BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781068|ref|YP_003065481.1| hypothetical protein CLIBASIA_04850 [Candidatus Liberibacter asiaticus str. psy62] (43 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781068|ref|YP_003065481.1| hypothetical protein CLIBASIA_04850 [Candidatus Liberibacter asiaticus str. psy62] Length = 43 Score = 89.4 bits (220), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 43/43 (100%), Positives = 43/43 (100%) Query: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER Sbjct: 1 MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43 >gi|254780440|ref|YP_003064853.1| transcription elongation factor GreA [Candidatus Liberibacter asiaticus str. psy62] Length = 158 Score = 23.5 bits (49), Expect = 0.64, Method: Compositional matrix adjust. Identities = 9/29 (31%), Positives = 19/29 (65%) Query: 4 SSPIALAIQNRQIGGVVRFDYDFKKKSYQ 32 SSPIA A+ +++G ++ + +K+Y+ Sbjct: 123 SSPIARALIGKELGDIISVNAPGGEKTYE 151 >gi|254780488|ref|YP_003064901.1| adenosylmethionine--8-amino-7-oxononanoate transaminase [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Score = 22.3 bits (46), Expect = 1.7, Method: Composition-based stats. Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 14 RQIGGVVRFDYDFKKKSY 31 RQ+G +V D++ + K Y Sbjct: 351 RQMGTIVALDFNVQNKGY 368 >gi|254780922|ref|YP_003065335.1| glucose-1-phosphate thymidylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 292 Score = 20.4 bits (41), Expect = 6.1, Method: Compositional matrix adjust. Identities = 11/37 (29%), Positives = 18/37 (48%) Query: 2 DSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNP 38 +S++ + +QN Q GVV D + S + NP Sbjct: 128 NSATVVGCHVQNPQRYGVVEVDSSNQAISIEEKPNNP 164 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.136 0.377 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,778 Number of Sequences: 1233 Number of extensions: 633 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 43 length of database: 328,796 effective HSP length: 16 effective length of query: 27 effective length of database: 309,068 effective search space: 8344836 effective search space used: 8344836 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)