Query gi|254781069|ref|YP_003065482.1| hypothetical protein CLIBASIA_04855 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 43 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 30 03:53:23 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781069.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK05337 beta-hexosaminidase; 94.8 0.018 4.6E-07 33.0 2.2 20 15-34 53-72 (336) 2 pfam00933 Glyco_hydro_3 Glycos 72.4 2.1 5.3E-05 23.0 1.6 25 15-39 7-32 (225) 3 COG1472 BglX Beta-glucosidase- 49.2 11 0.00028 19.6 1.8 24 16-39 59-83 (397) 4 TIGR02130 dapB_plant dihydrodi 43.6 12 0.00031 19.4 1.4 20 8-27 59-78 (275) 5 PRK05467 putative hydroxylase; 16.4 51 0.0013 16.3 0.5 17 16-32 116-134 (226) 6 pfam05785 CNF1 Rho-activating 16.1 1.1E+02 0.0029 14.7 2.2 27 10-42 115-141 (281) 7 TIGR02071 PBP_1b penicillin-bi 16.0 1.1E+02 0.0029 14.7 2.2 25 8-35 407-431 (742) 8 TIGR01793 cit_synth_euk citrat 15.5 64 0.0016 15.9 0.8 14 19-32 231-244 (430) 9 TIGR02841 spore_YyaC putative 14.1 1.1E+02 0.0028 14.7 1.8 25 7-31 50-76 (140) 10 pfam09859 DUF2086 Uncharacteri 11.7 1.2E+02 0.0032 14.5 1.4 17 14-30 84-107 (173) No 1 >PRK05337 beta-hexosaminidase; Provisional Probab=94.80 E-value=0.018 Score=33.00 Aligned_cols=20 Identities=50% Similarity=0.795 Sum_probs=17.9 Q ss_pred CCCCEEEEEEECCCEEEEEE Q ss_conf 26866999960786232333 Q gi|254781069|r 15 SSYPLMIAIDYEGGEVSRLI 34 (43) Q Consensus 15 ssyplmiaidyeggevsrli 34 (43) +..||+|+||-|||.|+|+- T Consensus 53 ~~~pllIaiDqEGGrV~Rl~ 72 (336) T PRK05337 53 VRPPLLIAVDQEGGRVQRFR 72 (336) T ss_pred CCCCCEEEEECCCCEEEECC T ss_conf 27993799815888466568 No 2 >pfam00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain. Probab=72.45 E-value=2.1 Score=23.05 Aligned_cols=25 Identities=28% Similarity=0.239 Sum_probs=19.2 Q ss_pred CCCCEEEEEEECCCEEEEEEE-EEEE Q ss_conf 268669999607862323333-2201 Q gi|254781069|r 15 SSYPLMIAIDYEGGEVSRLIC-TTVF 39 (43) Q Consensus 15 ssyplmiaidyeggevsrlic-ttvf 39 (43) .-.|++|++|-|||-|+|+.. .|.| T Consensus 7 lgiPl~i~~D~egG~v~r~~~~~t~f 32 (225) T pfam00933 7 LGIPLLCGTDGPHGVRQRDRDGATAF 32 (225) T ss_pred CCCCCEEEEECCCCEECCCCCCCCCC T ss_conf 79874898807887675589997758 No 3 >COG1472 BglX Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism] Probab=49.21 E-value=11 Score=19.59 Aligned_cols=24 Identities=63% Similarity=0.865 Sum_probs=19.6 Q ss_pred CCCEEEEEEECCCEEEEEEE-EEEE Q ss_conf 68669999607862323333-2201 Q gi|254781069|r 16 SYPLMIAIDYEGGEVSRLIC-TTVF 39 (43) Q Consensus 16 syplmiaidyeggevsrlic-ttvf 39 (43) .-|++|++|-|||-|.|+.- .|.| T Consensus 59 ~iplli~~D~egG~v~r~~~~~t~f 83 (397) T COG1472 59 GIPLLIAIDQEGGRVQRLREGFTVF 83 (397) T ss_pred CCCCEEEEECCCCEEEECCCCCCCC T ss_conf 8993599716888366346776669 No 4 >TIGR02130 dapB_plant dihydrodipicolinate reductase; InterPro: IPR011859 This narrow family includes genes from Arabidopsis and Fibrobacter succinogenes (which probably recieved the gene from a plant via lateral gene transfer). The sequences are distantly related to the dihydrodipicolinate reductases from archaea. In Fibrobacter this gene is the only candidate DHPR in the genome.. Probab=43.57 E-value=12 Score=19.35 Aligned_cols=20 Identities=30% Similarity=0.569 Sum_probs=16.5 Q ss_pred HHHHHHHCCCCEEEEEEECC Q ss_conf 54321212686699996078 Q gi|254781069|r 8 QKVNSVESSYPLMIAIDYEG 27 (43) Q Consensus 8 qkvnsvessyplmiaidyeg 27 (43) ..+.+|-..||-||.|||.- T Consensus 59 ~~~~~Vl~KYP~lI~~DYT~ 78 (275) T TIGR02130 59 KVLSEVLEKYPELIVVDYTI 78 (275) T ss_pred HHHHHHHHHCCCEEEECCCC T ss_conf 78999986388759980478 No 5 >PRK05467 putative hydroxylase; Provisional Probab=16.44 E-value=51 Score=16.35 Aligned_cols=17 Identities=41% Similarity=0.710 Sum_probs=10.3 Q ss_pred CCCEEEE--EEECCCEEEE Q ss_conf 6866999--9607862323 Q gi|254781069|r 16 SYPLMIA--IDYEGGEVSR 32 (43) Q Consensus 16 syplmia--idyeggevsr 32 (43) |..+... -||||||..- T Consensus 116 S~TlfLs~p~~YeGGEL~i 134 (226) T PRK05467 116 SATLFLSDPDDYDGGELVI 134 (226) T ss_pred EEEEECCCCCCCCCCEEEE T ss_conf 9999758954465855999 No 6 >pfam05785 CNF1 Rho-activating domain of cytotoxic necrotizing factor. This family consists of several bacterial cytotoxic necrotizing factor proteins as well as related dermonecrotic toxin (DNT) from Bordetella species. Cytotoxic necrotizing factor 1 (CNF1) causes necrosis of rabbit skin and re-organisation of the actin cytoskeleton in cultured cells. Bordetella dermonecrotic toxin (DNT) stimulates the assembly of actin stress fibres and focal adhesions by deamidating or polyaminating Gln63 of the small GTPase Rho. DNT is an A-B toxin which is composed of an N-terminal receptor-binding (B) domain and a C-terminal enzymatically active (A) domain. Probab=16.06 E-value=1.1e+02 Score=14.70 Aligned_cols=27 Identities=41% Similarity=0.656 Sum_probs=18.7 Q ss_pred HHHHHCCCCEEEEEEECCCEEEEEEEEEEEEEE Q ss_conf 321212686699996078623233332201230 Q gi|254781069|r 10 VNSVESSYPLMIAIDYEGGEVSRLICTTVFAIT 42 (43) Q Consensus 10 vnsvessyplmiaidyeggevsrlicttvfait 42 (43) ...++..+|+.|. +|..|- ||+|+|+. T Consensus 115 L~~i~~g~pviit----sG~LSG--CT~v~A~K 141 (281) T pfam05785 115 LSEVPEGKPLIIT----SGALSG--CTTVVARK 141 (281) T ss_pred HHHCCCCCEEEEE----CCCCCC--CEEEEEEC T ss_conf 8886789728996----776568--67999972 No 7 >TIGR02071 PBP_1b penicillin-binding protein 1B; InterPro: IPR011813 Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in Escherichia coli and other Proteobacteria, designated penicillin-binding protein 1B.; GO: 0008233 peptidase activity, 0008955 peptidoglycan glycosyltransferase activity, 0009252 peptidoglycan biosynthetic process, 0046677 response to antibiotic, 0009274 peptidoglycan-based cell wall. Probab=16.03 E-value=1.1e+02 Score=14.68 Aligned_cols=25 Identities=32% Similarity=0.527 Sum_probs=19.8 Q ss_pred HHHHHHHCCCCEEEEEEECCCEEEEEEE Q ss_conf 5432121268669999607862323333 Q gi|254781069|r 8 QKVNSVESSYPLMIAIDYEGGEVSRLIC 35 (43) Q Consensus 8 qkvnsvessyplmiaidyeggevsrlic 35 (43) +|.+.+|. -||.+|++-|||--+|- T Consensus 407 ~~~~~LEa---Amvv~D~~~GEvrA~vG 431 (742) T TIGR02071 407 KKLKDLEA---AMVVVDRFTGEVRALVG 431 (742) T ss_pred CCCCCCEE---EEEEEECCCCEEEEEEC T ss_conf 78885317---78898368870788875 No 8 >TIGR01793 cit_synth_euk citrate (Si)-synthase, eukaryotic; InterPro: IPR010109 Citrate synthase 2.3.3.1 from EC is a member of a small family of enzymes that can directly form a carbon-carbon bond without the presence of metal ion cofactors. It catalyses the first reaction in the Krebs' cycle, namely the conversion of oxaloacetate and acetyl-coenzyme A into citrate and coenzyme A. This reaction is important for energy generation and for carbon assimilation. The reaction proceeds via a non-covalently bound citryl-coenzyme A intermediate in a 2-step process (aldol-Claisen condensation followed by the hydrolysis of citryl-CoA). Citrate synthase enzymes are found in two distinct structural types: type I enzymes (found in eukaryotes, Gram-positive bacteria and archaea) form homodimers and have shorter sequences than type II enzymes, which are found in Gram-negative bacteria and are hexameric in structure. In both types, the monomer is composed of two domains: a large alpha-helical domain consisting of two structural repeats, where the second repeat is interrupted by a small alpha-helical domain. The cleft between these domains forms the active site, where both citrate and acetyl-coenzyme A bind. The enzyme undergoes a conformational change upon binding of the oxaloacetate ligand, whereby the active site cleft closes over in order to form the acetyl-CoA binding site . The energy required for domain closure comes from the interaction of the enzyme with the substrate. Type II enzymes possess an extra N-terminal beta-sheet domain, and some type II enzymes are allosterically inhibited by NADH . This entry includes both mitochondrial and peroxisomal forms of citrate synthase. Peroxisomal forms of the enzyme, recognized by the C-terminal targeting motif SKL, act in the glyoxylate cycle. Eukaryotic homologs include a Tetrahymena thermophila citrate synthase that doubles as a filament protein, a putative citrate synthase from Plasmodium falciparum (no TCA cycle), and a methylcitrate synthase from Aspergillus nidulans (Emericella nidulans).; GO: 0004108 citrate (Si)-synthase activity, 0044262 cellular carbohydrate metabolic process. Probab=15.47 E-value=64 Score=15.88 Aligned_cols=14 Identities=57% Similarity=0.714 Sum_probs=12.0 Q ss_pred EEEEEEECCCEEEE Q ss_conf 69999607862323 Q gi|254781069|r 19 LMIAIDYEGGEVSR 32 (43) Q Consensus 19 lmiaidyeggevsr 32 (43) |.|--|-|||.||- T Consensus 231 ltIHsDHEGGNVSA 244 (430) T TIGR01793 231 LTIHSDHEGGNVSA 244 (430) T ss_pred HEEEECCCCCCCCH T ss_conf 00120148886102 No 9 >TIGR02841 spore_YyaC putative sporulation protein YyaC; InterPro: IPR009665 This family consists of several uncharacterised bacterial proteins, which seem to be specific to the orders Clostridia and Bacillales. Family members are typically around 180 residues in length. The function of this family is unknown.. Probab=14.08 E-value=1.1e+02 Score=14.72 Aligned_cols=25 Identities=28% Similarity=0.498 Sum_probs=16.2 Q ss_pred HHHHHHHHCC--CCEEEEEEECCCEEE Q ss_conf 5543212126--866999960786232 Q gi|254781069|r 7 KQKVNSVESS--YPLMIAIDYEGGEVS 31 (43) Q Consensus 7 kqkvnsvess--yplmiaidyeggevs 31 (43) +++.+.++.. -|..||||--=|.+. T Consensus 50 ~e~l~~I~k~h~~PFiIAiDACLG~~~ 76 (140) T TIGR02841 50 EEKLKIIKKKHKNPFIIAIDACLGKLK 76 (140) T ss_pred HHHHHHHHHHCCCCCEEEEECCCCCCC T ss_conf 989999986268981899862468701 No 10 >pfam09859 DUF2086 Uncharacterized protein conserved in bacteria (DUF2086). This domain, found in various hypothetical prokaryotic proteins, has no known function. Probab=11.67 E-value=1.2e+02 Score=14.49 Aligned_cols=17 Identities=53% Similarity=1.062 Sum_probs=12.9 Q ss_pred HCCCCEEEEE-------EECCCEE Q ss_conf 1268669999-------6078623 Q gi|254781069|r 14 ESSYPLMIAI-------DYEGGEV 30 (43) Q Consensus 14 essyplmiai-------dyeggev 30 (43) |--+||-++| ||+|||. T Consensus 84 e~vFPlQv~ilLs~Pg~DftGGEF 107 (173) T pfam09859 84 EHVFPLQVAILLSEPGEDFTGGEF 107 (173) T ss_pred CEECCEEEEEECCCCCCCCCCCEE T ss_conf 601132368870688875658548 Done!