BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781070|ref|YP_003065483.1| hypothetical protein CLIBASIA_04860 [Candidatus Liberibacter asiaticus str. psy62] (58 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254781070|ref|YP_003065483.1| hypothetical protein CLIBASIA_04860 [Candidatus Liberibacter asiaticus str. psy62] gi|254040747|gb|ACT57543.1| hypothetical protein CLIBASIA_04860 [Candidatus Liberibacter asiaticus str. psy62] Length = 58 Score = 119 bits (298), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 58/58 (100%), Positives = 58/58 (100%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK Sbjct: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 >gi|304413318|ref|ZP_07394791.1| glycosyl hydrolase domain-containing hypothetical protein [Candidatus Regiella insecticola LSR1] gi|304284161|gb|EFL92554.1| glycosyl hydrolase domain-containing hypothetical protein [Candidatus Regiella insecticola LSR1] Length = 353 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 25/53 (47%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 M + LV +G+N NF+PV+DL + PETFIA FS +P + E+AQL S+ + Sbjct: 116 MTETLVDAGVNTNFAPVVDL-HRPETFIAGAERSFSALPKEVAENAQLISQAH 167 >gi|296106822|ref|YP_003618522.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] gi|295648723|gb|ADG24570.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] Length = 378 Score = 41.2 bits (95), Expect = 0.042, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I +K FS IP + AQL++ +IK+ Sbjct: 152 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKH 208 >gi|307609946|emb|CBW99474.1| hypothetical protein LPW_12471 [Legionella pneumophila 130b] Length = 378 Score = 41.2 bits (95), Expect = 0.044, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I +K FS IP + AQL++ +IK+ Sbjct: 152 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKH 208 >gi|54297148|ref|YP_123517.1| hypothetical protein lpp1193 [Legionella pneumophila str. Paris] gi|53750933|emb|CAH12344.1| hypothetical protein lpp1193 [Legionella pneumophila str. Paris] Length = 382 Score = 41.2 bits (95), Expect = 0.044, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I +K FS IP + AQL++ +IK+ Sbjct: 156 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKH 212 >gi|52841424|ref|YP_095223.1| glycosy hydrolase family protein [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|52628535|gb|AAU27276.1| glycosyl hydrolase family 3 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] Length = 395 Score = 41.2 bits (95), Expect = 0.045, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I +K FS IP + AQL++ +IK+ Sbjct: 169 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKH 225 >gi|148358777|ref|YP_001249984.1| glycosyl hydrolase family transporter 3 [Legionella pneumophila str. Corby] gi|148280550|gb|ABQ54638.1| glycosyl hydrolase family 3 [Legionella pneumophila str. Corby] Length = 382 Score = 41.2 bits (95), Expect = 0.047, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I +K FS IP + AQL++ +IK+ Sbjct: 156 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKH 212 >gi|254495931|ref|ZP_05108839.1| glycosy hydrolase family protein [Legionella drancourtii LLAP12] gi|254354809|gb|EET13436.1| glycosy hydrolase family protein [Legionella drancourtii LLAP12] Length = 379 Score = 39.7 bits (91), Expect = 0.13, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 M K L +G N++F+P++D+ P IA+K FS PA + A+++SR ++K+ Sbjct: 153 MTKILKETGFNLDFAPLVDINVNPNNPVIAKKERSFSSDPAVVIQDARIYSRHFLKH 209 >gi|54294135|ref|YP_126550.1| hypothetical protein lpl1199 [Legionella pneumophila str. Lens] gi|53753967|emb|CAH15438.1| hypothetical protein lpl1199 [Legionella pneumophila str. Lens] Length = 382 Score = 39.3 bits (90), Expect = 0.19, Method: Compositional matrix adjust. Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I +K FS IP + AQL++ +I + Sbjct: 156 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFITH 212 >gi|320353673|ref|YP_004195012.1| glycoside hydrolase family 3 domain-containing protein [Desulfobulbus propionicus DSM 2032] gi|320122175|gb|ADW17721.1| glycoside hydrolase family 3 domain protein [Desulfobulbus propionicus DSM 2032] Length = 354 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLF 49 +A+ L GIN+NF+PV+DL P+ I + + F PA A++F Sbjct: 117 LAEELAACGINLNFAPVVDLDLNPDNPIIGRYQRSFGADPATVASHARVF 166 >gi|153864860|ref|ZP_01997612.1| glycosyl hydrolase [Beggiatoa sp. SS] gi|152145645|gb|EDN72388.1| glycosyl hydrolase [Beggiatoa sp. SS] Length = 340 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTY 53 MAK L GIN+NF+PV+D+ P IA+K+ FS P + A F + + Sbjct: 194 MAKTLAELGINLNFAPVVDVNTNPHNPIIAKKQRSFSPNPKIVAQHALEFIKAH 247 >gi|295396087|ref|ZP_06806270.1| hypothetical protein HMPREF0183_1768 [Brevibacterium mcbrellneri ATCC 49030] gi|294971028|gb|EFG46920.1| hypothetical protein HMPREF0183_1768 [Brevibacterium mcbrellneri ATCC 49030] Length = 189 Score = 35.8 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYG---PETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 + KN VTS ++ + DL PET +AQ R + RIPA+A + F R + P Sbjct: 110 LGKNYVTSESATLYALLFDLCEDRVPPETSVAQARDLLLRIPAEARVAFATFLRGLYRRP 169 Query: 58 K 58 + Sbjct: 170 R 170 >gi|189423788|ref|YP_001950965.1| beta-N-acetylhexosaminidase [Geobacter lovleyi SZ] gi|189420047|gb|ACD94445.1| Beta-N-acetylhexosaminidase [Geobacter lovleyi SZ] Length = 392 Score = 35.4 bits (80), Expect = 2.5, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET--FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L T+G+N+NF+PV+DL P++ A +RS FS P+ A++F T+ N Sbjct: 168 IGATLATNGLNMNFAPVVDLNINPQSPAIGALERS-FSADPSIVTNHARIFVETHDAN 224 >gi|118474059|ref|YP_891951.1| glycosy hydrolase family protein [Campylobacter fetus subsp. fetus 82-40] gi|118413285|gb|ABK81705.1| glycosyl hyrolase, family 3 [Campylobacter fetus subsp. fetus 82-40] Length = 354 Score = 35.4 bits (80), Expect = 2.6, Method: Compositional matrix adjust. Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 4/59 (6%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIP----AKAEESAQLFSRTYIK 55 MA L GIN+NF+PV+D+ + I QK FS+ P A + E + F + IK Sbjct: 135 MADQLKNLGINMNFAPVVDVYNPNSSIIGQKNRAFSKNPDEVIAYSSEFIKSFDKANIK 193 >gi|157165607|ref|YP_001466722.1| glycoside hydrolase family 3 protein [Campylobacter concisus 13826] gi|112800169|gb|EAT97513.1| beta-hexosaminidase A (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) (Chitobiase) [Campylobacter concisus 13826] Length = 351 Score = 35.4 bits (80), Expect = 2.6, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 27/53 (50%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA NL GIN+NF+PV+DL IA K+ FS +K A F + Sbjct: 133 MAINLKECGINLNFAPVVDLHDENSPIIAAKQRAFSEYASKVVIYADAFMDAF 185 >gi|261886066|ref|ZP_06010105.1| glycosy hydrolase family protein [Campylobacter fetus subsp. venerealis str. Azul-94] Length = 354 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 4/59 (6%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIP----AKAEESAQLFSRTYIK 55 MA L GIN+NF+PV+D+ + I QK FS+ P A + E + F + IK Sbjct: 135 MADQLKNLGINMNFAPVVDVYNPNSSIIGQKNRAFSKNPDEVIAYSSEFIKSFDKANIK 193 >gi|313679320|ref|YP_004057059.1| glycoside hydrolase family 3 domain protein [Oceanithermus profundus DSM 14977] gi|313152035|gb|ADR35886.1| glycoside hydrolase family 3 domain protein [Oceanithermus profundus DSM 14977] Length = 492 Score = 35.0 bits (79), Expect = 3.0, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G N+NF+PVLDL P + +RS F P +A E A + +++ Sbjct: 103 ARGLAAYGFNLNFAPVLDLNTNPANPVIAERS-FGADPERASELALAWHEGHVQ 155 >gi|153872146|ref|ZP_02001121.1| glycosyl hydrolase, family 3 [Beggiatoa sp. PS] gi|152071386|gb|EDN68877.1| glycosyl hydrolase, family 3 [Beggiatoa sp. PS] Length = 436 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTY 53 MAK L T GIN NF+PV+DL P I + FS P + A F + + Sbjct: 208 MAKTLATVGINFNFAPVVDLNINPNNPVIGKLERSFSAYPQTVTKHALEFIKAH 261 >gi|189501346|ref|YP_001960816.1| Beta-N-acetylhexosaminidase [Chlorobium phaeobacteroides BS1] gi|189496787|gb|ACE05335.1| Beta-N-acetylhexosaminidase [Chlorobium phaeobacteroides BS1] Length = 373 Score = 34.7 bits (78), Expect = 4.7, Method: Compositional matrix adjust. Identities = 16/24 (66%), Positives = 18/24 (75%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPE 25 AK L SGINVNF+PV+DL PE Sbjct: 147 AKTLHNSGINVNFAPVVDLNSNPE 170 >gi|223039793|ref|ZP_03610078.1| glycosyl hyrolase, family 3 [Campylobacter rectus RM3267] gi|222878985|gb|EEF14081.1| glycosyl hyrolase, family 3 [Campylobacter rectus RM3267] Length = 363 Score = 34.3 bits (77), Expect = 6.4, Method: Compositional matrix adjust. Identities = 17/36 (47%), Positives = 21/36 (58%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFS 36 MA+ L GINVNF+PV D+L T I + FS Sbjct: 143 MAQQLKDVGINVNFAPVADVLNPKSTIIGSRGRAFS 178 >gi|52078658|ref|YP_077449.1| glycoside hydrolase family protein [Bacillus licheniformis ATCC 14580] gi|52784020|ref|YP_089849.1| YbbD [Bacillus licheniformis ATCC 14580] gi|52001869|gb|AAU21811.1| Glycoside hydrolase, family 3 [Bacillus licheniformis ATCC 14580] gi|52346522|gb|AAU39156.1| YbbD [Bacillus licheniformis ATCC 14580] Length = 643 Score = 33.9 bits (76), Expect = 8.3, Method: Compositional matrix adjust. Identities = 17/37 (45%), Positives = 23/37 (62%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSR 37 + K L + GINVNFSPVLD+ P+ + RS S+ Sbjct: 161 IGKELSSLGINVNFSPVLDVNNNPDNPVIGVRSFSSK 197 >gi|319649065|ref|ZP_08003274.1| YbbD protein [Bacillus sp. BT1B_CT2] gi|317389059|gb|EFV69877.1| YbbD protein [Bacillus sp. BT1B_CT2] Length = 643 Score = 33.9 bits (76), Expect = 8.4, Method: Compositional matrix adjust. Identities = 17/37 (45%), Positives = 23/37 (62%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSR 37 + K L + GINVNFSPVLD+ P+ + RS S+ Sbjct: 161 IGKELSSLGINVNFSPVLDVNNNPDNPVIGVRSFSSK 197 >gi|193213634|ref|YP_001999587.1| glycoside hydrolase family 3 domain-containing protein [Chlorobaculum parvum NCIB 8327] gi|193087111|gb|ACF12387.1| glycoside hydrolase family 3 domain protein [Chlorobaculum parvum NCIB 8327] Length = 373 Score = 33.5 bits (75), Expect = 8.8, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTY 53 AK L + GIN+N +PV+DL PE I + FS PA A++F T+ Sbjct: 146 AKLLKSLGINMNLAPVVDLNVNPENPVIGKLDRSFSSNPAVVARQARIFVDTF 198 Searching..................................................done Results from round 2 >gi|254781070|ref|YP_003065483.1| hypothetical protein CLIBASIA_04860 [Candidatus Liberibacter asiaticus str. psy62] gi|254040747|gb|ACT57543.1| hypothetical protein CLIBASIA_04860 [Candidatus Liberibacter asiaticus str. psy62] Length = 58 Score = 100 bits (249), Expect = 6e-20, Method: Composition-based stats. Identities = 58/58 (100%), Positives = 58/58 (100%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK Sbjct: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 >gi|304413318|ref|ZP_07394791.1| glycosyl hydrolase domain-containing hypothetical protein [Candidatus Regiella insecticola LSR1] gi|304284161|gb|EFL92554.1| glycosyl hydrolase domain-containing hypothetical protein [Candidatus Regiella insecticola LSR1] Length = 353 Score = 93.3 bits (230), Expect = 1e-17, Method: Composition-based stats. Identities = 25/53 (47%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 M + LV +G+N NF+PV+DL + PETFIA FS +P + E+AQL S+ + Sbjct: 116 MTETLVDAGVNTNFAPVVDL-HRPETFIAGAERSFSALPKEVAENAQLISQAH 167 >gi|153872146|ref|ZP_02001121.1| glycosyl hydrolase, family 3 [Beggiatoa sp. PS] gi|152071386|gb|EDN68877.1| glycosyl hydrolase, family 3 [Beggiatoa sp. PS] Length = 436 Score = 51.3 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTY 53 MAK L T GIN NF+PV+DL P + K FS P + A F + + Sbjct: 208 MAKTLATVGINFNFAPVVDLNINPNNPVIGKLERSFSAYPQTVTKHALEFIKAH 261 >gi|320353673|ref|YP_004195012.1| glycoside hydrolase family 3 domain-containing protein [Desulfobulbus propionicus DSM 2032] gi|320122175|gb|ADW17721.1| glycoside hydrolase family 3 domain protein [Desulfobulbus propionicus DSM 2032] Length = 354 Score = 50.5 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTY 53 +A+ L GIN+NF+PV+DL P+ I + + F PA A++F + Sbjct: 117 LAEELAACGINLNFAPVVDLDLNPDNPIIGRYQRSFGADPATVASHARVFVEAH 170 >gi|254495931|ref|ZP_05108839.1| glycosy hydrolase family protein [Legionella drancourtii LLAP12] gi|254354809|gb|EET13436.1| glycosy hydrolase family protein [Legionella drancourtii LLAP12] Length = 379 Score = 50.1 bits (118), Expect = 9e-05, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 M K L +G N++F+P++D+ P IA+K FS PA + A+++SR ++K+ Sbjct: 153 MTKILKETGFNLDFAPLVDINVNPNNPVIAKKERSFSSDPAVVIQDARIYSRHFLKH 209 >gi|153864860|ref|ZP_01997612.1| glycosyl hydrolase [Beggiatoa sp. SS] gi|152145645|gb|EDN72388.1| glycosyl hydrolase [Beggiatoa sp. SS] Length = 340 Score = 50.1 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTY 53 MAK L GIN+NF+PV+D+ P IA+K+ FS P + A F + + Sbjct: 194 MAKTLAELGINLNFAPVVDVNTNPHNPIIAKKQRSFSPNPKIVAQHALEFIKAH 247 >gi|307609946|emb|CBW99474.1| hypothetical protein LPW_12471 [Legionella pneumophila 130b] Length = 378 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I +K FS IP + AQL++ +IK+ Sbjct: 152 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKH 208 >gi|52841424|ref|YP_095223.1| glycosy hydrolase family protein [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|52628535|gb|AAU27276.1| glycosyl hydrolase family 3 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] Length = 395 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I +K FS IP + AQL++ +IK+ Sbjct: 169 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKH 225 >gi|296106822|ref|YP_003618522.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] gi|295648723|gb|ADG24570.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] Length = 378 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I +K FS IP + AQL++ +IK+ Sbjct: 152 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKH 208 >gi|148358777|ref|YP_001249984.1| glycosyl hydrolase family transporter 3 [Legionella pneumophila str. Corby] gi|148280550|gb|ABQ54638.1| glycosyl hydrolase family 3 [Legionella pneumophila str. Corby] Length = 382 Score = 49.4 bits (116), Expect = 1e-04, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I +K FS IP + AQL++ +IK+ Sbjct: 156 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKH 212 >gi|54297148|ref|YP_123517.1| hypothetical protein lpp1193 [Legionella pneumophila str. Paris] gi|53750933|emb|CAH12344.1| hypothetical protein lpp1193 [Legionella pneumophila str. Paris] Length = 382 Score = 49.4 bits (116), Expect = 1e-04, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I +K FS IP + AQL++ +IK+ Sbjct: 156 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKH 212 >gi|189423788|ref|YP_001950965.1| beta-N-acetylhexosaminidase [Geobacter lovleyi SZ] gi|189420047|gb|ACD94445.1| Beta-N-acetylhexosaminidase [Geobacter lovleyi SZ] Length = 392 Score = 48.6 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIKN 56 L T+G+N+NF+PV+DL P++ FS P+ A++F T+ N Sbjct: 171 TLATNGLNMNFAPVVDLNINPQSPAIGALERSFSADPSIVTNHARIFVETHDAN 224 >gi|54294135|ref|YP_126550.1| hypothetical protein lpl1199 [Legionella pneumophila str. Lens] gi|53753967|emb|CAH15438.1| hypothetical protein lpl1199 [Legionella pneumophila str. Lens] Length = 382 Score = 47.4 bits (111), Expect = 6e-04, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L ++G N+NF P LD+ P+ I +K FS IP + AQL++ +I Sbjct: 156 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFI 210 >gi|118580772|ref|YP_902022.1| glycoside hydrolase family 3 protein [Pelobacter propionicus DSM 2379] gi|118503482|gb|ABK99964.1| glycoside hydrolase, family 3 domain protein [Pelobacter propionicus DSM 2379] Length = 393 Score = 45.9 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKA-EESAQLFSRTYIKN 56 + LV G N+N +PV+DL P IA K+ FS PA +A++ + + KN Sbjct: 168 LVDTLVEYGFNLNLAPVVDLSINPANPVIALKQRSFSADPALVSAHAAEVIASHHRKN 225 >gi|270157239|ref|ZP_06185896.1| glycosyl hydrolase [Legionella longbeachae D-4968] gi|289164364|ref|YP_003454502.1| N-acetyl-beta-glucosaminidase [Legionella longbeachae NSW150] gi|269989264|gb|EEZ95518.1| glycosyl hydrolase [Legionella longbeachae D-4968] gi|288857537|emb|CBJ11375.1| putative N-acetyl-beta-glucosaminidase [Legionella longbeachae NSW150] Length = 380 Score = 45.1 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M + L +G N+NF+P LD+ P+ I +K FS P + A ++++ ++ Sbjct: 153 MTQTLKNTGFNLNFAPELDVNVNPDNPIIGKKDRSFSSDPKQIIRYASIYTQQFL 207 >gi|153872350|ref|ZP_02001271.1| conserved hypothetical protein [Beggiatoa sp. PS] gi|152071182|gb|EDN68727.1| conserved hypothetical protein [Beggiatoa sp. PS] Length = 403 Score = 45.1 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTY 53 M L GIN+NF+PV+D+ P IA K FS P + A + + + Sbjct: 180 MGNTLKGLGINLNFAPVVDVNTNPNNPIIAGKERSFSSDPNLVAKHAIEYIKGH 233 >gi|189423786|ref|YP_001950963.1| glycoside hydrolase [Geobacter lovleyi SZ] gi|189420045|gb|ACD94443.1| glycoside hydrolase family 3 domain protein [Geobacter lovleyi SZ] Length = 395 Score = 45.1 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L G N+N +PV+DL P+ IA K FS PA A F +++ Sbjct: 166 LAATLDEYGFNLNLAPVVDLATNPDNPVIAFKERSFSADPALVAAHAAEFIKSH 219 >gi|261886066|ref|ZP_06010105.1| glycosy hydrolase family protein [Campylobacter fetus subsp. venerealis str. Azul-94] Length = 354 Score = 44.7 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 4/59 (6%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKA----EESAQLFSRTYIK 55 MA L GIN+NF+PV+D+ + I QK FS+ P + E + F + IK Sbjct: 135 MADQLKNLGINMNFAPVVDVYNPNSSIIGQKNRAFSKNPDEVIAYSSEFIKSFDKANIK 193 >gi|118474059|ref|YP_891951.1| glycosy hydrolase family protein [Campylobacter fetus subsp. fetus 82-40] gi|118413285|gb|ABK81705.1| glycosyl hyrolase, family 3 [Campylobacter fetus subsp. fetus 82-40] Length = 354 Score = 44.7 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 4/59 (6%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKA----EESAQLFSRTYIK 55 MA L GIN+NF+PV+D+ + I QK FS+ P + E + F + IK Sbjct: 135 MADQLKNLGINMNFAPVVDVYNPNSSIIGQKNRAFSKNPDEVIAYSSEFIKSFDKANIK 193 >gi|189501346|ref|YP_001960816.1| Beta-N-acetylhexosaminidase [Chlorobium phaeobacteroides BS1] gi|189496787|gb|ACE05335.1| Beta-N-acetylhexosaminidase [Chlorobium phaeobacteroides BS1] Length = 373 Score = 44.7 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTY 53 AK L SGINVNF+PV+DL PE + FS A + A+ + Sbjct: 147 AKTLHNSGINVNFAPVVDLNSNPENPVIGSLERSFSADAAIVYKHARATVEAF 199 >gi|77918922|ref|YP_356737.1| putative glycosyl hydrolase [Pelobacter carbinolicus DSM 2380] gi|77545005|gb|ABA88567.1| putative glycosyl hydrolase [Pelobacter carbinolicus DSM 2380] Length = 382 Score = 44.0 bits (102), Expect = 0.006, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTY 53 A+ L +GIN+N SPV+DL P I + + FS P A+ R + Sbjct: 156 ARTLQQAGINLNLSPVVDLNVNPANPIIGRLQRSFSAEPGTVISHAREVIRAH 208 >gi|307721933|ref|YP_003893073.1| glycoside hydrolase family 3 domain-containing protein [Sulfurimonas autotrophica DSM 16294] gi|306980026|gb|ADN10061.1| glycoside hydrolase family 3 domain protein [Sulfurimonas autotrophica DSM 16294] Length = 560 Score = 43.6 bits (101), Expect = 0.008, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQ 47 A+ L +GIN+NF+PV+DL P I + P + + AQ Sbjct: 141 AQILEDAGINMNFAPVVDLSINPNNKVIVALERSYGSDPKEVVKYAQ 187 >gi|291333723|gb|ADD93410.1| b N acetylglucosaminidase glycoside hydrolase family 3 protein [uncultured marine bacterium MedDCM-OCT-S04-C102] Length = 262 Score = 43.6 bits (101), Expect = 0.009, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 24/52 (46%) Query: 5 LVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 L G+NVNF+PV+DL FI F R K ++ F + +N Sbjct: 39 LKELGVNVNFAPVVDLAINTSNFIYNAERSFGRDSDKVYYHSRNFINAHREN 90 >gi|193213634|ref|YP_001999587.1| glycoside hydrolase family 3 domain-containing protein [Chlorobaculum parvum NCIB 8327] gi|193087111|gb|ACF12387.1| glycoside hydrolase family 3 domain protein [Chlorobaculum parvum NCIB 8327] Length = 373 Score = 43.6 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTY 53 AK L + GIN+N +PV+DL PE + K FS PA A++F T+ Sbjct: 146 AKLLKSLGINMNLAPVVDLNVNPENPVIGKLDRSFSSNPAVVARQARIFVDTF 198 >gi|95929642|ref|ZP_01312384.1| glycoside hydrolase, family 3-like [Desulfuromonas acetoxidans DSM 684] gi|95134339|gb|EAT15996.1| glycoside hydrolase, family 3-like [Desulfuromonas acetoxidans DSM 684] Length = 411 Score = 43.6 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L T GIN+N +PV+DL P+ IA+ FS P + + A + + Sbjct: 161 LATTLATFGINLNLAPVVDLCSNPDNPVIARLDRCFSATPDQVTDQAGAYIAGH 214 >gi|270159405|ref|ZP_06188061.1| glycosyl hydrolase family 3 protein [Legionella longbeachae D-4968] gi|289165783|ref|YP_003455921.1| glycosyl hydrolase [Legionella longbeachae NSW150] gi|269987744|gb|EEZ93999.1| glycosyl hydrolase family 3 protein [Legionella longbeachae D-4968] gi|288858956|emb|CBJ12882.1| putative glycosyl hydrolase [Legionella longbeachae NSW150] Length = 357 Score = 43.2 bits (100), Expect = 0.011, Method: Composition-based stats. Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLF 49 MA L + G N+NF+PV+DL E I FS IP + A+ F Sbjct: 128 MALTLKSLGFNLNFAPVVDLNLQEEQGIIGALHRSFSAIPEQVIRFAKQF 177 >gi|317050968|ref|YP_004112084.1| glycoside hydrolase family 3 domain-containing protein [Desulfurispirillum indicum S5] gi|316946052|gb|ADU65528.1| glycoside hydrolase family 3 domain protein [Desulfurispirillum indicum S5] Length = 370 Score = 43.2 bits (100), Expect = 0.013, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRT 52 MA+ L G+N+NF+PV+D+ PE + FS + + F+R Sbjct: 145 MAQALAGLGVNLNFAPVVDVNMNPENPVIGSLGRSFSADASAVARHGEQFARA 197 >gi|307353677|ref|YP_003894728.1| glycoside hydrolase family 3 domain-containing protein [Methanoplanus petrolearius DSM 11571] gi|307156910|gb|ADN36290.1| glycoside hydrolase family 3 domain protein [Methanoplanus petrolearius DSM 11571] Length = 399 Score = 42.8 bits (99), Expect = 0.015, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTY 53 +A + +G N+NF+PV+DL+ P++ K FS P +A + Sbjct: 173 LADTVKDAGFNMNFAPVVDLMVNPDSPAIGKLNRSFSEDPVVVVRNAGWIIDEH 226 >gi|298529404|ref|ZP_07016807.1| glycoside hydrolase family 3 domain protein [Desulfonatronospira thiodismutans ASO3-1] gi|298510840|gb|EFI34743.1| glycoside hydrolase family 3 domain protein [Desulfonatronospira thiodismutans ASO3-1] Length = 372 Score = 42.8 bits (99), Expect = 0.015, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTY 53 A L GIN+N +PV+D+ P+ + + FS P K A + + Sbjct: 150 AVTLKDMGINLNLAPVVDVNVNPDNPVIGRLERSFSSDPEKVAVHAAEVIKAH 202 >gi|157165607|ref|YP_001466722.1| glycoside hydrolase family 3 protein [Campylobacter concisus 13826] gi|112800169|gb|EAT97513.1| beta-hexosaminidase A (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) (Chitobiase) [Campylobacter concisus 13826] Length = 351 Score = 42.8 bits (99), Expect = 0.016, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 27/53 (50%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA NL GIN+NF+PV+DL IA K+ FS +K A F + Sbjct: 133 MAINLKECGINLNFAPVVDLHDENSPIIAAKQRAFSEYASKVVIYADAFMDAF 185 >gi|193213964|ref|YP_001995163.1| beta-N-acetylhexosaminidase [Chloroherpeton thalassium ATCC 35110] gi|193087441|gb|ACF12716.1| Beta-N-acetylhexosaminidase [Chloroherpeton thalassium ATCC 35110] Length = 384 Score = 42.8 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESA 46 AK L GIN+NF+PVLD+ PE + K FS P E Sbjct: 160 AKTLAALGINLNFAPVLDVNTNPENPVIGKLARSFSENPEIVAEHG 205 >gi|148800320|gb|ABR12885.1| Orf31 [Mesorhizobium sp. CJ1] Length = 393 Score = 42.8 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTY 53 +A L G N+N +PV+DL P I K FS P E A++F + Sbjct: 155 LASALSDLGFNLNLAPVVDLNVNPANPIIGKLGRSFSADPQTVETYAKVFIEAH 208 >gi|255322696|ref|ZP_05363840.1| glycosyl hydrolase, family 3 [Campylobacter showae RM3277] gi|255300257|gb|EET79530.1| glycosyl hydrolase, family 3 [Campylobacter showae RM3277] Length = 361 Score = 42.4 bits (98), Expect = 0.020, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 25/52 (48%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 MA+ L G+NVNF+PV D+L T I + FS + A F R Sbjct: 141 MAQQLKDVGVNVNFAPVADVLNPKSTIIGSRGRAFSTDIDEVSLYASEFMRA 192 >gi|13488104|ref|NP_085717.1| glycosy hydrolase family protein [Mesorhizobium loti MAFF303099] gi|14027966|dbj|BAB54558.1| glycosyl hyrolase, family 3 [Mesorhizobium loti MAFF303099] Length = 394 Score = 42.4 bits (98), Expect = 0.021, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTY 53 +A +L + G N+N +PV+DL P I K FS P K E A+ F + Sbjct: 156 LASDLSSLGFNLNLAPVVDLNVNPANPIIGKLGRSFSADPQKVEAYARAFIEAH 209 >gi|223039793|ref|ZP_03610078.1| glycosyl hyrolase, family 3 [Campylobacter rectus RM3267] gi|222878985|gb|EEF14081.1| glycosyl hyrolase, family 3 [Campylobacter rectus RM3267] Length = 363 Score = 42.4 bits (98), Expect = 0.022, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 25/52 (48%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 MA+ L GINVNF+PV D+L T I + FS + A F + Sbjct: 143 MAQQLKDVGINVNFAPVADVLNPKSTIIGSRGRAFSADIDEVSLYASEFMKA 194 >gi|301167675|emb|CBW27258.1| putative sugar hydrolase [Bacteriovorax marinus SJ] Length = 405 Score = 41.6 bits (96), Expect = 0.032, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTY 53 +A++L + GIN+NF+P D+ P+ + K +S P K + F +++ Sbjct: 137 LAQDLESVGINLNFAPSADVNTNPDNPVIGKIERSYSSDPLKVSNNVAAFIKSH 190 >gi|296444426|ref|ZP_06886391.1| Beta-N-acetylhexosaminidase [Methylosinus trichosporium OB3b] gi|296258073|gb|EFH05135.1| Beta-N-acetylhexosaminidase [Methylosinus trichosporium OB3b] Length = 330 Score = 41.3 bits (95), Expect = 0.049, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Query: 9 GINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRT 52 G++VN +PV+DL P++ I + FS PA EE A+ + Sbjct: 122 GLDVNLAPVVDLDINPDSPDIGSAQRSFSADPAIVEECARTLAEA 166 >gi|256830691|ref|YP_003159419.1| beta-N-acetylhexosaminidase [Desulfomicrobium baculatum DSM 4028] gi|256579867|gb|ACU91003.1| Beta-N-acetylhexosaminidase [Desulfomicrobium baculatum DSM 4028] Length = 382 Score = 41.3 bits (95), Expect = 0.049, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSR 51 K L G+N+NF+PV D+ P++ FS P A F R Sbjct: 150 KLLADLGVNLNFAPVADVDINPQSPAIGALERSFSADPDLVALHAHAFCR 199 >gi|78357601|ref|YP_389050.1| Beta-N-acetylhexosaminidase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] gi|78220006|gb|ABB39355.1| Beta-N-acetylhexosaminidase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] Length = 398 Score = 41.3 bits (95), Expect = 0.052, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 9 GINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSR 51 G+N+NF+PV+D+ P+ I + FS AQ F + Sbjct: 167 GVNLNFAPVVDVNVRPDNPVIGRAGRSFSADSEAVARHAQAFLQ 210 >gi|313679320|ref|YP_004057059.1| glycoside hydrolase family 3 domain protein [Oceanithermus profundus DSM 14977] gi|313152035|gb|ADR35886.1| glycoside hydrolase family 3 domain protein [Oceanithermus profundus DSM 14977] Length = 492 Score = 40.5 bits (93), Expect = 0.070, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G N+NF+PVLDL P + F P +A E A + +++ Sbjct: 103 ARGLAAYGFNLNFAPVLDLNTNPANPVI-AERSFGADPERASELALAWHEGHVQ 155 >gi|196018043|ref|XP_002118719.1| hypothetical protein TRIADDRAFT_62735 [Trichoplax adhaerens] gi|190578387|gb|EDV18794.1| hypothetical protein TRIADDRAFT_62735 [Trichoplax adhaerens] Length = 224 Score = 40.5 bits (93), Expect = 0.070, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPE-TFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MAK L GIN NF+P +D+ P + I FS P ++ F + Sbjct: 118 MAKILKNYGINFNFAPCVDVDTNPTCSVIGGYERSFSDNPETVIHYSKQFIDAH 171 >gi|217978397|ref|YP_002362544.1| glycoside hydrolase family 3 domain protein [Methylocella silvestris BL2] gi|217503773|gb|ACK51182.1| glycoside hydrolase family 3 domain protein [Methylocella silvestris BL2] Length = 365 Score = 40.5 bits (93), Expect = 0.072, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M + L + G+N+NF+PVLD+ P + F P + +A F R K Sbjct: 113 MGRELASLGVNLNFAPVLDIHTNPANPVIG-ERAFGSTPDEVIAAALPFMRAMQK 166 >gi|78778263|ref|YP_394578.1| Beta-N-acetylhexosaminidase [Sulfurimonas denitrificans DSM 1251] gi|78498803|gb|ABB45343.1| Beta-N-acetylhexosaminidase [Sulfurimonas denitrificans DSM 1251] Length = 358 Score = 40.5 bits (93), Expect = 0.074, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLF 49 +AK L +GIN NF+PV+DL P I + ++ + A++F Sbjct: 135 LAKTLRQNGINCNFAPVVDLALNPNNKVIYGLNRSYGAASSEVIKYAKIF 184 >gi|78187897|ref|YP_375940.1| glycosy hydrolase family protein [Chlorobium luteolum DSM 273] gi|78167799|gb|ABB24897.1| glycosyl hydrolase, family 3 [Chlorobium luteolum DSM 273] Length = 378 Score = 40.1 bits (92), Expect = 0.096, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIK 55 A+ L + G+N+N +PV+DL P+ + + +S P A + + T+++ Sbjct: 151 ARTLQSMGVNMNLAPVVDLDTNPQNPVIGRIERSYSPDPDIVSSQAAIVTTTFLR 205 >gi|254495607|ref|ZP_05108529.1| glycosyl hydrolase [Legionella drancourtii LLAP12] gi|254355177|gb|EET13790.1| glycosyl hydrolase [Legionella drancourtii LLAP12] Length = 358 Score = 39.7 bits (91), Expect = 0.13, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 1 MAKNLVTSGINVNFSPVLDL-LYGPETFIAQKRSIFSRIPAKAEESAQLF 49 MA+ L G N+NF+PV+DL +Y + I FS P A+ F Sbjct: 129 MAETLKALGFNLNFAPVVDLHMYDQQGIIGALHRSFSDDPETVIRMARQF 178 >gi|21672931|ref|NP_660996.1| glycosy hydrolase family protein [Chlorobium tepidum TLS] gi|21645987|gb|AAM71338.1| glycosyl hydrolase, family 3 [Chlorobium tepidum TLS] Length = 372 Score = 39.7 bits (91), Expect = 0.13, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Query: 5 LVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTY 53 L + GINVN +PV+DL P + K FS P + A++ + Sbjct: 149 LKSLGINVNLAPVVDLNVNPSNPVIGKLDRSFSADPVVVAQQARMVIDAF 198 >gi|78189925|ref|YP_380263.1| glycosy hydrolase family protein [Chlorobium chlorochromatii CaD3] gi|78172124|gb|ABB29220.1| glycosyl hydrolase, family 3 [Chlorobium chlorochromatii CaD3] Length = 374 Score = 39.7 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTY 53 +AK L +N+NF+PV DL P + K FS A+A +L + TY Sbjct: 148 IAKTLRAMHVNMNFAPVADLNRNPNNPVIGKVERSFSADAARATTHIRLTADTY 201 >gi|256392352|ref|YP_003113916.1| beta-N-acetylhexosaminidase [Catenulispora acidiphila DSM 44928] gi|256358578|gb|ACU72075.1| Beta-N-acetylhexosaminidase [Catenulispora acidiphila DSM 44928] Length = 438 Score = 39.7 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 22/41 (53%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEE 44 N+ G+N+N +PVLD+ P F+ + FS+ P + Sbjct: 218 NMAGVGMNLNLAPVLDVYRTPGNFLDAAQRSFSQNPNTVSQ 258 >gi|257054254|ref|YP_003132086.1| beta-glucosidase-like glycosyl hydrolase [Saccharomonospora viridis DSM 43017] gi|256584126|gb|ACU95259.1| beta-glucosidase-like glycosyl hydrolase [Saccharomonospora viridis DSM 43017] Length = 383 Score = 39.3 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 + L G+ V+++PV+DL GP + FS P A E A F+ Sbjct: 167 EQLSARGVTVDYAPVVDLTDGPANGVIG-DRSFSADPQTATEYAAAFA 213 >gi|154174220|ref|YP_001408361.1| glycosyl hydrolase family protein [Campylobacter curvus 525.92] gi|112802602|gb|EAT99946.1| glycosyl hyrolase, family 3 [Campylobacter curvus 525.92] Length = 350 Score = 38.9 bits (89), Expect = 0.22, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 26/56 (46%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L SGINV+ +PV+DL I K FS +K A F + ++ Sbjct: 132 MADELKQSGINVDLAPVVDLHDEASPIIGAKERAFSENASKVIFYANAFMDAFKRD 187 >gi|162447148|ref|YP_001620280.1| glycoside hydrolase family 3 protein [Acholeplasma laidlawii PG-8A] gi|161985255|gb|ABX80904.1| glycoside hydrolase, family 3 [Acholeplasma laidlawii PG-8A] Length = 523 Score = 38.9 bits (89), Expect = 0.23, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 5/55 (9%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M K L+ GIN++ +PVLD+ P+ + RS FS P K LF I+ Sbjct: 119 MGKELIDLGINMDLAPVLDVNNNPKNPVIGVRS-FSDDPDKVA----LFGNANIR 168 >gi|163755898|ref|ZP_02163015.1| b-N-acetylglucosaminidase, glycoside hydrolase family 3 protein [Kordia algicida OT-1] gi|161324069|gb|EDP95401.1| b-N-acetylglucosaminidase, glycoside hydrolase family 3 protein [Kordia algicida OT-1] Length = 366 Score = 38.9 bits (89), Expect = 0.24, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 27/53 (50%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A NL+ GINVN++PVLD+ I + FS+ P A+ ++ Sbjct: 141 IAHNLLQLGINVNYAPVLDVHNDNNPPIGKNHRAFSKNPQDIINHARQVVLSH 193 >gi|260459754|ref|ZP_05808008.1| Beta-N-acetylhexosaminidase [Mesorhizobium opportunistum WSM2075] gi|259034556|gb|EEW35813.1| Beta-N-acetylhexosaminidase [Mesorhizobium opportunistum WSM2075] Length = 437 Score = 38.6 bits (88), Expect = 0.29, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTY 53 +A +L G N+NF PV DL P I K FS P + F R + Sbjct: 167 LATDLREWGFNLNFGPVADLNVNPANPIIGKLGRSFSANPEIVAQYGAAFVRAH 220 >gi|41409786|ref|NP_962622.1| LpqI [Mycobacterium avium subsp. paratuberculosis K-10] gi|41398618|gb|AAS06238.1| LpqI [Mycobacterium avium subsp. paratuberculosis K-10] Length = 388 Score = 38.6 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSR 51 K + GI V+F+PV+D+ P+ + F PAK E A +++ Sbjct: 164 KKMRDLGITVDFAPVVDVSDEPDDAVIG-NRSFGADPAKVTEYAGAYAQ 211 >gi|124515181|gb|EAY56692.1| Beta-N-acetylhexosaminidase [Leptospirillum rubarum] Length = 342 Score = 38.2 bits (87), Expect = 0.35, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSR 51 + + L +GI+++F+PVLD+ P+ + FSR P + + FS Sbjct: 111 LGRALRQTGIDIDFAPVLDVDSNPDNPVIG-DRSFSREPWEVARLSMAFSH 160 >gi|332140001|ref|YP_004425739.1| Beta-hexosaminidase A precursor [Alteromonas macleodii str. 'Deep ecotype'] gi|327550023|gb|AEA96741.1| Beta-hexosaminidase A precursor [Alteromonas macleodii str. 'Deep ecotype'] Length = 687 Score = 38.2 bits (87), Expect = 0.38, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 + K L+ GIN NF+P +D+ P+ + RS FS P + Q F Sbjct: 201 IGKTLLPLGINTNFAPSVDINSEPKNPVINVRS-FSEHPEQVAALGQTFVEA 251 >gi|152992043|ref|YP_001357764.1| glycosy hydrolase family protein [Sulfurovum sp. NBC37-1] gi|151423904|dbj|BAF71407.1| glycosyl hydrolase, family 3 [Sulfurovum sp. NBC37-1] Length = 361 Score = 38.2 bits (87), Expect = 0.41, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLF 49 MAK L + GIN + +PV+DL P+ I F + P A F Sbjct: 140 MAKELKSVGINYDLAPVVDLDINPKNHVIHGLGRSFGKDPKTVAAYASTF 189 >gi|319779640|ref|YP_004130553.1| Beta N-acetyl-glucosaminidase [Taylorella equigenitalis MCE9] gi|317109664|gb|ADU92410.1| Beta N-acetyl-glucosaminidase [Taylorella equigenitalis MCE9] Length = 351 Score = 37.8 bits (86), Expect = 0.47, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 6/55 (10%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L++ G++ +++PVLDL YG T I F + P + SR +I+ Sbjct: 112 MAMELLSCGVDFSYAPVLDLDYGFSTVIG--DRAFHKDPKVVA----ILSRAFIQ 160 >gi|42521783|ref|NP_967163.1| hypothetical protein Bd0146 [Bdellovibrio bacteriovorus HD100] gi|39574313|emb|CAE77817.1| bglX2 [Bdellovibrio bacteriovorus HD100] Length = 370 Score = 37.8 bits (86), Expect = 0.50, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 GIN++F+P +D+ P + RSI S P + A R YIK+ Sbjct: 120 GINLDFAPCVDIFTNPGNTVIGDRSI-SSDPEMVAKHASALVRGYIKS 166 >gi|46580644|ref|YP_011452.1| glycosy hydrolase family protein [Desulfovibrio vulgaris str. Hildenborough] gi|120602051|ref|YP_966451.1| glycoside hydrolase family 3 protein [Desulfovibrio vulgaris DP4] gi|46450063|gb|AAS96712.1| glycosyl hydrolase, family 3 [Desulfovibrio vulgaris str. Hildenborough] gi|120562280|gb|ABM28024.1| glycoside hydrolase, family 3 domain protein [Desulfovibrio vulgaris DP4] gi|311234375|gb|ADP87229.1| glycoside hydrolase family 3 domain protein [Desulfovibrio vulgaris RCH1] Length = 481 Score = 37.8 bits (86), Expect = 0.52, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLF 49 +A + G+NV+F PV+DL P IA+ + P + A F Sbjct: 172 LATEMAEVGLNVDFGPVVDLAVNPSNPVIARLERSYGSDPCRVASHAAAF 221 >gi|118464303|ref|YP_884041.1| glycosyl hydrolase family protein 3 [Mycobacterium avium 104] gi|254777359|ref|ZP_05218875.1| glycosyl hydrolase family protein 3 [Mycobacterium avium subsp. avium ATCC 25291] gi|118165590|gb|ABK66487.1| Glycosyl hydrolase family protein 3 [Mycobacterium avium 104] Length = 388 Score = 37.8 bits (86), Expect = 0.52, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSR 51 K + GI ++F+PV+D+ P+ + F PAK E A +++ Sbjct: 164 KKMRDLGITIDFAPVVDVSDEPDDAVIG-NRSFGADPAKVTEYAGAYAQ 211 >gi|51891438|ref|YP_074129.1| putative beta-N-acetylglucosaminidase [Symbiobacterium thermophilum IAM 14863] gi|51855127|dbj|BAD39285.1| putative beta-N-acetylglucosaminidase [Symbiobacterium thermophilum IAM 14863] Length = 523 Score = 37.8 bits (86), Expect = 0.55, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A+ L GIN+N +PVLD+ P + RS F PA+ E + R + Sbjct: 112 IARELRAMGINMNLAPVLDVNVNPANPVIGVRS-FGSDPARVAEHGAAYIRGH 163 >gi|146337722|ref|YP_001202770.1| glycoside hydrolase family protein [Bradyrhizobium sp. ORS278] gi|146190528|emb|CAL74527.1| putative Glycosyl hydrolase, family 3 [Bradyrhizobium sp. ORS278] Length = 369 Score = 37.8 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query: 10 INVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 INVN +PV+DL P I Q++ + P A F + + K Sbjct: 137 INVNLAPVVDLNTNPANPIIGQRQRSYGSEPDTVVRYAAAFVQAHRK 183 >gi|53803933|ref|YP_114416.1| beta-hexosaminidase [Methylococcus capsulatus str. Bath] gi|81681671|sp|Q606N2|NAGZ_METCA RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|53757694|gb|AAU91985.1| beta-N-acetylhexosaminidase [Methylococcus capsulatus str. Bath] Length = 334 Score = 37.4 bits (85), Expect = 0.59, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 MA L G++ +F+PVLD+ G T I F+R P + +A+ F+ Sbjct: 98 MAAELRAVGVDFSFAPVLDVDSGISTVIG--DRAFARTPEEVTAAARAFA 145 >gi|38327416|gb|AAR17736.1| putative hydrolase [Bdellovibrio bacteriovorus] Length = 369 Score = 37.4 bits (85), Expect = 0.60, Method: Composition-based stats. Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 GIN++F+P +D+ P + RSI S P + A R YIK Sbjct: 120 GINLDFAPCVDIFTNPGNTVIGDRSI-SSDPEMVAKHASALVRGYIK 165 >gi|206603689|gb|EDZ40169.1| Beta-N-acetylhexosaminidase [Leptospirillum sp. Group II '5-way CG'] Length = 342 Score = 37.4 bits (85), Expect = 0.60, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Query: 5 LVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSR 51 L +GI+++F+PVLD+ P+ + FSR P + + FS Sbjct: 115 LRQTGIDIDFAPVLDVDSNPDNPVIG-DRSFSREPWEVARLSMAFSH 160 >gi|297622431|ref|YP_003703865.1| glycoside hydrolase family 3 domain-containing protein [Truepera radiovictrix DSM 17093] gi|297163611|gb|ADI13322.1| glycoside hydrolase family 3 domain protein [Truepera radiovictrix DSM 17093] Length = 507 Score = 37.4 bits (85), Expect = 0.63, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ L G+NVNF+PV D+ + P + F P F + Sbjct: 102 ARGLRAVGVNVNFAPVADVNHNPRNPVI-AERAFGGDPEAVARHVAAFVAGH 152 >gi|254491750|ref|ZP_05104929.1| Glycosyl hydrolase family 3 N terminal domain protein [Methylophaga thiooxidans DMS010] gi|224463228|gb|EEF79498.1| Glycosyl hydrolase family 3 N terminal domain protein [Methylophaga thiooxydans DMS010] Length = 349 Score = 37.4 bits (85), Expect = 0.70, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 26/58 (44%), Gaps = 6/58 (10%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 MA L GI+ +F+PVLDL YG I F R P + +R YI K Sbjct: 108 MAAELRAVGIDFSFAPVLDLNYGVSQVIG--DRAFHRDPKAVTD----IARAYIHGMK 159 >gi|317154368|ref|YP_004122416.1| glycoside hydrolase family 3 domain-containing protein [Desulfovibrio aespoeensis Aspo-2] gi|316944619|gb|ADU63670.1| glycoside hydrolase family 3 domain protein [Desulfovibrio aespoeensis Aspo-2] Length = 379 Score = 37.4 bits (85), Expect = 0.72, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLF 49 L +G N++F+PV D+ P++ I + FS PA+ A LF Sbjct: 160 TLRQAGFNLDFAPVADVDVNPDSPAIGRLGRSFSADPARVGRCAGLF 206 >gi|31747863|gb|AAN10188.1| putative glycosylhydrolase [Candidatus Fritschea bemisiae] Length = 389 Score = 37.0 bits (84), Expect = 0.86, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSR 51 GI++NF+PV+D+ P + F P K A L + Sbjct: 137 GIHLNFAPVVDINNHPNNTVIG-NRSFGSDPEKVSRCASLIIQ 178 >gi|332184589|gb|AEE26843.1| Beta-hexosaminidase [Francisella cf. novicida 3523] Length = 378 Score = 37.0 bits (84), Expect = 0.92, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 23/52 (44%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 MA+ + GIN+N +P +D+ I + FS + A LF + Sbjct: 146 MAETMYKVGINLNLAPCVDIHNDNCPIIGKYERSFSTDVNTIVDCANLFCKA 197 >gi|323700659|ref|ZP_08112571.1| glycoside hydrolase family 3 domain protein [Desulfovibrio sp. ND132] gi|323460591|gb|EGB16456.1| glycoside hydrolase family 3 domain protein [Desulfovibrio desulfuricans ND132] Length = 380 Score = 36.6 bits (83), Expect = 1.0, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLF 49 +L + G N+NF+PV+D+ P++ I + FS P + A +F Sbjct: 161 DLSSVGFNLNFAPVVDVNVDPDSPAIGRLGRSFSSDPERVARCAGIF 207 >gi|254457746|ref|ZP_05071174.1| B-N-acetylglucosaminidase, glycoside hydrolase family 3 protein [Campylobacterales bacterium GD 1] gi|207086538|gb|EDZ63822.1| B-N-acetylglucosaminidase, glycoside hydrolase family 3 protein [Campylobacterales bacterium GD 1] Length = 555 Score = 36.6 bits (83), Expect = 1.0, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +K L + IN NF+PV+DL P+ I++ F + K A++ + K+ Sbjct: 138 SKMLSNNNINCNFAPVVDLDINPKNKVISELERSFGKDSEKVTHYAKIVIDSQTKH 193 >gi|302529885|ref|ZP_07282227.1| glycosyl hydrolase [Streptomyces sp. AA4] gi|302438780|gb|EFL10596.1| glycosyl hydrolase [Streptomyces sp. AA4] Length = 353 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 23/40 (57%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKA 42 +NL G+NVN +PVLD+ P FI + +S+ P A Sbjct: 133 QNLAGVGMNVNLAPVLDVYRQPGNFIDKYGRSYSQDPQVA 172 >gi|162452568|ref|YP_001614935.1| put. Beta-glucosidase [Sorangium cellulosum 'So ce 56'] gi|161163150|emb|CAN94455.1| put. Beta-glucosidase [Sorangium cellulosum 'So ce 56'] Length = 371 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLF 49 +A L GIN+NF+PVLD+ P I F R P A F Sbjct: 113 VASELRAVGINLNFAPVLDVDSNPANPIIG-DRAFGRDPGAVARGAVAF 160 >gi|325281835|ref|YP_004254377.1| Beta-N-acetylhexosaminidase [Odoribacter splanchnicus DSM 20712] gi|324313644|gb|ADY34197.1| Beta-N-acetylhexosaminidase [Odoribacter splanchnicus DSM 20712] Length = 1001 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 G++VNF+PV+D+ P I RS F P + + A L++ Sbjct: 151 GVHVNFAPVVDINSNPRNPIIGMRS-FGEDPEEVTQKAILYA 191 >gi|260578567|ref|ZP_05846477.1| lipoprotein [Corynebacterium jeikeium ATCC 43734] gi|258603282|gb|EEW16549.1| lipoprotein [Corynebacterium jeikeium ATCC 43734] Length = 334 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Query: 3 KNLVTSGINVNFSPVLDLLYGPE-TFIAQKRSIFSRIPAKAEESAQLFSR 51 K + GI V+F+PV+DL G E + A FS P A + A+ +S Sbjct: 112 KKVRDLGITVDFAPVVDLAGGQEVSDNAIGSRSFSADPKVAADYARAYSE 161 >gi|320333474|ref|YP_004170185.1| glycoside hydrolase family 3 domain-containing protein [Deinococcus maricopensis DSM 21211] gi|319754763|gb|ADV66520.1| glycoside hydrolase family 3 domain protein [Deinococcus maricopensis DSM 21211] Length = 496 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAE 43 A+ L+ GIN NF+P LD+ P + F P + Sbjct: 104 ARGLLDLGINWNFAPALDVNVNPLNPVIG-ERSFGADPHEVA 144 >gi|332678767|gb|AEE87896.1| Beta-hexosaminidase [Francisella cf. novicida Fx1] Length = 378 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 25/56 (44%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MAK + GIN+N +P +D+ I + FS + A LF + K+ Sbjct: 146 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEKH 201 >gi|208779545|ref|ZP_03246890.1| glycosyl hydrolase family 3 N domain protein [Francisella novicida FTG] gi|208744506|gb|EDZ90805.1| glycosyl hydrolase family 3 N domain protein [Francisella novicida FTG] Length = 351 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 25/56 (44%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MAK + GIN+N +P +D+ I + FS + A LF + K+ Sbjct: 119 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEKH 174 >gi|194323270|ref|ZP_03057054.1| glycosyl hydrolase family 3 N domain protein [Francisella tularensis subsp. novicida FTE] gi|194322634|gb|EDX20114.1| glycosyl hydrolase family 3 N domain protein [Francisella tularensis subsp. novicida FTE] Length = 351 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 25/56 (44%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MAK + GIN+N +P +D+ I + FS + A LF + K+ Sbjct: 119 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEKH 174 >gi|254373400|ref|ZP_04988888.1| hypothetical protein FTCG_00990 [Francisella tularensis subsp. novicida GA99-3549] gi|151571126|gb|EDN36780.1| hypothetical protein FTCG_00990 [Francisella novicida GA99-3549] Length = 347 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 25/56 (44%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MAK + GIN+N +P +D+ I + FS + A LF + K+ Sbjct: 115 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEKH 170 >gi|118498045|ref|YP_899095.1| glycosy hydrolase family protein [Francisella tularensis subsp. novicida U112] gi|82452987|gb|ABB76142.1| BlgX [Francisella novicida] gi|118423951|gb|ABK90341.1| glycosyl hydrolase family 3 [Francisella novicida U112] Length = 378 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 25/56 (44%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MAK + GIN+N +P +D+ I + FS + A LF + K+ Sbjct: 146 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEKH 201 >gi|89095930|ref|ZP_01168824.1| beta-hexosamidase A precursor [Bacillus sp. NRRL B-14911] gi|89089676|gb|EAR68783.1| beta-hexosamidase A precursor [Bacillus sp. NRRL B-14911] Length = 694 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEE 44 + + L GIN NF+PV+D+ P+ + RS F P E Sbjct: 261 IGEELAALGINTNFAPVMDVNNNPDNPVIGVRS-FGENPELVAE 303 >gi|254374863|ref|ZP_04990344.1| hypothetical protein FTDG_01041 [Francisella novicida GA99-3548] gi|151572582|gb|EDN38236.1| hypothetical protein FTDG_01041 [Francisella novicida GA99-3548] Length = 347 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 23/52 (44%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 MAK + GIN+N +P +D+ I + FS + A LF + Sbjct: 115 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKA 166 >gi|224457774|ref|ZP_03666247.1| glycosy hydrolase family protein [Francisella tularensis subsp. tularensis MA00-2987] gi|254371223|ref|ZP_04987225.1| hypothetical protein [Francisella tularensis subsp. tularensis FSC033] gi|254875454|ref|ZP_05248164.1| glycosyl hydrolase [Francisella tularensis subsp. tularensis MA00-2987] gi|151569463|gb|EDN35117.1| hypothetical protein FTBG_00992 [Francisella tularensis subsp. tularensis FSC033] gi|254841453|gb|EET19889.1| glycosyl hydrolase [Francisella tularensis subsp. tularensis MA00-2987] gi|282159820|gb|ADA79211.1| glycosyl hydrolase family 3 [Francisella tularensis subsp. tularensis NE061598] Length = 347 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 23/52 (44%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 MAK + GIN+N +P +D+ I + FS + A LF + Sbjct: 115 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKA 166 >gi|167009145|ref|ZP_02274076.1| glycosyl hydrolase family 3 [Francisella tularensis subsp. holarctica FSC200] gi|254367306|ref|ZP_04983332.1| glycosyl hydrolase [Francisella tularensis subsp. holarctica 257] gi|134253122|gb|EBA52216.1| glycosyl hydrolase [Francisella tularensis subsp. holarctica 257] Length = 347 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 23/52 (44%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 MAK + GIN+N +P +D+ I + FS + A LF + Sbjct: 115 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKA 166 >gi|115314432|ref|YP_763155.1| glycosyl hydrolase [Francisella tularensis subsp. holarctica OSU18] gi|156501943|ref|YP_001428008.1| glycosy hydrolase family protein [Francisella tularensis subsp. holarctica FTNF002-00] gi|290954606|ref|ZP_06559227.1| glycosy hydrolase family protein [Francisella tularensis subsp. holarctica URFT1] gi|295311949|ref|ZP_06802773.1| glycosy hydrolase family protein [Francisella tularensis subsp. holarctica URFT1] gi|115129331|gb|ABI82518.1| probable glycosyl hydrolase [Francisella tularensis subsp. holarctica OSU18] gi|156252546|gb|ABU61052.1| glycosyl hydrolase family 3 [Francisella tularensis subsp. holarctica FTNF002-00] Length = 347 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 23/52 (44%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 MAK + GIN+N +P +D+ I + FS + A LF + Sbjct: 115 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKA 166 >gi|194719503|gb|ACF93787.1| HexI [Collimonas fungivorans Ter331] Length = 521 Score = 36.3 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESA 46 +A+ + + G N NF+PVLDL P + F P +A E A Sbjct: 120 VARGIRSLGFNWNFAPVLDLNNNPANPVIG-ERSFGSDPQRATELA 164 >gi|311898955|dbj|BAJ31363.1| putative glycoside hydrolase [Kitasatospora setae KM-6054] Length = 419 Score = 36.3 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 23/51 (45%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 A L G+N+N +PVLD+ P F + +S PA + F + Sbjct: 197 AAALTRYGLNLNLAPVLDVYRTPGDFADSAQRSYSTDPATVGKLGSAFLKA 247 >gi|68535234|ref|YP_249939.1| putative beta-glucosidase-related glycosidase [Corynebacterium jeikeium K411] gi|68262833|emb|CAI36321.1| putative beta-glucosidase-related glycosidase [Corynebacterium jeikeium K411] Length = 401 Score = 36.3 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Query: 3 KNLVTSGINVNFSPVLDLLYGPE-TFIAQKRSIFSRIPAKAEESAQLFSR 51 K + GI V+F+PV+DL G E + A FS P A + A+ +S Sbjct: 179 KKVRDLGITVDFAPVVDLAGGQEVSDNAIGSRSFSADPKVAADYARAYSE 228 >gi|34495714|ref|NP_899929.1| glycosyl hydrolase family protein [Chromobacterium violaceum ATCC 12472] gi|34101569|gb|AAQ57938.1| probable glycosyl hyrolase, family 3 [Chromobacterium violaceum ATCC 12472] Length = 505 Score = 35.9 bits (81), Expect = 1.7, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ L + G+N NF+PVLDL P + F PA+A A+ + ++ Sbjct: 111 VARGLKSLGVNWNFAPVLDLNNNPANPVIG-ERSFGADPARAAALARAWMEGHL 163 >gi|149919407|ref|ZP_01907888.1| hypothetical protein PPSIR1_27268 [Plesiocystis pacifica SIR-1] gi|149819713|gb|EDM79138.1| hypothetical protein PPSIR1_27268 [Plesiocystis pacifica SIR-1] Length = 279 Score = 35.9 bits (81), Expect = 1.7, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 +A L+ G +++F+PV+D+ P+ + F+R PA F R Sbjct: 108 LALELLDCGFDLDFAPVVDVDSNPDNPVIG-DRSFARDPATVGAHGAAFIRA 158 >gi|254501037|ref|ZP_05113188.1| Glycosyl hydrolase family 3 N terminal domain protein [Labrenzia alexandrii DFL-11] gi|222437108|gb|EEE43787.1| Glycosyl hydrolase family 3 N terminal domain protein [Labrenzia alexandrii DFL-11] Length = 412 Score = 35.9 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Query: 10 INVNFSPVLDLLYGP-ETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 INVNF PV+D+ P I +K+ FS P A F + Sbjct: 157 INVNFGPVVDVDINPGNPIIGKKKRSFSADPTTVTNCAAGFIAAH 201 >gi|289577462|ref|YP_003476089.1| glycoside hydrolase [Thermoanaerobacter italicus Ab9] gi|289527175|gb|ADD01527.1| glycoside hydrolase family 3 domain protein [Thermoanaerobacter italicus Ab9] Length = 525 Score = 35.9 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K L GIN+NF+PVLD+ P + RS + P K E F YIK Sbjct: 118 KELRALGININFAPVLDVNNNPSNPVIGVRS-YGENPEKVAE----FGINYIK 165 >gi|52078658|ref|YP_077449.1| glycoside hydrolase family protein [Bacillus licheniformis ATCC 14580] gi|52784020|ref|YP_089849.1| YbbD [Bacillus licheniformis ATCC 14580] gi|52001869|gb|AAU21811.1| Glycoside hydrolase, family 3 [Bacillus licheniformis ATCC 14580] gi|52346522|gb|AAU39156.1| YbbD [Bacillus licheniformis ATCC 14580] Length = 643 Score = 35.9 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPA 40 + K L + GINVNFSPVLD+ P+ + RS FS P Sbjct: 161 IGKELSSLGINVNFSPVLDVNNNPDNPVIGVRS-FSSKPE 199 >gi|319649065|ref|ZP_08003274.1| YbbD protein [Bacillus sp. BT1B_CT2] gi|317389059|gb|EFV69877.1| YbbD protein [Bacillus sp. BT1B_CT2] Length = 643 Score = 35.9 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPA 40 + K L + GINVNFSPVLD+ P+ + RS FS P Sbjct: 161 IGKELSSLGINVNFSPVLDVNNNPDNPVIGVRS-FSSKPE 199 >gi|295697245|ref|YP_003590483.1| glycoside hydrolase family 3 domain protein [Bacillus tusciae DSM 2912] gi|295412847|gb|ADG07339.1| glycoside hydrolase family 3 domain protein [Bacillus tusciae DSM 2912] Length = 391 Score = 35.9 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAE 43 MA+ L G N +F+PVLD+ P+ + F P A Sbjct: 146 MAEELRAFGFNTDFAPVLDINSNPDNPVIG-DRSFGSTPDAAS 187 >gi|239996479|ref|ZP_04717003.1| Beta-hexosaminidase A precursor [Alteromonas macleodii ATCC 27126] Length = 657 Score = 35.9 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 + + L+ GIN NF+P +D+ P+ + RS FS P + Q F Sbjct: 189 IGQTLLPLGINTNFAPSVDVNSEPKNPVINVRS-FSENPEQVAALGQTFVSA 239 >gi|307267306|ref|ZP_07548805.1| glycoside hydrolase family 3 domain protein [Thermoanaerobacter wiegelii Rt8.B1] gi|306917679|gb|EFN47954.1| glycoside hydrolase family 3 domain protein [Thermoanaerobacter wiegelii Rt8.B1] Length = 525 Score = 35.9 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K L GIN+NF+PVLD+ P + RS + P K E F YIK Sbjct: 118 KELRALGININFAPVLDVNNNPSNPVIGVRS-YGENPEKVAE----FGINYIK 165 >gi|229495828|ref|ZP_04389556.1| glycosyl hydrolase, family 3 [Porphyromonas endodontalis ATCC 35406] gi|229317402|gb|EEN83307.1| glycosyl hydrolase, family 3 [Porphyromonas endodontalis ATCC 35406] Length = 1001 Score = 35.5 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRS 33 MA+ T GI+VNF+PV+D+ P+ + RS Sbjct: 159 MAEQCKTVGIHVNFAPVVDVNNNPKNPVIGTRS 191 >gi|194334961|ref|YP_002016821.1| beta-N-acetylhexosaminidase [Prosthecochloris aestuarii DSM 271] gi|194312779|gb|ACF47174.1| Beta-N-acetylhexosaminidase [Prosthecochloris aestuarii DSM 271] Length = 375 Score = 35.1 bits (79), Expect = 3.1, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRT 52 A L + IN+NF+PV D+ P+ + + FS PA A + Sbjct: 149 AATLQSMHINLNFAPVADVNINPDNPVIGRLERSFSSDPAIVALHAAATVQA 200 >gi|124002449|ref|ZP_01687302.1| glycosyl hydrolase, family 3 [Microscilla marina ATCC 23134] gi|123992278|gb|EAY31646.1| glycosyl hydrolase, family 3 [Microscilla marina ATCC 23134] Length = 383 Score = 35.1 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ + G NVNF+PV DL P+ I K FS + A F+ + K+ Sbjct: 158 IAQKVKAMGFNVNFAPVTDLNVNPKAPIIGKLGRSFSGDVNTLVQHALKFTEVHQKH 214 >gi|226314290|ref|YP_002774186.1| beta-hexosaminidase [Brevibacillus brevis NBRC 100599] gi|226097240|dbj|BAH45682.1| probable beta-hexosaminidase [Brevibacillus brevis NBRC 100599] Length = 537 Score = 35.1 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAE 43 + L +GI+VNF+P +D+ P+ + RS F P + Sbjct: 119 EELRAAGISVNFAPTVDVNNNPDNPVIGVRS-FGEAPEQVA 158 >gi|145595898|ref|YP_001160195.1| glycoside hydrolase family 3 protein [Salinispora tropica CNB-440] gi|145305235|gb|ABP55817.1| glycoside hydrolase, family 3 domain protein [Salinispora tropica CNB-440] Length = 575 Score = 35.1 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Query: 5 LVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEE 44 L G+NV+F+PV D+L P T I + P+ E Sbjct: 211 LAAMGVNVDFAPVADVLVTPSTVIGS--RSYGADPSMVAE 248 >gi|110636892|ref|YP_677099.1| b-N-acetylglucosaminidase [Cytophaga hutchinsonii ATCC 33406] gi|110279573|gb|ABG57759.1| b-N-acetylglucosaminidase, glycoside hydrolase family 3 protein [Cytophaga hutchinsonii ATCC 33406] Length = 395 Score = 34.7 bits (78), Expect = 3.9, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTY 53 +AK L G N+N++P LDL P IA+ +S P + A + Sbjct: 169 LAKELKELGFNLNYAPCLDLATNPNNPIIAKVGRSYSADPDLVSKQAAASINAH 222 >gi|317484721|ref|ZP_07943622.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bilophila wadsworthia 3_1_6] gi|316924077|gb|EFV45262.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bilophila wadsworthia 3_1_6] Length = 379 Score = 34.7 bits (78), Expect = 4.5, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPA 40 M + L G+N+NF+PVLD+ P + I + FS P Sbjct: 156 MGRMLRELGVNLNFAPVLDVNVYPASPAIGRLGRSFSAAPQ 196 >gi|218885938|ref|YP_002435259.1| beta-N-acetylhexosaminidase [Desulfovibrio vulgaris str. 'Miyazaki F'] gi|218756892|gb|ACL07791.1| Beta-N-acetylhexosaminidase [Desulfovibrio vulgaris str. 'Miyazaki F'] Length = 586 Score = 34.7 bits (78), Expect = 4.5, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 18/26 (69%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET 26 M + L G+N+NF+PV+D+ P++ Sbjct: 316 MGRELADVGVNLNFAPVVDVDVNPDS 341 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.306 0.129 0.343 Lambda K H 0.267 0.0378 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 891,719,356 Number of Sequences: 14124377 Number of extensions: 22340112 Number of successful extensions: 52170 Number of sequences better than 10.0: 110 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 90 Number of HSP's that attempted gapping in prelim test: 52108 Number of HSP's gapped (non-prelim): 134 length of query: 58 length of database: 4,842,793,630 effective HSP length: 31 effective length of query: 27 effective length of database: 4,404,937,943 effective search space: 118933324461 effective search space used: 118933324461 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.0 bits) S2: 75 (33.6 bits)