RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254781068|ref|YP_003065481.1| hypothetical protein
CLIBASIA_04850 [Candidatus Liberibacter asiaticus str. psy62]
         (43 letters)



>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant
          photosynthetic reaction center, peripheral antenna;
          HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1
          Length = 154

 Score = 30.7 bits (68), Expect = 0.081
 Identities = 7/11 (63%), Positives = 9/11 (81%), Gaps = 1/11 (9%)

Query: 2  DSSSPIALAIQ 12
          D S+P ALAI+
Sbjct: 34 DDSAP-ALAIK 43


>2oxn_A Beta-hexosaminidase; TIM-barrel, hydrolase; HET: OAN; 1.70A
          {Vibrio cholerae} PDB: 3gs6_A* 3gsm_A* 1y65_A* 1tr9_A
          Length = 340

 Score = 24.2 bits (51), Expect = 8.5
 Identities = 9/31 (29%), Positives = 14/31 (45%), Gaps = 9/31 (29%)

Query: 11 IQNRQIGGVVRFDYDFKKKSYQRNIKNPIQL 41
          +Q+  +GGV+ F          RN  +  QL
Sbjct: 21 LQHPTVGGVILF---------GRNYHDNQQL 42


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.319    0.136    0.377 

Gapped
Lambda     K      H
   0.267   0.0433    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 356,640
Number of extensions: 9353
Number of successful extensions: 15
Number of sequences better than 10.0: 1
Number of HSP's gapped: 15
Number of HSP's successfully gapped: 2
Length of query: 43
Length of database: 5,693,230
Length adjustment: 16
Effective length of query: 27
Effective length of database: 5,305,326
Effective search space: 143243802
Effective search space used: 143243802
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.8 bits)