RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781069|ref|YP_003065482.1| hypothetical protein CLIBASIA_04855 [Candidatus Liberibacter asiaticus str. psy62] (43 letters) >gnl|CDD|31661 COG1472, BglX, Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism]. Length = 397 Score = 26.1 bits (57), Expect = 2.2 Identities = 12/16 (75%), Positives = 13/16 (81%) Query: 18 PLMIAIDYEGGEVSRL 33 PL+IAID EGG V RL Sbjct: 61 PLLIAIDQEGGRVQRL 76 >gnl|CDD|173902 cd00805, TyrRS_core, catalytic core domain of tyrosinyl-tRNA synthetase. Tyrosinyl-tRNA synthetase (TyrRS) catalytic core domain. TyrRS is a homodimer which attaches Tyr to the appropriate tRNA. TyrRS is a class I tRNA synthetases, so it aminoacylates the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formationof the enzyme bound aminoacyl-adenylate. It contains the class I characteristic HIGH and KMSKS motifs, which are involved in ATP binding. Length = 269 Score = 24.1 bits (53), Expect = 9.0 Identities = 8/32 (25%), Positives = 15/32 (46%), Gaps = 6/32 (18%) Query: 1 MAKEADKQKVNSVES------SYPLMIAIDYE 26 + ++A K ++ E YPL+ A D+ Sbjct: 117 LRRDAVKVRLEEEEGISFSEFIYPLLQAYDFV 148 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.314 0.127 0.339 Gapped Lambda K H 0.267 0.0548 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 414,399 Number of extensions: 10237 Number of successful extensions: 22 Number of sequences better than 10.0: 1 Number of HSP's gapped: 22 Number of HSP's successfully gapped: 2 Length of query: 43 Length of database: 6,263,737 Length adjustment: 17 Effective length of query: 26 Effective length of database: 5,896,384 Effective search space: 153305984 Effective search space used: 153305984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (23.8 bits)