILFDQDVSTGTYGKNLKNQAQIK 62 >gi|148360469|ref|YP_001251676.1| glycosyl hydrolase [Legionella pneumophila str. Corby] gi|296106464|ref|YP_003618164.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] gi|148282242|gb|ABQ56330.1| glycosyl hydrolase [Legionella pneumophila str. Corby] gi|295648365|gb|ADG24212.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] Length = 358 Score = 33.9 bits (76), Expect = 8.1, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 25/43 (58%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 + +SP+A + N +GGV+ FD D Y +N++N Q+ + Sbjct: 21 LHDNSPVAQWLSNDGLGGVLLFDKDLSTGIYGKNLRNQAQIRQ 63 Searching..................................................done Results from round 2 >gi|254781068|ref|YP_003065481.1| hypothetical protein CLIBASIA_04850 [Candidatus Liberibacter asiaticus str. psy62] gi|254040745|gb|ACT57541.1| hypothetical protein CLIBASIA_04850 [Candidatus Liberibacter asiaticus str. psy62] Length = 43 Score = 81.2 bits (199), Expect = 5e-14, Method: Composition-based stats. Identities = 43/43 (100%), Positives = 43/43 (100%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER Sbjct: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 >gi|54294135|ref|YP_126550.1| hypothetical protein lpl1199 [Legionella pneumophila str. Lens] gi|53753967|emb|CAH15438.1| hypothetical protein lpl1199 [Legionella pneumophila str. Lens] Length = 382 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 19/43 (44%), Positives = 31/43 (72%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D SPIA AI+ IGGV+ FD++ + +++ +NI+NP Q+ R Sbjct: 47 VDEKSPIAQAIEKNNIGGVILFDFNQQSQTFNKNIENPEQVNR 89 >gi|298529404|ref|ZP_07016807.1| glycoside hydrolase family 3 domain protein [Desulfonatronospira thiodismutans ASO3-1] gi|298510840|gb|EFI34743.1| glycoside hydrolase family 3 domain protein [Desulfonatronospira thiodismutans ASO3-1] Length = 372 Score = 46.2 bits (108), Expect = 0.001, Method: Composition-based stats. Identities = 21/43 (48%), Positives = 29/43 (67%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D +SPI IQN +GGVV FDYD +S RN+++P QL + Sbjct: 49 VDENSPIVRDIQNGLVGGVVLFDYDVALESPARNVQSPDQLRK 91 >gi|52841424|ref|YP_095223.1| glycosy hydrolase family protein [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|52628535|gb|AAU27276.1| glycosyl hydrolase family 3 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] Length = 395 Score = 46.2 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 18/43 (41%), Positives = 31/43 (72%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D SPIA AI+ IGGV+ FD++ + +++ +NI++P Q+ R Sbjct: 60 VDEKSPIAQAIEKNNIGGVILFDFNQQSQTFDKNIESPEQVNR 102 >gi|307609946|emb|CBW99474.1| hypothetical protein LPW_12471 [Legionella pneumophila 130b] Length = 378 Score = 46.2 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 18/43 (41%), Positives = 31/43 (72%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D SPIA AI+ IGGV+ FD++ + +++ +NI++P Q+ R Sbjct: 43 VDEKSPIAQAIEKNNIGGVILFDFNQQSQTFDKNIESPEQVNR 85 >gi|317154368|ref|YP_004122416.1| glycoside hydrolase family 3 domain-containing protein [Desulfovibrio aespoeensis Aspo-2] gi|316944619|gb|ADU63670.1| glycoside hydrolase family 3 domain protein [Desulfovibrio aespoeensis Aspo-2] Length = 379 Score = 45.0 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 21/43 (48%), Positives = 25/43 (58%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D SPI I+ R +GGVV FDYD S RNI P Q+ R Sbjct: 58 VDEQSPIVRDIRERNLGGVVLFDYDVALASPNRNIDTPAQVAR 100 >gi|21672931|ref|NP_660996.1| glycosy hydrolase family protein [Chlorobium tepidum TLS] gi|21645987|gb|AAM71338.1| glycosyl hydrolase, family 3 [Chlorobium tepidum TLS] Length = 372 Score = 45.0 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 23/39 (58%), Positives = 26/39 (66%) Query: 5 SPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 S IA I+ R IGGVV FDYD KS RNI++P QL R Sbjct: 49 SAIAADIRERGIGGVVLFDYDVPSKSPIRNIESPEQLRR 87 >gi|78189925|ref|YP_380263.1| glycosy hydrolase family protein [Chlorobium chlorochromatii CaD3] gi|78172124|gb|ABB29220.1| glycosyl hydrolase, family 3 [Chlorobium chlorochromatii CaD3] Length = 374 Score = 45.0 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 23/43 (53%), Positives = 25/43 (58%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 + S I AIQ R IGGVV FDYD S RNI +P QL R Sbjct: 48 LAESPQIVAAIQKRHIGGVVLFDYDVPFASPTRNITSPSQLAR 90 >gi|296106822|ref|YP_003618522.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] gi|295648723|gb|ADG24570.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] Length = 378 Score = 44.3 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 31/43 (72%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D SPIA AI+ IGGV+ FD++ + +++ +NI++P Q+ + Sbjct: 43 VDEKSPIAQAIEKNNIGGVILFDFNQQSQTFDKNIESPEQVNQ 85 >gi|148358777|ref|YP_001249984.1| glycosyl hydrolase family transporter 3 [Legionella pneumophila str. Corby] gi|148280550|gb|ABQ54638.1| glycosyl hydrolase family 3 [Legionella pneumophila str. Corby] Length = 382 Score = 44.3 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 31/43 (72%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D SPIA AI+ IGGV+ FD++ + +++ +NI++P Q+ + Sbjct: 47 VDEKSPIAQAIEKNNIGGVILFDFNQQSQTFDKNIESPEQVNQ 89 >gi|54297148|ref|YP_123517.1| hypothetical protein lpp1193 [Legionella pneumophila str. Paris] gi|53750933|emb|CAH12344.1| hypothetical protein lpp1193 [Legionella pneumophila str. Paris] Length = 382 Score = 44.3 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 31/43 (72%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D SPIA AI+ IGGV+ FD++ + +++ +NI++P Q+ + Sbjct: 47 VDEKSPIAQAIEKNNIGGVILFDFNQQSQTFDKNIESPEQVNQ 89 >gi|194337785|ref|YP_002019579.1| Beta-N-acetylhexosaminidase [Pelodictyon phaeoclathratiforme BU-1] gi|194310262|gb|ACF44962.1| Beta-N-acetylhexosaminidase [Pelodictyon phaeoclathratiforme BU-1] Length = 375 Score = 43.5 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 20/33 (60%), Positives = 22/33 (66%) Query: 11 IQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 I+ RQIGGVV FDYD S RNI +P QL R Sbjct: 58 IRERQIGGVVLFDYDVPSHSTSRNISSPEQLAR 90 >gi|270157239|ref|ZP_06185896.1| glycosyl hydrolase [Legionella longbeachae D-4968] gi|289164364|ref|YP_003454502.1| N-acetyl-beta-glucosaminidase [Legionella longbeachae NSW150] gi|269989264|gb|EEZ95518.1| glycosyl hydrolase [Legionella longbeachae D-4968] gi|288857537|emb|CBJ11375.1| putative N-acetyl-beta-glucosaminidase [Legionella longbeachae NSW150] Length = 380 Score = 43.1 bits (100), Expect = 0.013, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 29/43 (67%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 ++S SPI I+ IGGV+ FDY++ +++ +NI+ P Q+ + Sbjct: 44 VNSQSPIVKTIEKDNIGGVILFDYNYHSRNFDKNIETPEQVRQ 86 >gi|193213634|ref|YP_001999587.1| glycoside hydrolase family 3 domain-containing protein [Chlorobaculum parvum NCIB 8327] gi|193087111|gb|ACF12387.1| glycoside hydrolase family 3 domain protein [Chlorobaculum parvum NCIB 8327] Length = 373 Score = 42.7 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 23/45 (51%), Positives = 30/45 (66%), Gaps = 2/45 (4%) Query: 1 MDSSSPIAL--AIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D+SS A A++ QIGGVV FDYD KS RNI++P Q+ R Sbjct: 43 LDASSDPAFEKALRAGQIGGVVLFDYDVPSKSPVRNIESPKQVRR 87 >gi|153872350|ref|ZP_02001271.1| conserved hypothetical protein [Beggiatoa sp. PS] gi|152071182|gb|EDN68727.1| conserved hypothetical protein [Beggiatoa sp. PS] Length = 403 Score = 42.0 bits (97), Expect = 0.026, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 29/42 (69%) Query: 2 DSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 D+ I I+NR IGG++ F+YD +KS RNI++P Q+++ Sbjct: 81 DNDDFIVQDIRNRHIGGILLFNYDVAQKSPVRNIQSPAQVKK 122 >gi|332701405|ref|ZP_08421493.1| Beta-N-acetylhexosaminidase [Desulfovibrio africanus str. Walvis Bay] gi|332551554|gb|EGJ48598.1| Beta-N-acetylhexosaminidase [Desulfovibrio africanus str. Walvis Bay] Length = 381 Score = 42.0 bits (97), Expect = 0.029, Method: Composition-based stats. Identities = 19/43 (44%), Positives = 28/43 (65%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 +D SPIA ++ ++GGV+ FDYD KS RN+++ QL R Sbjct: 54 LDEDSPIAQDVRTGRVGGVILFDYDVLLKSPVRNVQSKEQLTR 96 >gi|145220500|ref|YP_001131209.1| Beta-N-acetylhexosaminidase [Prosthecochloris vibrioformis DSM 265] gi|145206664|gb|ABP37707.1| Beta-N-acetylhexosaminidase [Chlorobium phaeovibrioides DSM 265] Length = 382 Score = 41.2 bits (95), Expect = 0.048, Method: Composition-based stats. Identities = 21/39 (53%), Positives = 24/39 (61%) Query: 3 SSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQL 41 SS I AI+ IGGVV FDYD +S RNI +P QL Sbjct: 51 SSPDIQRAIRENHIGGVVLFDYDVPSRSRPRNIVSPEQL 89 >gi|118580772|ref|YP_902022.1| glycoside hydrolase family 3 protein [Pelobacter propionicus DSM 2379] gi|118503482|gb|ABK99964.1| glycoside hydrolase, family 3 domain protein [Pelobacter propionicus DSM 2379] Length = 393 Score = 41.2 bits (95), Expect = 0.049, Method: Composition-based stats. Identities = 19/39 (48%), Positives = 26/39 (66%) Query: 5 SPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 SPI++AI+ +GGVV FD + +RNI NP QL+R Sbjct: 72 SPISVAIREHGVGGVVLFDNNADLGVTERNISNPAQLKR 110 >gi|189347885|ref|YP_001944414.1| Beta-N-acetylhexosaminidase [Chlorobium limicola DSM 245] gi|189342032|gb|ACD91435.1| Beta-N-acetylhexosaminidase [Chlorobium limicola DSM 245] Length = 373 Score = 40.8 bits (94), Expect = 0.071, Method: Composition-based stats. Identities = 21/37 (56%), Positives = 23/37 (62%) Query: 7 IALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 IA I+ R IGGVV FDYD KS RNI P QL + Sbjct: 52 IADDIRKRHIGGVVLFDYDVPLKSPVRNIAGPEQLSK 88 >gi|153864860|ref|ZP_01997612.1| glycosyl hydrolase [Beggiatoa sp. SS] gi|152145645|gb|EDN72388.1| glycosyl hydrolase [Beggiatoa sp. SS] Length = 340 Score = 40.0 bits (92), Expect = 0.097, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 26/42 (61%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLE 42 M PI I+ IGGVV F+YD ++S RNI++P Q++ Sbjct: 94 MSHDDPIVQDIREHHIGGVVLFNYDVARQSPVRNIQSPQQVK 135 >gi|189423788|ref|YP_001950965.1| beta-N-acetylhexosaminidase [Geobacter lovleyi SZ] gi|189420047|gb|ACD94445.1| Beta-N-acetylhexosaminidase [Geobacter lovleyi SZ] Length = 392 Score = 40.0 bits (92), Expect = 0.10, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 28/42 (66%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLE 42 +D S+ I I++ +IGG + FD D K K+Y RNI +P QL+ Sbjct: 68 LDDSNYIVRDIRDYRIGGTILFDRDAKLKTYGRNIVSPEQLQ 109 >gi|78187897|ref|YP_375940.1| glycosy hydrolase family protein [Chlorobium luteolum DSM 273] gi|78167799|gb|ABB24897.1| glycosyl hydrolase, family 3 [Chlorobium luteolum DSM 273] Length = 378 Score = 40.0 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%) Query: 10 AIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 AI ++IGGVV FDYD ++ RNI P QL+R Sbjct: 59 AIDRQRIGGVVLFDYDVPSRTPLRNITGPEQLQR 92 >gi|307353677|ref|YP_003894728.1| glycoside hydrolase family 3 domain-containing protein [Methanoplanus petrolearius DSM 11571] gi|307156910|gb|ADN36290.1| glycoside hydrolase family 3 domain protein [Methanoplanus petrolearius DSM 11571] Length = 399 Score = 40.0 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 27/40 (67%) Query: 2 DSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQL 41 D+ S IA I+N ++GGV+ FD D S +RNIK+P Q+ Sbjct: 73 DNDSQIADDIRNGRVGGVILFDRDVALNSSERNIKSPEQV 112 >gi|254495931|ref|ZP_05108839.1| glycosy hydrolase family protein [Legionella drancourtii LLAP12] gi|254354809|gb|EET13436.1| glycosy hydrolase family protein [Legionella drancourtii LLAP12] Length = 379 Score = 39.6 bits (91), Expect = 0.13, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 29/43 (67%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 ++S S I I IGGV+ FDY+ + +S+ +NI++P Q+++ Sbjct: 44 INSQSEIVKIIDKNNIGGVILFDYNAQTQSFDKNIESPAQVKQ 86 >gi|193213964|ref|YP_001995163.1| beta-N-acetylhexosaminidase [Chloroherpeton thalassium ATCC 35110] gi|193087441|gb|ACF12716.1| Beta-N-acetylhexosaminidase [Chloroherpeton thalassium ATCC 35110] Length = 384 Score = 39.6 bits (91), Expect = 0.13, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 26/38 (68%) Query: 4 SSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQL 41 SS + + I+ ++IGGV+ FDYD K RNI++P Q+ Sbjct: 62 SSKVIVDIRQQRIGGVILFDYDLPLKQASRNIQSPEQV 99 >gi|256830691|ref|YP_003159419.1| beta-N-acetylhexosaminidase [Desulfomicrobium baculatum DSM 4028] gi|256579867|gb|ACU91003.1| Beta-N-acetylhexosaminidase [Desulfomicrobium baculatum DSM 4028] Length = 382 Score = 39.6 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 28/41 (68%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQL 41 +D +SPI I+ +GGV+ FD D + +S +RNI++P Q+ Sbjct: 49 VDGASPILRDIREHNLGGVILFDRDVQLQSPERNIQSPEQV 89 >gi|95929642|ref|ZP_01312384.1| glycoside hydrolase, family 3-like [Desulfuromonas acetoxidans DSM 684] gi|95134339|gb|EAT15996.1| glycoside hydrolase, family 3-like [Desulfuromonas acetoxidans DSM 684] Length = 411 Score = 39.3 bits (90), Expect = 0.16, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 23/33 (69%) Query: 11 IQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 IQ R +GGV+ FDYD + + RNI +P QL++ Sbjct: 71 IQKRHLGGVILFDYDVQLRQSGRNIASPSQLKQ 103 >gi|153872146|ref|ZP_02001121.1| glycosyl hydrolase, family 3 [Beggiatoa sp. PS] gi|152071386|gb|EDN68877.1| glycosyl hydrolase, family 3 [Beggiatoa sp. PS] Length = 436 Score = 38.5 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 17/32 (53%), Positives = 23/32 (71%) Query: 11 IQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLE 42 IQ +GGV+ FDYD KS +RNIK+P Q++ Sbjct: 118 IQQFHLGGVILFDYDIVLKSSRRNIKSPRQVK 149 >gi|119358346|ref|YP_912990.1| glycoside hydrolase family 3 protein [Chlorobium phaeobacteroides DSM 266] gi|119355695|gb|ABL66566.1| glycoside hydrolase, family 3 domain protein [Chlorobium phaeobacteroides DSM 266] Length = 375 Score = 37.7 bits (86), Expect = 0.51, Method: Composition-based stats. Identities = 19/43 (44%), Positives = 26/43 (60%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 + S IA I+ ++IGGVV FDYD +S RNI P +L + Sbjct: 48 LAESPQIASDIRRQRIGGVVLFDYDVPSRSPIRNITTPSRLMK 90 >gi|110597288|ref|ZP_01385576.1| Beta-N-acetylhexosaminidase [Chlorobium ferrooxidans DSM 13031] gi|110341124|gb|EAT59592.1| Beta-N-acetylhexosaminidase [Chlorobium ferrooxidans DSM 13031] Length = 389 Score = 37.7 bits (86), Expect = 0.55, Method: Composition-based stats. Identities = 21/40 (52%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Query: 3 SSSP-IALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQL 41 + SP IA I R+IGGVV FDYD + RNI +P QL Sbjct: 63 AESPGIAEDILERRIGGVVLFDYDVPLHAPSRNISSPEQL 102 >gi|189501346|ref|YP_001960816.1| Beta-N-acetylhexosaminidase [Chlorobium phaeobacteroides BS1] gi|189496787|gb|ACE05335.1| Beta-N-acetylhexosaminidase [Chlorobium phaeobacteroides BS1] Length = 373 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 21/33 (63%) Query: 11 IQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 I R +GGVV FDYD KS RNI + QL++ Sbjct: 56 ITKRHLGGVVLFDYDVPSKSTGRNITSREQLQK 88 >gi|194334961|ref|YP_002016821.1| beta-N-acetylhexosaminidase [Prosthecochloris aestuarii DSM 271] gi|194312779|gb|ACF47174.1| Beta-N-acetylhexosaminidase [Prosthecochloris aestuarii DSM 271] Length = 375 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 21/31 (67%) Query: 11 IQNRQIGGVVRFDYDFKKKSYQRNIKNPIQL 41 I +++IGGV+ FDYD S RNI +P QL Sbjct: 58 IASKRIGGVILFDYDVPSASTTRNIASPGQL 88 >gi|296444426|ref|ZP_06886391.1| Beta-N-acetylhexosaminidase [Methylosinus trichosporium OB3b] gi|296258073|gb|EFH05135.1| Beta-N-acetylhexosaminidase [Methylosinus trichosporium OB3b] Length = 330 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 15/26 (57%), Positives = 19/26 (73%) Query: 16 IGGVVRFDYDFKKKSYQRNIKNPIQL 41 +GGV+ FDYD K Y+RNI +P QL Sbjct: 31 LGGVILFDYDCIDKKYERNIFDPAQL 56 >gi|254457746|ref|ZP_05071174.1| B-N-acetylglucosaminidase, glycoside hydrolase family 3 protein [Campylobacterales bacterium GD 1] gi|207086538|gb|EDZ63822.1| B-N-acetylglucosaminidase, glycoside hydrolase family 3 protein [Campylobacterales bacterium GD 1] Length = 555 Score = 36.6 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 28/42 (66%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLE 42 +++++ I IQ ++GGVV FD +KK+S +NI P QL+ Sbjct: 38 VNNNTEIVEYIQQYELGGVVLFDRFYKKRSQIKNIDTPEQLQ 79 >gi|323700659|ref|ZP_08112571.1| glycoside hydrolase family 3 domain protein [Desulfovibrio sp. ND132] gi|323460591|gb|EGB16456.1| glycoside hydrolase family 3 domain protein [Desulfovibrio desulfuricans ND132] Length = 380 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 26/43 (60%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 ++ S I I+ R +GGV+ FDYD + QRNI++ Q+ R Sbjct: 59 VNQRSTIVRDIRERHLGGVILFDYDMFWGAGQRNIRSVEQVRR 101 >gi|52841120|ref|YP_094919.1| glycosyl hydrolase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|54296905|ref|YP_123274.1| hypothetical protein lpp0946 [Legionella pneumophila str. Paris] gi|52628231|gb|AAU26972.1| glycosyl hydrolase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|53750690|emb|CAH12097.1| hypothetical protein lpp0946 [Legionella pneumophila str. Paris] Length = 358 Score = 34.6 bits (78), Expect = 4.2, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 26/43 (60%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 + +SP+A + N +GGV+ FD D Y +N++N Q+++ Sbjct: 21 LHDNSPVAQWLSNDGLGGVLLFDKDLSTGIYGKNLRNQAQIKQ 63 >gi|54293860|ref|YP_126275.1| hypothetical protein lpl0916 [Legionella pneumophila str. Lens] gi|53753692|emb|CAH15150.1| hypothetical protein lpl0916 [Legionella pneumophila str. Lens] Length = 358 Score = 34.6 bits (78), Expect = 4.6, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 25/43 (58%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 + +SP+A + N +GGV+ FD D Y +N++N Q+ + Sbjct: 21 LHDNSPVAQWLSNDGLGGVLLFDKDLSTGIYGKNLRNQTQIRQ 63 >gi|307609676|emb|CBW99184.1| hypothetical protein LPW_09671 [Legionella pneumophila 130b] Length = 358 Score = 34.2 bits (77), Expect = 5.4, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 25/43 (58%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 + +SP+A + N +GGV+ FD D Y +N++N Q+ + Sbjct: 21 LHDNSPVAQWLSNDGLGGVLLFDKDLSTGIYGKNLRNQAQIRQ 63 >gi|148360469|ref|YP_001251676.1| glycosyl hydrolase [Legionella pneumophila str. Corby] gi|296106464|ref|YP_003618164.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] gi|148282242|gb|ABQ56330.1| glycosyl hydrolase [Legionella pneumophila str. Corby] gi|295648365|gb|ADG24212.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] Length = 358 Score = 34.2 bits (77), Expect = 5.4, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 25/43 (58%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 + +SP+A + N +GGV+ FD D Y +N++N Q+ + Sbjct: 21 LHDNSPVAQWLSNDGLGGVLLFDKDLSTGIYGKNLRNQAQIRQ 63 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.319 0.136 0.377 Lambda K H 0.267 0.0418 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 727,090,752 Number of Sequences: 14124377 Number of extensions: 16078863 Number of successful extensions: 29601 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 29520 Number of HSP's gapped (non-prelim): 81 length of query: 43 length of database: 4,842,793,630 effective HSP length: 17 effective length of query: 26 effective length of database: 4,602,679,221 effective search space: 119669659746 effective search space used: 119669659746 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 76 (33.9 bits)