BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781070|ref|YP_003065483.1| hypothetical protein CLIBASIA_04860 [Candidatus Liberibacter asiaticus str. psy62] (58 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|51891438|ref|YP_074129.1| putative beta-N-acetylglucosaminidase [Symbiobacterium thermophilum IAM 14863] gi|51855127|dbj|BAD39285.1| putative beta-N-acetylglucosaminidase [Symbiobacterium thermophilum IAM 14863] Length = 523 Score = 83.3 bits (205), Expect = 9e-15, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GIN+N +PVLD+ P + F PA+ E + R + Sbjct: 112 IARELRAMGINMNLAPVLDVNVNPANPVIGV-RSFGSDPARVAEHGAAYIRGHHD 165 >gi|20806762|ref|NP_621933.1| Beta-glucosidase-related glycosidase [Thermoanaerobacter tengcongensis MB4] gi|20515221|gb|AAM23537.1| Beta-glucosidase-related glycosidases [Thermoanaerobacter tengcongensis MB4] Length = 591 Score = 77.9 bits (191), Expect = 4e-13, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L GIN + +PV+D+ P + F P + F + +N Sbjct: 158 IGSELKAVGINWDLAPVMDVNVNPYNPVIGI-RSFGGNPDVVAKLGVAFMKGLQEN 212 >gi|320353673|ref|YP_004195012.1| glycoside hydrolase family 3 domain-containing protein [Desulfobulbus propionicus DSM 2032] gi|320122175|gb|ADW17721.1| glycoside hydrolase family 3 domain protein [Desulfobulbus propionicus DSM 2032] Length = 354 Score = 77.9 bits (191), Expect = 4e-13, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQ-KRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ L GIN+NF+PV+DL P+ I + F PA A++F + ++ Sbjct: 117 LAEELAACGINLNFAPVVDLDLNPDNPIIGRYQRSFGADPATVASHARVFVEAHHRH 173 >gi|254478115|ref|ZP_05091498.1| Glycosyl hydrolase family 3 N terminal domain protein [Carboxydibrachium pacificum DSM 12653] gi|214035977|gb|EEB76668.1| Glycosyl hydrolase family 3 N terminal domain protein [Carboxydibrachium pacificum DSM 12653] Length = 546 Score = 77.9 bits (191), Expect = 5e-13, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L GIN + +PV+D+ P + F P + F + +N Sbjct: 158 IGSELKAVGINWDLAPVMDVNVNPYNPVIGI-RSFGGNPDVVAKLGVAFMKGLQEN 212 >gi|153864860|ref|ZP_01997612.1| glycosyl hydrolase [Beggiatoa sp. SS] gi|152145645|gb|EDN72388.1| glycosyl hydrolase [Beggiatoa sp. SS] Length = 340 Score = 77.5 bits (190), Expect = 6e-13, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQ-KRSIFSRIPAKAEESAQLFSRTYIK 55 MAK L GIN+NF+PV+D+ P I K+ FS P + A F + + + Sbjct: 194 MAKTLAELGINLNFAPVVDVNTNPHNPIIAKKQRSFSPNPKIVAQHALEFIKAHRE 249 >gi|153872350|ref|ZP_02001271.1| conserved hypothetical protein [Beggiatoa sp. PS] gi|152071182|gb|EDN68727.1| conserved hypothetical protein [Beggiatoa sp. PS] Length = 403 Score = 76.7 bits (188), Expect = 1e-12, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIA-QKRSIFSRIPAKAEESAQLFSRTYIK 55 M L GIN+NF+PV+D+ P I K FS P + A + + + + Sbjct: 180 MGNTLKGLGINLNFAPVVDVNTNPNNPIIAGKERSFSSDPNLVAKHAIEYIKGHHQ 235 >gi|284122657|ref|ZP_06386871.1| beta-N-acetylglucosaminidase [Candidatus Poribacteria sp. WGA-A3] gi|283829339|gb|EFC33737.1| beta-N-acetylglucosaminidase [Candidatus Poribacteria sp. WGA-A3] Length = 354 Score = 76.4 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ L GIN+N +PVLD+ P+ I + P + + N Sbjct: 109 AQELRAVGINMNLAPVLDVNSNPDNPIIG-DRAYGTQPERVCTYGMAVMQGLEDN 162 >gi|138894951|ref|YP_001125404.1| beta-hexosamidase A [Geobacillus thermodenitrificans NG80-2] gi|134266464|gb|ABO66659.1| Beta-hexosamidase A precursor [Geobacillus thermodenitrificans NG80-2] Length = 697 Score = 76.4 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L GIN+N +PVLD+ P+ + F P + + + Sbjct: 265 IGEELYALGINMNLAPVLDVNNNPDNPVIGV-RSFGENPELVAQLGTAYMKGLQD 318 >gi|196248483|ref|ZP_03147184.1| glycoside hydrolase family 3 domain protein [Geobacillus sp. G11MC16] gi|196212208|gb|EDY06966.1| glycoside hydrolase family 3 domain protein [Geobacillus sp. G11MC16] Length = 697 Score = 76.4 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L GIN+N +PVLD+ P+ + F P + + + Sbjct: 265 IGEELYALGINMNLAPVLDVNNNPDNPVIGV-RSFGENPELVAQLGTAYMKGLQD 318 >gi|147678616|ref|YP_001212831.1| beta-glucosidase-related glycosidases and D-alanyl-D-alanine dipeptidase [Pelotomaculum thermopropionicum SI] gi|146274713|dbj|BAF60462.1| beta-glucosidase-related glycosidases and D-alanyl-D-alanine dipeptidase [Pelotomaculum thermopropionicum SI] Length = 1139 Score = 76.0 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L GINV+ +PV+D+ P+ + F P + + Sbjct: 679 IGEELNALGINVDLAPVVDVNINPDNPVIGI-RSFGSDPQLVADMGVAYINGLRD 732 >gi|261405918|ref|YP_003242159.1| glycoside hydrolase family 3 domain-containing protein [Paenibacillus sp. Y412MC10] gi|261282381|gb|ACX64352.1| glycoside hydrolase family 3 domain protein [Paenibacillus sp. Y412MC10] Length = 546 Score = 76.0 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L + G+N+NF+P LD+ P + F P E + Y + Sbjct: 120 ARELRSLGVNMNFAPCLDVNNNPRNPVIGV-RSFGEDPHAVAELGTAAIKGYQE 172 >gi|239826845|ref|YP_002949469.1| glycoside hydrolase [Geobacillus sp. WCH70] gi|239807138|gb|ACS24203.1| glycoside hydrolase family 3 domain protein [Geobacillus sp. WCH70] Length = 698 Score = 76.0 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L GIN+N +PVLD+ P+ + F P E + + Sbjct: 266 IGEELHALGINMNLAPVLDVNNNPDNPVIGV-RSFGENPELVAELGVSYIKGLQD 319 >gi|302035632|ref|YP_003795954.1| beta-N-acetylglucosaminidase [Candidatus Nitrospira defluvii] gi|300603696|emb|CBK40027.1| Beta-N-acetylglucosaminidase [Candidatus Nitrospira defluvii] Length = 383 Score = 75.6 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +AK L GIN+N +PVLD+ P+ + F P E N Sbjct: 108 IAKELRAVGINMNMAPVLDVNSNPDNPVIG-DRAFGAAPELVGEMGLATIGGLQDN 162 >gi|89095930|ref|ZP_01168824.1| beta-hexosamidase A precursor [Bacillus sp. NRRL B-14911] gi|89089676|gb|EAR68783.1| beta-hexosamidase A precursor [Bacillus sp. NRRL B-14911] Length = 694 Score = 75.2 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GIN NF+PV+D+ P+ + F P E +++ Sbjct: 261 IGEELAALGINTNFAPVMDVNNNPDNPVIGV-RSFGENPELVAEMGVAYTKGLQ 313 >gi|319652039|ref|ZP_08006160.1| beta-hexosamidase A [Bacillus sp. 2_A_57_CT2] gi|317396330|gb|EFV77047.1| beta-hexosamidase A [Bacillus sp. 2_A_57_CT2] Length = 707 Score = 75.2 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L + GIN+NF+PV+D+ P+ + F P + ++ Sbjct: 273 IGEELASLGINMNFAPVMDVNNNPDNPVIGV-RSFGEDPQLVADMGVAYTEGLQ 325 >gi|23100661|ref|NP_694128.1| beta-N-acetylhexosaminidase [Oceanobacillus iheyensis HTE831] gi|22778895|dbj|BAC15162.1| beta-N-acetylhexosaminidase (beta-hexosaminidase) [Oceanobacillus iheyensis HTE831] Length = 529 Score = 75.2 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L GIN N +PV+D+ P+ + + P + A+ + Sbjct: 112 GTELRALGINWNLAPVVDVNVNPDNPVIGV-RSYGESPERVARLAKAAVKGMQD 164 >gi|291565862|dbj|BAI88134.1| glycoside hydrolase, family 3 [Arthrospira platensis NIES-39] Length = 527 Score = 75.2 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A + G+N PV+D+ P+ + F P A F R K P Sbjct: 123 ASEALAIGLNWVLGPVVDVNNNPDNPVINV-RSFGDNPETVSNLATAFIRGCQKYP 177 >gi|284052770|ref|ZP_06382980.1| glycoside hydrolase family 3 domain protein [Arthrospira platensis str. Paraca] Length = 517 Score = 75.2 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A + G+N PV+D+ P+ + F P A F R K P Sbjct: 113 ASEALAIGLNWVLGPVVDVNNNPDNPVINV-RSFGDNPETVSNLATAFIRGCQKYP 167 >gi|196018043|ref|XP_002118719.1| hypothetical protein TRIADDRAFT_62735 [Trichoplax adhaerens] gi|190578387|gb|EDV18794.1| hypothetical protein TRIADDRAFT_62735 [Trichoplax adhaerens] Length = 224 Score = 75.2 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPE-TFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MAK L GIN NF+P +D+ P + I FS P ++ F + ++ Sbjct: 118 MAKILKNYGINFNFAPCVDVDTNPTCSVIGGYERSFSDNPETVIHYSKQFIDAHKEH 174 >gi|209525402|ref|ZP_03273942.1| glycoside hydrolase family 3 domain protein [Arthrospira maxima CS-328] gi|209494082|gb|EDZ94397.1| glycoside hydrolase family 3 domain protein [Arthrospira maxima CS-328] Length = 524 Score = 74.8 bits (183), Expect = 3e-12, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A + G+N PV+D+ P+ + F P A F R K P Sbjct: 123 ASEALAIGLNWVLGPVVDVNNNPDNPVINV-RSFGDNPETVSNLASAFIRGCQKYP 177 >gi|162452568|ref|YP_001614935.1| put. Beta-glucosidase [Sorangium cellulosum 'So ce 56'] gi|161163150|emb|CAN94455.1| put. Beta-glucosidase [Sorangium cellulosum 'So ce 56'] Length = 371 Score = 74.8 bits (183), Expect = 3e-12, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L GIN+NF+PVLD+ P I F R P A F + Sbjct: 114 ASELRAVGINLNFAPVLDVDSNPANPIIG-DRAFGRDPGAVARGAVAFLEGLQE 166 >gi|295402631|ref|ZP_06812577.1| glycoside hydrolase family 3 domain protein [Geobacillus thermoglucosidasius C56-YS93] gi|294975333|gb|EFG50965.1| glycoside hydrolase family 3 domain protein [Geobacillus thermoglucosidasius C56-YS93] Length = 698 Score = 74.8 bits (183), Expect = 4e-12, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L GIN+N +PVLD+ P+ + F P E + + Sbjct: 266 IGEELYALGINMNLAPVLDVNNNPDNPVIGV-RSFGENPELVAELGMSYIKGLQD 319 >gi|153872146|ref|ZP_02001121.1| glycosyl hydrolase, family 3 [Beggiatoa sp. PS] gi|152071386|gb|EDN68877.1| glycosyl hydrolase, family 3 [Beggiatoa sp. PS] Length = 436 Score = 74.8 bits (183), Expect = 4e-12, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYI 54 MAK L T GIN NF+PV+DL P + K FS P + A F + + Sbjct: 208 MAKTLATVGINFNFAPVVDLNINPNNPVIGKLERSFSAYPQTVTKHALEFIKAHH 262 >gi|312111401|ref|YP_003989717.1| glycoside hydrolase [Geobacillus sp. Y4.1MC1] gi|311216502|gb|ADP75106.1| glycoside hydrolase family 3 domain protein [Geobacillus sp. Y4.1MC1] Length = 698 Score = 74.4 bits (182), Expect = 4e-12, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L GIN+N +PVLD+ P+ + F P E + + Sbjct: 266 IGEELYALGINMNLAPVLDVNNNPDNPVIGV-RSFGENPELVAELGMSYIKGLQD 319 >gi|226355925|ref|YP_002785665.1| glycoside hydrolase [Deinococcus deserti VCD115] gi|226317915|gb|ACO45911.1| putative Glycosyl hydrolase, family 3 N terminal domain; putative Beta-N-acetylhexosaminidase [Deinococcus deserti VCD115] Length = 476 Score = 74.4 bits (182), Expect = 4e-12, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A+ L + GIN NF+PVLD+ P + + PA + + Sbjct: 95 LARQLRSVGINWNFAPVLDVNLNPGNPVIG-ERAYGADPALVARHGRAALEGH 146 >gi|289577462|ref|YP_003476089.1| glycoside hydrolase [Thermoanaerobacter italicus Ab9] gi|289527175|gb|ADD01527.1| glycoside hydrolase family 3 domain protein [Thermoanaerobacter italicus Ab9] Length = 525 Score = 73.7 bits (180), Expect = 7e-12, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K L GIN+NF+PVLD+ P + + P K E + + K Sbjct: 117 GKELRALGININFAPVLDVNNNPSNPVIGV-RSYGENPEKVAEFGINYIKGLQK 169 >gi|332977733|gb|EGK14496.1| glycosyl hydrolase domain protein [Desmospora sp. 8437] Length = 577 Score = 73.7 bits (180), Expect = 8e-12, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK L GI +N +PVLD+ P+ + + P E + Y KN Sbjct: 162 AKELRAVGIQMNLAPVLDVNVNPDNPVIGV-RSYGESPRLVSEMGAAAVKGYQKN 215 >gi|260459754|ref|ZP_05808008.1| Beta-N-acetylhexosaminidase [Mesorhizobium opportunistum WSM2075] gi|259034556|gb|EEW35813.1| Beta-N-acetylhexosaminidase [Mesorhizobium opportunistum WSM2075] Length = 437 Score = 73.7 bits (180), Expect = 8e-12, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIK 55 +A +L G N+NF PV DL P I K FS P + F R + Sbjct: 167 LATDLREWGFNLNFGPVADLNVNPANPIIGKLGRSFSANPEIVAQYGAAFVRAHRD 222 >gi|152992043|ref|YP_001357764.1| glycosy hydrolase family protein [Sulfurovum sp. NBC37-1] gi|151423904|dbj|BAF71407.1| glycosyl hydrolase, family 3 [Sulfurovum sp. NBC37-1] Length = 361 Score = 73.7 bits (180), Expect = 9e-12, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIA-QKRSIFSRIPAKAEESAQLFSRTYI 54 MAK L + GIN + +PV+DL P+ + F + P A F Sbjct: 140 MAKELKSVGINYDLAPVVDLDINPKNHVIHGLGRSFGKDPKTVAAYASTFIDAMH 194 >gi|329929619|ref|ZP_08283318.1| glycosyl hydrolase family 3 N-terminal domain protein [Paenibacillus sp. HGF5] gi|328935996|gb|EGG32450.1| glycosyl hydrolase family 3 N-terminal domain protein [Paenibacillus sp. HGF5] Length = 546 Score = 73.3 bits (179), Expect = 9e-12, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L + G+N+NF+P LD+ P + F P E + + Y + Sbjct: 120 ARELRSLGVNMNFAPCLDVNNNPRNPVIGV-RSFGEDPHAVAELGTVAIKGYQE 172 >gi|332361359|gb|EGJ39163.1| beta-hexosaminidase A [Streptococcus sanguinis SK1056] Length = 932 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARLGTAMMEGIQK 321 >gi|327459719|gb|EGF06059.1| beta-hexosaminidase A [Streptococcus sanguinis SK1057] Length = 932 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARLGTAMMEGIQK 321 >gi|332360780|gb|EGJ38587.1| beta-hexosaminidase A [Streptococcus sanguinis SK355] Length = 930 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARLGTAMMEGIQK 321 >gi|325687365|gb|EGD29386.1| family 3 glycoside hydrolase [Streptococcus sanguinis SK72] Length = 932 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARLGTAMMEGIQK 321 >gi|325689800|gb|EGD31804.1| family 3 glycoside hydrolase [Streptococcus sanguinis SK115] Length = 925 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARLGTAMMEGIQK 321 >gi|327474182|gb|EGF19592.1| putative glycoside hydrolase [Streptococcus sanguinis SK408] Length = 932 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARLGTAMMEGIQK 321 >gi|167045590|gb|ABZ10240.1| putative glycosyl hydrolase family 3 N terminal domain protein [uncultured marine crenarchaeote HF4000_APKG10I20] Length = 349 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M K L GIN++++PVLD+ PE I PAK R + Sbjct: 103 MGKELRAVGINMDYAPVLDVHSNPENPIIGL-RALDTDPAKVARLGAELIRGFYD 156 >gi|167044845|gb|ABZ09512.1| putative glycosyl hydrolase family 3 N terminal domain protein [uncultured marine crenarchaeote HF4000_APKG8D22] Length = 392 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M K L GIN++++PVLD+ PE I PAK R + Sbjct: 103 MGKELRAVGINMDYAPVLDVHSNPENPIIGL-RALDTDPAKVARLGAELIRGFYD 156 >gi|325694416|gb|EGD36326.1| beta-hexosaminidase A [Streptococcus sanguinis SK150] Length = 932 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARLGTAMMEGIQK 321 >gi|323351674|ref|ZP_08087328.1| family 3 glycoside hydrolase [Streptococcus sanguinis VMC66] gi|322122160|gb|EFX93886.1| family 3 glycoside hydrolase [Streptococcus sanguinis VMC66] Length = 932 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARLGTAMMEGIQK 321 >gi|324995679|gb|EGC27591.1| beta-hexosaminidase A [Streptococcus sanguinis SK678] Length = 932 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARLGTAMMEGIQK 321 >gi|332366661|gb|EGJ44404.1| family 3 glycoside hydrolase [Streptococcus sanguinis SK1059] Length = 932 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARLGTAMMEGIQK 321 >gi|324991256|gb|EGC23190.1| family 3 glycoside hydrolase [Streptococcus sanguinis SK353] Length = 932 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARLGTAMMEGIQK 321 >gi|297622431|ref|YP_003703865.1| glycoside hydrolase family 3 domain-containing protein [Truepera radiovictrix DSM 17093] gi|297163611|gb|ADI13322.1| glycoside hydrolase family 3 domain protein [Truepera radiovictrix DSM 17093] Length = 507 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+NVNF+PV D+ + P + F P F + + Sbjct: 102 ARGLRAVGVNVNFAPVADVNHNPRNPVI-AERAFGGDPEAVARHVAAFVAGHQE 154 >gi|167461151|ref|ZP_02326240.1| Beta-glucosidase-related glycosidase [Paenibacillus larvae subsp. larvae BRL-230010] gi|322384898|ref|ZP_08058554.1| beta-hexosaminidase-like protein [Paenibacillus larvae subsp. larvae B-3650] gi|321150195|gb|EFX43702.1| beta-hexosaminidase-like protein [Paenibacillus larvae subsp. larvae B-3650] Length = 536 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L GIN+NF+P LD+ P+ + + + + Y Sbjct: 118 AEELRAIGINMNFAPCLDVNNNPDNPVIGV-RSYGETAELVSKLGVEAMKGYQD 170 >gi|332360729|gb|EGJ38538.1| family 3 glycoside hydrolase [Streptococcus sanguinis SK49] Length = 932 Score = 72.9 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARLGTAMMEGIQK 321 >gi|332701405|ref|ZP_08421493.1| Beta-N-acetylhexosaminidase [Desulfovibrio africanus str. Walvis Bay] gi|332551554|gb|EGJ48598.1| Beta-N-acetylhexosaminidase [Desulfovibrio africanus str. Walvis Bay] Length = 381 Score = 72.9 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYI 54 + + L G N++F+PV+D+ P + + FS P + A F R Sbjct: 153 LGRELAACGFNLDFAPVVDVNVNPGNPVIGRLGRSFSADPTAVADHAAAFVRGLH 207 >gi|324993012|gb|EGC24932.1| beta-hexosaminidase A [Streptococcus sanguinis SK405] gi|327462308|gb|EGF08635.1| beta-hexosaminidase A [Streptococcus sanguinis SK1] Length = 932 Score = 72.9 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARMGTAMMEGIQK 321 >gi|298529404|ref|ZP_07016807.1| glycoside hydrolase family 3 domain protein [Desulfonatronospira thiodismutans ASO3-1] gi|298510840|gb|EFI34743.1| glycoside hydrolase family 3 domain protein [Desulfonatronospira thiodismutans ASO3-1] Length = 372 Score = 72.9 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIK 55 A L GIN+N +PV+D+ P+ + + FS P K A + + Sbjct: 150 AVTLKDMGINLNLAPVVDVNVNPDNPVIGRLERSFSSDPEKVAVHAAEVIKAHRD 204 >gi|125717896|ref|YP_001035029.1| Beta-hexosamidase A [Streptococcus sanguinis SK36] gi|125497813|gb|ABN44479.1| Beta-hexosamidase A, putative [Streptococcus sanguinis SK36] Length = 930 Score = 72.9 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 266 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARLGTAMMEGIQK 319 >gi|327470145|gb|EGF15609.1| beta-hexosaminidase A [Streptococcus sanguinis SK330] Length = 932 Score = 72.9 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARLGTAMMEGIQK 321 >gi|288556579|ref|YP_003428514.1| cell wall regulatory beta-N-acetylglucosaminidase [Bacillus pseudofirmus OF4] gi|288547739|gb|ADC51622.1| cell wall regulatory beta-N-acetylglucosaminidase [Bacillus pseudofirmus OF4] Length = 699 Score = 72.9 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L + GIN+NF+PV+D+ P+ + F P + ++ Sbjct: 265 IGSELHSLGINMNFAPVMDVNNNPDNPVIGV-RSFGEDPKLVADMGVAYTHGLQ 317 >gi|325696399|gb|EGD38289.1| family 3 glycoside hydrolase [Streptococcus sanguinis SK160] Length = 932 Score = 72.9 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARMGTAMMEGIQK 321 >gi|328946173|gb|EGG40318.1| family 3 glycoside hydrolase [Streptococcus sanguinis SK1087] Length = 932 Score = 72.9 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARLGTAMMEGVQK 321 >gi|124004451|ref|ZP_01689296.1| beta-N-acetylglucosaminidase [Microscilla marina ATCC 23134] gi|123990023|gb|EAY29537.1| beta-N-acetylglucosaminidase [Microscilla marina ATCC 23134] Length = 994 Score = 72.9 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ + G ++NF+PV+D+ P+ + FS + + N Sbjct: 159 IAQQMKRLGTHINFAPVVDVNINPKNPVIG-YRSFSENRETVARKGVAYMKGLQDN 213 >gi|193213964|ref|YP_001995163.1| beta-N-acetylhexosaminidase [Chloroherpeton thalassium ATCC 35110] gi|193087441|gb|ACF12716.1| Beta-N-acetylhexosaminidase [Chloroherpeton thalassium ATCC 35110] Length = 384 Score = 72.5 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIK 55 AK L GIN+NF+PVLD+ PE + K FS P E + + + Sbjct: 160 AKTLAALGINLNFAPVLDVNTNPENPVIGKLARSFSENPEIVAEHGLATVKAFHQ 214 >gi|327489661|gb|EGF21453.1| beta-hexosaminidase A [Streptococcus sanguinis SK1058] Length = 932 Score = 72.5 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NVNF+PV D P+ + FS P K Sbjct: 268 IGRELSALGLNVNFAPVFDTNNNPQNPVIGL-RSFSSDPKVVARMGTAMMEGIQK 321 >gi|323490781|ref|ZP_08095983.1| glycoside hydrolase family 3 domain protein [Planococcus donghaensis MPA1U2] gi|323395663|gb|EGA88507.1| glycoside hydrolase family 3 domain protein [Planococcus donghaensis MPA1U2] Length = 701 Score = 72.5 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L GIN+NF+P D+ P+ + F P E +++ + Sbjct: 269 IGEELSALGINMNFAPSFDINNNPDNPVIGV-RSFGEKPELVAELGVAYTKGLQQ 322 >gi|322370628|ref|ZP_08045184.1| glycoside hydrolase family 3 domain protein [Haladaptatus paucihalophilus DX253] gi|320549586|gb|EFW91244.1| glycoside hydrolase family 3 domain protein [Haladaptatus paucihalophilus DX253] Length = 410 Score = 72.5 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G++++ +PVLD+ P+ + F P + E F+ Sbjct: 138 GSELRALGVDIDLAPVLDVNNNPDNPVIGV-RSFGERPERVAELGAAFADGLQD 190 >gi|255036468|ref|YP_003087089.1| beta-lactamase [Dyadobacter fermentans DSM 18053] gi|254949224|gb|ACT93924.1| beta-lactamase [Dyadobacter fermentans DSM 18053] Length = 992 Score = 72.5 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +AK G+++NF+PV D+ P+ + F K E A + R N Sbjct: 162 LAKQARRLGMHINFAPVADVNNNPDNPVISF-RSFGENKYKVAEKAVAYMRGMQDN 216 >gi|307267306|ref|ZP_07548805.1| glycoside hydrolase family 3 domain protein [Thermoanaerobacter wiegelii Rt8.B1] gi|306917679|gb|EFN47954.1| glycoside hydrolase family 3 domain protein [Thermoanaerobacter wiegelii Rt8.B1] Length = 525 Score = 72.5 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K L GIN+NF+PVLD+ P + + P K E + + K Sbjct: 117 GKELRALGININFAPVLDVNNNPSNPVIGV-RSYGENPEKVAEFGINYIKGVQK 169 >gi|154416837|ref|XP_001581440.1| glycosyl hydrolase [Trichomonas vaginalis G3] gi|121915667|gb|EAY20454.1| Glycosyl hydrolase family 3 N terminal domain containing protein [Trichomonas vaginalis G3] Length = 553 Score = 72.1 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L +G+N+N +P D+ P+ I F P + + + + + Sbjct: 158 MATELRAAGVNMNHAPTSDVNSNPKNPIIG-DRSFGDNPENVSKFVDYYIQGHHE 211 >gi|109900460|ref|YP_663715.1| glycoside hydrolase family protein [Pseudoalteromonas atlantica T6c] gi|109702741|gb|ABG42661.1| glycoside hydrolase, family 3-like protein [Pseudoalteromonas atlantica T6c] Length = 633 Score = 72.1 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +AK L G NVNF+P +D+ PE + F P E + +N Sbjct: 161 IAKELAVLGFNVNFAPSVDVNVNPENPVINV-RSFGEDPQVVAELGLAQMQAMQQN 215 >gi|255037953|ref|YP_003088574.1| glycoside hydrolase family 3 domain-containing protein [Dyadobacter fermentans DSM 18053] gi|254950709|gb|ACT95409.1| glycoside hydrolase family 3 domain protein [Dyadobacter fermentans DSM 18053] Length = 1018 Score = 72.1 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ GI++NF+PV D+ P + F + + + N Sbjct: 182 IARQCKRLGIHINFAPVSDVNSNPANPVIGI-RSFGEDKENVARKSIAYMKGLQHN 236 >gi|149919407|ref|ZP_01907888.1| hypothetical protein PPSIR1_27268 [Plesiocystis pacifica SIR-1] gi|149819713|gb|EDM79138.1| hypothetical protein PPSIR1_27268 [Plesiocystis pacifica SIR-1] Length = 279 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L+ G +++F+PV+D+ P+ + F+R PA F R Sbjct: 108 LALELLDCGFDLDFAPVVDVDSNPDNPVIG-DRSFARDPATVGAHGAAFIRAMQ 160 >gi|218246069|ref|YP_002371440.1| glycoside hydrolase family 3 domain-containing protein [Cyanothece sp. PCC 8801] gi|257059119|ref|YP_003137007.1| glycoside hydrolase family 3 domain protein [Cyanothece sp. PCC 8802] gi|218166547|gb|ACK65284.1| glycoside hydrolase family 3 domain protein [Cyanothece sp. PCC 8801] gi|256589285|gb|ACV00172.1| glycoside hydrolase family 3 domain protein [Cyanothece sp. PCC 8802] Length = 534 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 +A+ + GIN +PV+D+ P+ + FS P E A F P Sbjct: 126 IAQEALAVGINWVLAPVVDVNNNPKNPVINI-RSFSDDPKIVSELAVAFLEGAKTYP 181 >gi|313677398|ref|YP_004055394.1| glycoside hydrolase family 3 domain protein [Marivirga tractuosa DSM 4126] gi|312944096|gb|ADR23286.1| glycoside hydrolase family 3 domain protein [Marivirga tractuosa DSM 4126] Length = 983 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ G++VNF+PV+D+ + + F E + + N Sbjct: 143 IARQAKLIGVHVNFAPVVDVNNNIKNPVIG-NRSFGEDKVNVAEKGVAYMKGMQDN 197 >gi|313902088|ref|ZP_07835500.1| beta-N-acetylhexosaminidase [Thermaerobacter subterraneus DSM 13965] gi|313467650|gb|EFR63152.1| beta-N-acetylhexosaminidase [Thermaerobacter subterraneus DSM 13965] Length = 537 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L GIN+N +PVLD+ P + F P + Y Sbjct: 127 ARELRALGINMNLAPVLDVNVNPSNPVIGV-RSFGEDPELVADLGVAQVLGYQD 179 >gi|223984203|ref|ZP_03634351.1| hypothetical protein HOLDEFILI_01644 [Holdemania filiformis DSM 12042] gi|223963818|gb|EEF68182.1| hypothetical protein HOLDEFILI_01644 [Holdemania filiformis DSM 12042] Length = 571 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L G N+NF+PVLD+ P+ + +S P A + + + Sbjct: 158 MADELSGMGFNMNFAPVLDVNSNPDNPVIHL-RSYSDDPKAVASFASTWIKGLQE 211 >gi|13488104|ref|NP_085717.1| glycosy hydrolase family protein [Mesorhizobium loti MAFF303099] gi|14027966|dbj|BAB54558.1| glycosyl hyrolase, family 3 [Mesorhizobium loti MAFF303099] Length = 394 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYI 54 +A +L + G N+N +PV+DL P I K FS P K E A+ F + Sbjct: 156 LASDLSSLGFNLNLAPVVDLNVNPANPIIGKLGRSFSADPQKVEAYARAFIEAHR 210 >gi|332974899|gb|EGK11812.1| glycosyl hydrolase domain protein [Desmospora sp. 8437] Length = 587 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G N+N +PVLD+ P+ + FS P + E A + Y Sbjct: 171 GSELRAMGFNMNMAPVLDVNNNPKNPVIGT-RSFSGDPHQVVEMASAQIQGYHD 223 >gi|189502741|ref|YP_001958458.1| hypothetical protein Aasi_1439 [Candidatus Amoebophilus asiaticus 5a2] gi|189498182|gb|ACE06729.1| hypothetical protein Aasi_1439 [Candidatus Amoebophilus asiaticus 5a2] Length = 1007 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ L GI+VNF+PV+D+ P+ F + + N Sbjct: 145 IARQLKLLGIHVNFAPVIDINNNPDNPGIG-NRAFGDGKGSVISKGLAYIQGLQDN 199 >gi|297543766|ref|YP_003676068.1| glycoside hydrolase family 3 domain-containing protein [Thermoanaerobacter mathranii subsp. mathranii str. A3] gi|296841541|gb|ADH60057.1| glycoside hydrolase family 3 domain protein [Thermoanaerobacter mathranii subsp. mathranii str. A3] Length = 526 Score = 71.3 bits (174), Expect = 5e-11, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L T GIN+NF+PV+D+ P + + P + + K Sbjct: 118 GRELRTIGININFAPVMDVNNNPLNPVIGV-RSYGENPEDVANFGINYIKGLQK 170 >gi|108803474|ref|YP_643411.1| glycosyl hydrolase [Rubrobacter xylanophilus DSM 9941] gi|108764717|gb|ABG03599.1| beta-N-acetylhexosaminidase. Glycosyl Hydrolase family 3 [Rubrobacter xylanophilus DSM 9941] Length = 604 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN NF+PV D+ P + F P Y + Sbjct: 174 GEELRAIGINQNFAPVADVNVNPRNPVIGV-RSFGEDPRLVARLTAAQVEGYQE 226 >gi|326389333|ref|ZP_08210901.1| Beta-N-acetylhexosaminidase [Thermoanaerobacter ethanolicus JW 200] gi|325994696|gb|EGD53120.1| Beta-N-acetylhexosaminidase [Thermoanaerobacter ethanolicus JW 200] Length = 532 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K L GIN+NF+PVLD+ P + + K E + + K Sbjct: 124 GKELRALGININFAPVLDVNNNPSNPVIGV-RSYGENLEKVAEFGVNYIKGLQK 176 >gi|20806741|ref|NP_621912.1| Beta-glucosidase-related glycosidase [Thermoanaerobacter tengcongensis MB4] gi|254478116|ref|ZP_05091499.1| Glycosyl hydrolase family 3 N terminal domain protein [Carboxydibrachium pacificum DSM 12653] gi|20515198|gb|AAM23516.1| Beta-glucosidase-related glycosidases [Thermoanaerobacter tengcongensis MB4] gi|33286394|gb|AAQ01678.1| beta-glucosidase [Caldanaerobacter subterraneus subsp. tengcongensis] gi|214035978|gb|EEB76669.1| Glycosyl hydrolase family 3 N terminal domain protein [Carboxydibrachium pacificum DSM 12653] Length = 526 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L T GIN+NF+PV+D+ P + + P + + K Sbjct: 118 GRELRTIGININFAPVMDVNNNPLNPVIGV-RSYGENPEDVANFGINYIKGLQK 170 >gi|254411786|ref|ZP_05025562.1| Glycosyl hydrolase family 3 N terminal domain protein [Microcoleus chthonoplastes PCC 7420] gi|196181508|gb|EDX76496.1| Glycosyl hydrolase family 3 N terminal domain protein [Microcoleus chthonoplastes PCC 7420] Length = 548 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A+ + GIN +PV+D+ P+ + FS P + A F R +P Sbjct: 131 AQEALAIGINWILAPVVDVNNNPQNPVINV-RAFSDTPETVSQLACQFIRGTQDSP 185 >gi|172057360|ref|YP_001813820.1| glycoside hydrolase family 3 protein [Exiguobacterium sibiricum 255-15] gi|171989881|gb|ACB60803.1| glycoside hydrolase family 3 domain protein [Exiguobacterium sibiricum 255-15] Length = 646 Score = 71.0 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GINVNF PVLD+ P + FS P E ++ + Sbjct: 163 IGSELHALGINVNFGPVLDVNNNPGNPVIGV-RSFSSDPNLVGELGSAMTQGIQE 216 >gi|302669326|ref|YP_003832476.1| beta-N-acetylhexosaminidase Bhx3C [Butyrivibrio proteoclasticus B316] gi|302396990|gb|ADL35894.1| beta-N-acetylhexosaminidase Bhx3C [Butyrivibrio proteoclasticus B316] Length = 666 Score = 71.0 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + L G N +F+P +D+ P + FS P + + +++ +N Sbjct: 165 LGEELAALGFNADFAPDIDVNNNPSNPVIGT-RSFSDDPDLVSKLGKAYAKGLSEN 219 >gi|198276096|ref|ZP_03208627.1| hypothetical protein BACPLE_02283 [Bacteroides plebeius DSM 17135] gi|198270908|gb|EDY95178.1| hypothetical protein BACPLE_02283 [Bacteroides plebeius DSM 17135] Length = 989 Score = 70.6 bits (172), Expect = 6e-11, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ G+ +NF+PV D+ P + F P + E + + N Sbjct: 153 ARQCRLIGVQINFAPVADVDNNPNNPVINF-RSFGGDPKRVAEKVAAYVKGLEDN 206 >gi|172039586|ref|YP_001806087.1| beta-glucosidase [Cyanothece sp. ATCC 51142] gi|171701040|gb|ACB54021.1| beta-glucosidase [Cyanothece sp. ATCC 51142] Length = 539 Score = 70.6 bits (172), Expect = 6e-11, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 AK V GIN SP++D+ P+ + F P E A+ F +P Sbjct: 132 AKESVKIGINWILSPIVDVNNNPDNPVINI-RSFGDNPKVVSELAKAFIEGAKNHP 186 >gi|229917128|ref|YP_002885774.1| beta-N-acetylhexosaminidase [Exiguobacterium sp. AT1b] gi|229468557|gb|ACQ70329.1| Beta-N-acetylhexosaminidase [Exiguobacterium sp. AT1b] Length = 649 Score = 70.6 bits (172), Expect = 6e-11, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+NVNF PVLD+ P + FS P E ++ Sbjct: 166 IGSELHALGVNVNFGPVLDVNNNPGNPVIGV-RSFSSDPELVGELGSAMTQGIQD 219 >gi|307150649|ref|YP_003886033.1| glycoside hydrolase family 3 domain-containing protein [Cyanothece sp. PCC 7822] gi|306980877|gb|ADN12758.1| glycoside hydrolase family 3 domain protein [Cyanothece sp. PCC 7822] Length = 533 Score = 70.6 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A GIN +PV+D+ P + F P + + A F P Sbjct: 128 AAQAHEIGINWILAPVVDVNNNPHNPVINV-RSFGDQPEQVSKLATAFIEGTQNYP 182 >gi|193213634|ref|YP_001999587.1| glycoside hydrolase family 3 domain-containing protein [Chlorobaculum parvum NCIB 8327] gi|193087111|gb|ACF12387.1| glycoside hydrolase family 3 domain protein [Chlorobaculum parvum NCIB 8327] Length = 373 Score = 70.6 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIK 55 AK L + GIN+N +PV+DL PE + K FS PA A++F T+ + Sbjct: 146 AKLLKSLGINMNLAPVVDLNVNPENPVIGKLDRSFSSNPAVVARQARIFVDTFHQ 200 >gi|311748625|ref|ZP_07722410.1| glycosyl hydrolase, family 3 [Algoriphagus sp. PR1] gi|126577150|gb|EAZ81398.1| glycosyl hydrolase, family 3 [Algoriphagus sp. PR1] Length = 984 Score = 70.2 bits (171), Expect = 8e-11, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA+ G+++NF+PV+D+ P+ + F + A + + + Sbjct: 157 MARQFKELGMHINFAPVVDVNSNPDNPVIG-YRAFGENKKLVAQRAVSYMKGLQDH 211 >gi|167038852|ref|YP_001661837.1| glycoside hydrolase family 3 protein [Thermoanaerobacter sp. X514] gi|166853092|gb|ABY91501.1| glycoside hydrolase, family 3 domain protein [Thermoanaerobacter sp. X514] Length = 520 Score = 70.2 bits (171), Expect = 8e-11, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K L GIN+NF+PVLD+ + + P K E + + K Sbjct: 112 GKELRALGININFAPVLDINNNLSNPVIGV-RSYGENPEKVAEFGINYIKGLQK 164 >gi|300913563|ref|ZP_07130880.1| Beta-N-acetylhexosaminidase [Thermoanaerobacter sp. X561] gi|307723422|ref|YP_003903173.1| beta-N-acetylhexosaminidase [Thermoanaerobacter sp. X513] gi|300890248|gb|EFK85393.1| Beta-N-acetylhexosaminidase [Thermoanaerobacter sp. X561] gi|307580483|gb|ADN53882.1| Beta-N-acetylhexosaminidase [Thermoanaerobacter sp. X513] Length = 525 Score = 70.2 bits (171), Expect = 8e-11, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K L GIN+NF+PVLD+ + + P K E + + K Sbjct: 117 GKELRALGININFAPVLDINNNLSNPVIGV-RSYGENPEKVAEFGINYIKGLQK 169 >gi|217978397|ref|YP_002362544.1| glycoside hydrolase family 3 domain protein [Methylocella silvestris BL2] gi|217503773|gb|ACK51182.1| glycoside hydrolase family 3 domain protein [Methylocella silvestris BL2] Length = 365 Score = 70.2 bits (171), Expect = 8e-11, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M + L + G+N+NF+PVLD+ P + F P + +A F R K Sbjct: 113 MGRELASLGVNLNFAPVLDIHTNPANPVIG-ERAFGSTPDEVIAAALPFMRAMQK 166 >gi|38327416|gb|AAR17736.1| putative hydrolase [Bdellovibrio bacteriovorus] Length = 369 Score = 70.2 bits (171), Expect = 8e-11, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M + GIN++F+P +D+ P + S P + A R YIK Sbjct: 112 MGLEMKAVGINLDFAPCVDIFTNPGNTVIG-DRSISSDPEMVAKHASALVRGYIK 165 >gi|42521783|ref|NP_967163.1| hypothetical protein Bd0146 [Bdellovibrio bacteriovorus HD100] gi|39574313|emb|CAE77817.1| bglX2 [Bdellovibrio bacteriovorus HD100] Length = 370 Score = 70.2 bits (171), Expect = 8e-11, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M + GIN++F+P +D+ P + S P + A R YIK Sbjct: 112 MGLEMKAVGINLDFAPCVDIFTNPGNTVIG-DRSISSDPEMVAKHASALVRGYIK 165 >gi|288573939|ref|ZP_06392296.1| glycoside hydrolase family 3 domain protein [Dethiosulfovibrio peptidovorans DSM 11002] gi|288569680|gb|EFC91237.1| glycoside hydrolase family 3 domain protein [Dethiosulfovibrio peptidovorans DSM 11002] Length = 550 Score = 70.2 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 M + L + GI+++++PV+D+ P I F A + + Sbjct: 143 MGRQLKSLGIDLDYAPVVDVNSNPSNPIIGV-RSFGDDVATVSSMGASMIKGF 194 >gi|242278563|ref|YP_002990692.1| glycoside hydrolase family 3 domain protein [Desulfovibrio salexigens DSM 2638] gi|242121457|gb|ACS79153.1| glycoside hydrolase family 3 domain protein [Desulfovibrio salexigens DSM 2638] Length = 373 Score = 70.2 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIA-QKRSIFSRIPAKAEESAQLFSRTYI 54 + K+L +GIN+NF+PV+D+ + + FS P A + Sbjct: 147 IGKSLKEAGINMNFAPVVDVNRNAANPVIAALQRSFSDDPRIVARFADSYIDGLH 201 >gi|162447148|ref|YP_001620280.1| glycoside hydrolase family 3 protein [Acholeplasma laidlawii PG-8A] gi|161985255|gb|ABX80904.1| glycoside hydrolase, family 3 [Acholeplasma laidlawii PG-8A] Length = 523 Score = 70.2 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 M K L+ GIN++ +PVLD+ P+ + FS P K R + Sbjct: 119 MGKELIDLGINMDLAPVLDVNNNPKNPVIGV-RSFSDDPDKVALFGNANIRGLQNH 173 >gi|15613238|ref|NP_241541.1| beta-hexosamidase A precursor [Bacillus halodurans C-125] gi|10173289|dbj|BAB04394.1| beta-hexosamidase A precursor [Bacillus halodurans C-125] Length = 686 Score = 69.8 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L + GIN+N +PVLD+ P+ + FS P + +++ Sbjct: 250 IGRELQSLGINMNLAPVLDVNNNPDNPVIGV-RSFSENPELVGQLGVAYTKGLQ 302 >gi|188993873|ref|YP_001928125.1| glycosyl hydrolase family 3 [Porphyromonas gingivalis ATCC 33277] gi|188593553|dbj|BAG32528.1| glycosyl hydrolase family 3 [Porphyromonas gingivalis ATCC 33277] Length = 1003 Score = 69.8 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ GI++NF+PVLD+ P+ + F P + E +++ Sbjct: 169 ARQCRLMGIHINFAPVLDVNNNPKNPVIGT-RSFGDNPRRVAERGIAYAQGLED 221 >gi|34539891|ref|NP_904370.1| glycosyl hydrolase family protein [Porphyromonas gingivalis W83] gi|34396202|gb|AAQ65269.1| glycosyl hydrolase, family 3 [Porphyromonas gingivalis W83] Length = 1003 Score = 69.8 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ GI++NF+PVLD+ P+ + F P + E +++ Sbjct: 169 ARQCRLMGIHINFAPVLDVNNNPKNPVIGT-RSFGDNPRRVAERGIAYAQGLED 221 >gi|297157371|gb|ADI07083.1| putative sugar hydrolase [Streptomyces bingchenggensis BCW-1] Length = 524 Score = 69.8 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M + L G+N++++P D+ P+ + F P + R Sbjct: 114 MGRRLAACGVNLDWAPSADVNSNPDNPVIGV-RAFGADPQLVARHTAAYIRGLQ 166 >gi|86609778|ref|YP_478540.1| glycosyl hydrolase domain-containing protein [Synechococcus sp. JA-2-3B'a(2-13)] gi|86558320|gb|ABD03277.1| glycosyl hydrolase domain protein [Synechococcus sp. JA-2-3B'a(2-13)] Length = 511 Score = 69.8 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L + G N+NF+PV+D+ P I F P + + R Y + Sbjct: 115 GTELKSLGFNLNFAPVVDVNSNPHNPIIGI-RAFGSDPKQVTDYGLALWRGYRQ 167 >gi|253575841|ref|ZP_04853176.1| glycoside hydrolase [Paenibacillus sp. oral taxon 786 str. D14] gi|251844884|gb|EES72897.1| glycoside hydrolase [Paenibacillus sp. oral taxon 786 str. D14] Length = 544 Score = 69.4 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ GIN NF+P +D+ P + F P + R Y Sbjct: 118 AKEMLQLGINFNFAPCVDVNNNPANPVIGV-RSFGEQPDRVAVHGAAAVRGYQ 169 >gi|296813051|ref|XP_002846863.1| glycosyl hyrolase [Arthroderma otae CBS 113480] gi|238842119|gb|EEQ31781.1| glycosyl hyrolase [Arthroderma otae CBS 113480] Length = 983 Score = 69.4 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L P + F + Y Sbjct: 127 AQELRAVGVNWILGPVLDVLTNGRNQPLGV-RSIGDDPQEVAAYGVEFMKGYQD 179 >gi|307298841|ref|ZP_07578643.1| glycoside hydrolase family 3 domain protein [Thermotogales bacterium mesG1.Ag.4.2] gi|306915266|gb|EFN45651.1| glycoside hydrolase family 3 domain protein [Thermotogales bacterium mesG1.Ag.4.2] Length = 512 Score = 69.4 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G+N N +PV+D+ P+ F P + A+ F Sbjct: 107 LAREMNAIGVNWNLAPVVDINCNPKNPGIGV-RSFGDSPDQVIAYARAFVEGMK 159 >gi|261886066|ref|ZP_06010105.1| glycosy hydrolase family protein [Campylobacter fetus subsp. venerealis str. Azul-94] Length = 354 Score = 69.4 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 30/55 (54%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L GIN+NF+PV+D+ + I QK FS+ P + + F +++ K Sbjct: 135 MADQLKNLGINMNFAPVVDVYNPNSSIIGQKNRAFSKNPDEVIAYSSEFIKSFDK 189 >gi|163846686|ref|YP_001634730.1| glycoside hydrolase family 3 protein [Chloroflexus aurantiacus J-10-fl] gi|222524491|ref|YP_002568962.1| glycoside hydrolase family 3 domain-containing protein [Chloroflexus sp. Y-400-fl] gi|163667975|gb|ABY34341.1| glycoside hydrolase family 3 domain protein [Chloroflexus aurantiacus J-10-fl] gi|222448370|gb|ACM52636.1| glycoside hydrolase family 3 domain protein [Chloroflexus sp. Y-400-fl] Length = 515 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L G+N+ ++PV D+ P+ + F P A ++ Sbjct: 108 IGAELAALGVNLVYAPVCDVNTNPQNPVIGI-RAFGDDPKIVGVLAAAMIAGLQQH 162 >gi|15806351|ref|NP_295057.1| glycosyl hydrolase family protein [Deinococcus radiodurans R1] gi|6459083|gb|AAF10903.1|AE001979_9 glycosyl hyrolase, family 3 [Deinococcus radiodurans R1] Length = 348 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A+ L + GIN NF+PVLD+ P + + A+ + + Sbjct: 114 LARQLRSVGINWNFTPVLDINVNPANPVIG-DRAYGSDAARVTRHGRAALAGH 165 >gi|46580644|ref|YP_011452.1| glycosy hydrolase family protein [Desulfovibrio vulgaris str. Hildenborough] gi|120602051|ref|YP_966451.1| glycoside hydrolase family 3 protein [Desulfovibrio vulgaris DP4] gi|46450063|gb|AAS96712.1| glycosyl hydrolase, family 3 [Desulfovibrio vulgaris str. Hildenborough] gi|120562280|gb|ABM28024.1| glycoside hydrolase, family 3 domain protein [Desulfovibrio vulgaris DP4] gi|311234375|gb|ADP87229.1| glycoside hydrolase family 3 domain protein [Desulfovibrio vulgaris RCH1] Length = 481 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIA-QKRSIFSRIPAKAEESAQLFSRTY 53 +A + G+NV+F PV+DL P + + + P + A F Sbjct: 172 LATEMAEVGLNVDFGPVVDLAVNPSNPVIARLERSYGSDPCRVASHAAAFVNGL 225 >gi|319649065|ref|ZP_08003274.1| YbbD protein [Bacillus sp. BT1B_CT2] gi|317389059|gb|EFV69877.1| YbbD protein [Bacillus sp. BT1B_CT2] Length = 643 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L + GINVNFSPVLD+ P+ + FS P + + Sbjct: 161 IGKELSSLGINVNFSPVLDVNNNPDNPVIGV-RSFSSKPELTSKLGIQMMKGLQD 214 >gi|52078658|ref|YP_077449.1| glycoside hydrolase family protein [Bacillus licheniformis ATCC 14580] gi|52784020|ref|YP_089849.1| YbbD [Bacillus licheniformis ATCC 14580] gi|52001869|gb|AAU21811.1| Glycoside hydrolase, family 3 [Bacillus licheniformis ATCC 14580] gi|52346522|gb|AAU39156.1| YbbD [Bacillus licheniformis ATCC 14580] Length = 643 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L + GINVNFSPVLD+ P+ + FS P + + Sbjct: 161 IGKELSSLGINVNFSPVLDVNNNPDNPVIGV-RSFSSKPELTSKLGIQMMKGLQD 214 >gi|118474059|ref|YP_891951.1| glycosy hydrolase family protein [Campylobacter fetus subsp. fetus 82-40] gi|118413285|gb|ABK81705.1| glycosyl hyrolase, family 3 [Campylobacter fetus subsp. fetus 82-40] Length = 354 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 30/55 (54%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L GIN+NF+PV+D+ + I QK FS+ P + + F +++ K Sbjct: 135 MADQLKNLGINMNFAPVVDVYNPNSSIIGQKNRAFSKNPDEVIAYSSEFIKSFDK 189 >gi|312131255|ref|YP_003998595.1| glycoside hydrolase family 3 domain protein [Leadbetterella byssophila DSM 17132] gi|311907801|gb|ADQ18242.1| glycoside hydrolase family 3 domain protein [Leadbetterella byssophila DSM 17132] Length = 968 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ G++ NFSPV D+ P+ + F P E F R + K Sbjct: 144 IARQCKRIGVHFNFSPVGDINSNPKNPVIN-YRSFGESPLNVSELTSAFVRGHRK 197 >gi|119486755|ref|ZP_01620730.1| beta-glucosidase [Lyngbya sp. PCC 8106] gi|119456048|gb|EAW37181.1| beta-glucosidase [Lyngbya sp. PCC 8106] Length = 535 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A G+N +PV+D+ P+ + F PA A F R P Sbjct: 124 ALEAQAIGLNWILAPVVDVNNNPDNPVINV-RSFGETPATVSRLASAFIRGCQSYP 178 >gi|169350876|ref|ZP_02867814.1| hypothetical protein CLOSPI_01650 [Clostridium spiroforme DSM 1552] gi|169292462|gb|EDS74595.1| hypothetical protein CLOSPI_01650 [Clostridium spiroforme DSM 1552] Length = 904 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + L GINVNF+P D P + S P E + K+ Sbjct: 164 IGRELNELGINVNFAPSFDTNNNPNNPVIGL-RSISSDPNLVAELGVPMMKGMQKH 218 >gi|332308382|ref|YP_004436233.1| glycoside hydrolase family 3 domain protein [Glaciecola agarilytica 4H-3-7+YE-5] gi|332175711|gb|AEE24965.1| glycoside hydrolase family 3 domain protein [Glaciecola agarilytica 4H-3-7+YE-5] Length = 633 Score = 68.7 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +AK L G NVNF+P +D+ PE + F P + + N Sbjct: 161 IAKELAVLGFNVNFAPSVDVNVNPENPVINV-RSFGEDPHVVSQLGFAQMQAMQNN 215 >gi|108759339|ref|YP_634739.1| glycosy hydrolase family protein [Myxococcus xanthus DK 1622] gi|108463219|gb|ABF88404.1| glycosyl hyrolase, family 3 [Myxococcus xanthus DK 1622] Length = 369 Score = 68.7 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L G + +F+PVLD+ P + FSR + +R Sbjct: 111 LAYELRALGFDWDFAPVLDVDTNPANPVIG-DRSFSREAEEVARLGVALARGL 162 >gi|21224364|ref|NP_630143.1| hydrolase [Streptomyces coelicolor A3(2)] gi|3169046|emb|CAA19244.1| putative hydrolase [Streptomyces coelicolor A3(2)] Length = 506 Score = 68.7 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L +G++++++P D+ P+ I F P + R Sbjct: 113 LGRQLRAAGVSLDYAPSADVNSNPDNPIIGV-RSFGSDPEVVARHTTAWIRGLQ 165 >gi|77361987|ref|YP_341561.1| beta-hexosaminidase A [Pseudoalteromonas haloplanktis TAC125] gi|76876898|emb|CAI89115.1| Beta-hexosaminidase A precursor (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) (Chitobiase) [Pseudoalteromonas haloplanktis TAC125] Length = 599 Score = 68.7 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L GINVN++P +D+ P+ + F P + + N Sbjct: 141 MATELSALGINVNYAPSIDVNMNPDNPVINV-RSFGEDPKRVATLGAAQVAGFENN 195 >gi|332798269|ref|YP_004459768.1| beta-N-acetylhexosaminidase [Tepidanaerobacter sp. Re1] gi|332696004|gb|AEE90461.1| Beta-N-acetylhexosaminidase [Tepidanaerobacter sp. Re1] Length = 411 Score = 68.7 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + L + G N+NF+PVLD+ P + FS + + N Sbjct: 161 IGEELKSLGFNMNFAPVLDIDSNPANPVIG-DRSFSSNEQTVSKLGTATMKGIQTN 215 >gi|301168391|emb|CBW27981.1| beta-hexosaminidase [Bacteriovorax marinus SJ] Length = 369 Score = 68.7 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MAK L G+N+N +PV D++ + + F + + R Sbjct: 116 MAKELKACGVNLNLAPVCDIVNNEQNKVIG-DRAFGKDAETVSKYISSVIRGLQ 168 >gi|332706080|ref|ZP_08426152.1| beta-glucosidase-related protein [Lyngbya majuscula 3L] gi|332355172|gb|EGJ34640.1| beta-glucosidase-related protein [Lyngbya majuscula 3L] Length = 586 Score = 68.7 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 11/51 (21%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 A + GIN +PV+D+ + + F P + A F Sbjct: 135 ATEALAIGINWILAPVVDVNNNSQNPVINV-RSFGDNPQIVSQLASAFIEG 184 >gi|291294819|ref|YP_003506217.1| glycoside hydrolase family 3 domain-containing protein [Meiothermus ruber DSM 1279] gi|290469778|gb|ADD27197.1| glycoside hydrolase family 3 domain protein [Meiothermus ruber DSM 1279] Length = 511 Score = 68.7 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L++ GIN NF+P +D+ P+ + F P K + ++R + Sbjct: 107 GRALISLGINWNFAPSVDVNTNPQNPVIG-DRSFGSDPKKVARLSLAWARGLEQ 159 >gi|254491750|ref|ZP_05104929.1| Glycosyl hydrolase family 3 N terminal domain protein [Methylophaga thiooxidans DMS010] gi|224463228|gb|EEF79498.1| Glycosyl hydrolase family 3 N terminal domain protein [Methylophaga thiooxydans DMS010] Length = 349 Score = 68.7 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L GI+ +F+PVLDL YG I F R P + A+ + K Sbjct: 108 MAAELRAVGIDFSFAPVLDLNYGVSQVIG--DRAFHRDPKAVTDIARAYIHGMKK 160 >gi|119963236|ref|YP_949743.1| beta-N-acetylglucosaminidase [Arthrobacter aurescens TC1] gi|119950095|gb|ABM09006.1| putative beta-N-Acetylglucosaminidase [Arthrobacter aurescens TC1] Length = 681 Score = 68.3 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + GINV+F+PVLDL P+ + PA + Sbjct: 185 LGSEMRAMGINVDFAPVLDLNSNPDNPVIGI-RSMGEDPALVSALGVAQIEGIQAH 239 >gi|21672931|ref|NP_660996.1| glycosy hydrolase family protein [Chlorobium tepidum TLS] gi|21645987|gb|AAM71338.1| glycosyl hydrolase, family 3 [Chlorobium tepidum TLS] Length = 372 Score = 68.3 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIK 55 A L + GINVN +PV+DL P + K FS P + A++ + + Sbjct: 146 AALLKSLGINVNLAPVVDLNVNPSNPVIGKLDRSFSADPVVVAQQARMVIDAFHQ 200 >gi|228470514|ref|ZP_04055381.1| beta-hexosaminidase [Porphyromonas uenonis 60-3] gi|228307810|gb|EEK16766.1| beta-hexosaminidase [Porphyromonas uenonis 60-3] Length = 436 Score = 68.3 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA+ GI+V+F+PVLD+ P+ + P +R Sbjct: 181 MAEQCRVMGIHVSFAPVLDVNNNPKNPVIGT-RSLGATPDIVISHGLALARGLED 234 >gi|189423786|ref|YP_001950963.1| glycoside hydrolase [Geobacter lovleyi SZ] gi|189420045|gb|ACD94443.1| glycoside hydrolase family 3 domain protein [Geobacter lovleyi SZ] Length = 395 Score = 68.3 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQ-KRSIFSRIPAKAEESAQLFSRTYIKN 56 +A L G N+N +PV+DL P+ + K FS PA A F +++ ++ Sbjct: 166 LAATLDEYGFNLNLAPVVDLATNPDNPVIAFKERSFSADPALVAAHAAEFIKSHHRH 222 >gi|148800320|gb|ABR12885.1| Orf31 [Mesorhizobium sp. CJ1] Length = 393 Score = 68.3 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYI 54 +A L G N+N +PV+DL P I K FS P E A++F + Sbjct: 155 LASALSDLGFNLNLAPVVDLNVNPANPIIGKLGRSFSADPQTVETYAKVFIEAHR 209 >gi|258592217|emb|CBE68526.1| Putative beta-N-acetylglucosaminidase (fragment) [NC10 bacterium 'Dutch sediment'] Length = 354 Score = 68.3 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A+ L+ GIN+N +PVLD+L P + + P + F R Sbjct: 107 IARELMAVGINMNMAPVLDVLTNPANPV-MAGRSYGSDPHMVAQHGIAFFRGL 158 >gi|239982214|ref|ZP_04704738.1| putative sugar hydrolase [Streptomyces albus J1074] gi|291454061|ref|ZP_06593451.1| sugar hydrolase [Streptomyces albus J1074] gi|291357010|gb|EFE83912.1| sugar hydrolase [Streptomyces albus J1074] Length = 497 Score = 68.3 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ L G+++N++P D+ P+ + F P + Sbjct: 116 LARRLADCGVHLNWAPSADVNSDPDNPVIGV-RSFGSDPDLVARHTAAYVEGMQ 168 >gi|297154180|gb|ADI03892.1| hydrolase [Streptomyces bingchenggensis BCW-1] Length = 503 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L +GI++NF+P +D+ P+ I F A + + Sbjct: 113 LGRQLRGAGISLNFAPTVDVNSNPDNPIIGV-RSFGADAKTVSRHAAAWIKGLQ 165 >gi|332520295|ref|ZP_08396757.1| Beta-N-acetylhexosaminidase [Lacinutrix algicola 5H-3-7-4] gi|332043648|gb|EGI79843.1| Beta-N-acetylhexosaminidase [Lacinutrix algicola 5H-3-7-4] Length = 987 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ G++ NF+PV+D+ P I F A F + Sbjct: 150 LGEHCKRLGVHFNFAPVVDINTNPNNPIIG-NRSFGEDRDNVTNKAAAFMKGMQ 202 >gi|301167675|emb|CBW27258.1| putative sugar hydrolase [Bacteriovorax marinus SJ] Length = 405 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIK 55 +A++L + GIN+NF+P D+ P+ + K +S P K + F +++ Sbjct: 137 LAQDLESVGINLNFAPSADVNTNPDNPVIGKIERSYSSDPLKVSNNVAAFIKSHHD 192 >gi|23098754|ref|NP_692220.1| beta-N-acetylglucosaminidase [Oceanobacillus iheyensis HTE831] gi|22776981|dbj|BAC13255.1| beta-N-acetylglucosaminidase [Oceanobacillus iheyensis HTE831] Length = 668 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L GIN+NF+P +D+ P + F P + Y Sbjct: 169 LGKELDALGINMNFAPTVDVNLNPANPVIGV-RSFGEDPDMVSQLGAAQITAYED 222 >gi|282891400|ref|ZP_06299899.1| hypothetical protein pah_c161o006 [Parachlamydia acanthamoebae str. Hall's coccus] gi|281498685|gb|EFB41005.1| hypothetical protein pah_c161o006 [Parachlamydia acanthamoebae str. Hall's coccus] Length = 544 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L + GINVN +PV+D+ + I F P + + K Sbjct: 145 ELKSVGINVNLAPVVDVNCNEKNPIIGI-RAFGSSPKDVASLGKEMMEGFRK 195 >gi|299536575|ref|ZP_07049887.1| lipoprotein ybbD precursor [Lysinibacillus fusiformis ZC1] gi|298728059|gb|EFI68622.1| lipoprotein ybbD precursor [Lysinibacillus fusiformis ZC1] Length = 562 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + L G N++F+PVLD+ P I FS PA + + Sbjct: 316 LGEQLRAFGFNLDFAPVLDVNSNPNNPIIG-DRSFSNDPAIVSQLGIQTMKGL 367 >gi|256784449|ref|ZP_05522880.1| hydrolase [Streptomyces lividans TK24] gi|289768328|ref|ZP_06527706.1| hydrolase [Streptomyces lividans TK24] gi|289698527|gb|EFD65956.1| hydrolase [Streptomyces lividans TK24] Length = 265 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L +G++++++P D+ P+ I F P + R Sbjct: 113 LGRQLRAAGVSLDYAPSADVNSNPDNPIIGV-RSFGSDPEVVARHTTAWIRGLQ 165 >gi|260062566|ref|YP_003195646.1| beta-N-acetylglucosaminidase [Robiginitalea biformata HTCC2501] gi|88784133|gb|EAR15303.1| beta-N-acetylglucosaminidase [Robiginitalea biformata HTCC2501] Length = 971 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ G+++NF+PV D+ P I F PA+ A + Sbjct: 149 IGQHAARLGVHINFAPVADINTNPANPIIG-NRSFGEDPARVARQAGYLMQGMH 201 >gi|298208772|ref|YP_003716951.1| putative hydrolase/beta lactamase fusion protein [Croceibacter atlanticus HTCC2559] gi|83848699|gb|EAP86568.1| putative hydrolase/beta lactamase fusion protein [Croceibacter atlanticus HTCC2559] Length = 971 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ G+++NF PV+D+ P I F E A F Sbjct: 149 IGQHVKRIGMHMNFGPVVDINTNPNNPIIG-NRSFGEDKVNVTEKAIAFMNGMH 201 >gi|37519986|ref|NP_923363.1| sugar hydrolase [Gloeobacter violaceus PCC 7421] gi|35210978|dbj|BAC88358.1| gll0417 [Gloeobacter violaceus PCC 7421] Length = 511 Score = 67.5 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ + GIN +P LD++ P + F P + F+ Sbjct: 125 AREARSVGINWVLAPCLDVMSNPRNPVIGL-RSFGEDPREVARLGVAFAAGLRD 177 >gi|304407997|ref|ZP_07389647.1| Beta-N-acetylhexosaminidase [Paenibacillus curdlanolyticus YK9] gi|304343016|gb|EFM08860.1| Beta-N-acetylhexosaminidase [Paenibacillus curdlanolyticus YK9] Length = 533 Score = 67.5 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L+ GINVNF+P LD+ P+ + +S P + Y + Sbjct: 121 GEELLKLGINVNFAPCLDVNNNPDNPVINV-RSYSDHPDVVGRLGVAAVQGYTE 173 >gi|307609946|emb|CBW99474.1| hypothetical protein LPW_12471 [Legionella pneumophila 130b] Length = 378 Score = 67.5 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQ-KRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I K FS IP + AQL++ +IK+ Sbjct: 152 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKH 208 >gi|149372824|ref|ZP_01891845.1| b-glycosidase, glycoside hydrolase family 3 protein [unidentified eubacterium SCB49] gi|149354521|gb|EDM43086.1| b-glycosidase, glycoside hydrolase family 3 protein [unidentified eubacterium SCB49] Length = 975 Score = 67.5 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+++NF+PV+D+ P+ I F E A F + Sbjct: 150 IGTHTKRMGMHINFAPVVDINTNPKNPIIG-NRSFGEDKENVSEKATAFMKGMQ 202 >gi|52841424|ref|YP_095223.1| glycosy hydrolase family protein [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|52628535|gb|AAU27276.1| glycosyl hydrolase family 3 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] Length = 395 Score = 67.5 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQ-KRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I K FS IP + AQL++ +IK+ Sbjct: 169 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKH 225 >gi|54297148|ref|YP_123517.1| hypothetical protein lpp1193 [Legionella pneumophila str. Paris] gi|53750933|emb|CAH12344.1| hypothetical protein lpp1193 [Legionella pneumophila str. Paris] Length = 382 Score = 67.5 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQ-KRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I K FS IP + AQL++ +IK+ Sbjct: 156 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKH 212 >gi|254517782|ref|ZP_05129838.1| beta-hexosamidase A [Clostridium sp. 7_2_43FAA] gi|226911531|gb|EEH96732.1| beta-hexosamidase A [Clostridium sp. 7_2_43FAA] Length = 862 Score = 67.5 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + L + GINVNF+P +D+ P + FS P + + +N Sbjct: 168 IGRELNSLGINVNFAPSVDINNNPLNPVIGL-RSFSSNPDLVAKLGVKMIKGIQEN 222 >gi|148358777|ref|YP_001249984.1| glycosyl hydrolase family transporter 3 [Legionella pneumophila str. Corby] gi|148280550|gb|ABQ54638.1| glycosyl hydrolase family 3 [Legionella pneumophila str. Corby] Length = 382 Score = 67.5 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQ-KRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I K FS IP + AQL++ +IK+ Sbjct: 156 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKH 212 >gi|150024851|ref|YP_001295677.1| beta-N-acetylglucosaminidase precursor [Flavobacterium psychrophilum JIP02/86] gi|149771392|emb|CAL42861.1| Probable beta-N-acetylglucosaminidase precursor [Flavobacterium psychrophilum JIP02/86] Length = 1001 Score = 67.5 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M K GI NF+PV+D+ P I F + + A + + Sbjct: 179 MGKETKRMGIQFNFAPVIDINTNPNNPIIG-NRSFGENKEEVTKRAVALMKGFQN 232 >gi|253575593|ref|ZP_04852929.1| glycoside hydrolase [Paenibacillus sp. oral taxon 786 str. D14] gi|251844931|gb|EES72943.1| glycoside hydrolase [Paenibacillus sp. oral taxon 786 str. D14] Length = 426 Score = 67.5 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+N++F+PVLD+ P+ + F P + + Sbjct: 180 IGQELAGFGLNLDFAPVLDVNSNPDNPVIG-DRAFGTKPEIVSRMGIAVMKGIRE 233 >gi|296106822|ref|YP_003618522.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] gi|295648723|gb|ADG24570.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] Length = 378 Score = 67.5 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQ-KRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I K FS IP + AQL++ +IK+ Sbjct: 152 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKH 208 >gi|94985183|ref|YP_604547.1| Beta-N-acetylhexosaminidase [Deinococcus geothermalis DSM 11300] gi|94555464|gb|ABF45378.1| Beta-N-acetylhexosaminidase [Deinococcus geothermalis DSM 11300] Length = 478 Score = 67.5 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A+ L + G+N NF+PVLD+ P + + + + Sbjct: 95 LARQLRSVGVNWNFAPVLDVNVNPANPVIG-ERAYGADVDRVIRHGTAALLGH 146 >gi|239928361|ref|ZP_04685314.1| sugar hydrolase [Streptomyces ghanaensis ATCC 14672] gi|291436688|ref|ZP_06576078.1| sugar hydrolase [Streptomyces ghanaensis ATCC 14672] gi|291339583|gb|EFE66539.1| sugar hydrolase [Streptomyces ghanaensis ATCC 14672] Length = 496 Score = 67.5 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+N+N++P D+ P+ + F P + Sbjct: 114 LGRRLAACGVNLNWAPSADVNANPDNPVIGV-RSFGGDPHLVARHTAAYVEGLQ 166 >gi|288541503|gb|ADC45575.1| hydrolase [Streptomyces nanchangensis] Length = 503 Score = 67.5 bits (164), Expect = 7e-10, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L +GI++NF+P +D+ P+ I F A + R Sbjct: 113 LGRQLRGAGISLNFAPTVDVNSNPDNPIIGV-RSFGADATTVSRHAAAWIRGLQ 165 >gi|302685077|ref|XP_003032219.1| glycoside hydrolase family 3 protein [Schizophyllum commune H4-8] gi|300105912|gb|EFI97316.1| glycoside hydrolase family 3 protein [Schizophyllum commune H4-8] Length = 390 Score = 67.1 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A+ L GI F PV D+ P + F PA + + + Y Sbjct: 120 IAQELKYVGIQWAFGPVADVNSDPRNPVIGV-RSFGDDPATVSKYVRAMTDAY 171 >gi|300865259|ref|ZP_07110073.1| Beta-glucosidase [Oscillatoria sp. PCC 6506] gi|300336732|emb|CBN55223.1| Beta-glucosidase [Oscillatoria sp. PCC 6506] Length = 568 Score = 67.1 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A + G+N +PV+D+ P+ + F+ P A F K P Sbjct: 126 ATEAIAIGLNWVLAPVVDVNNNPDNPVINV-RAFAETPDLVSRLATAFIHGAQKYP 180 >gi|31747863|gb|AAN10188.1| putative glycosylhydrolase [Candidatus Fritschea bemisiae] Length = 389 Score = 67.1 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + GI++NF+PV+D+ P + F P K A L + Sbjct: 129 IGRQCRIVGIHLNFAPVVDINNHPNNTVIG-NRSFGSDPEKVSRCASLIIQGMR 181 >gi|226314290|ref|YP_002774186.1| beta-hexosaminidase [Brevibacillus brevis NBRC 100599] gi|226097240|dbj|BAH45682.1| probable beta-hexosaminidase [Brevibacillus brevis NBRC 100599] Length = 537 Score = 67.1 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L +GI+VNF+P +D+ P+ + F P + + + + Sbjct: 118 GEELRAAGISVNFAPTVDVNNNPDNPVIGV-RSFGEAPEQVARFGEAAIQGLL 169 >gi|110636892|ref|YP_677099.1| b-N-acetylglucosaminidase [Cytophaga hutchinsonii ATCC 33406] gi|110279573|gb|ABG57759.1| b-N-acetylglucosaminidase, glycoside hydrolase family 3 protein [Cytophaga hutchinsonii ATCC 33406] Length = 395 Score = 67.1 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYI 54 +AK L G N+N++P LDL P I K +S P + A + Sbjct: 169 LAKELKELGFNLNYAPCLDLATNPNNPIIAKVGRSYSADPDLVSKQAAASINAHH 223 >gi|271962972|ref|YP_003337168.1| beta-hexosamidase A precursor [Streptosporangium roseum DSM 43021] gi|270506147|gb|ACZ84425.1| beta-hexosamidase A precursor [Streptosporangium roseum DSM 43021] Length = 427 Score = 67.1 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L GIN++F+PV D+ P + + P K + + Sbjct: 177 GTELRALGINLDFAPVADVNINPRNPVIGP-RAYGSDPKKVAPMVAAAVQGFHD 229 >gi|269839623|ref|YP_003324315.1| glycoside hydrolase [Thermobaculum terrenum ATCC BAA-798] gi|269791353|gb|ACZ43493.1| glycoside hydrolase family 3 domain protein [Thermobaculum terrenum ATCC BAA-798] Length = 543 Score = 67.1 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+N+N +PV D+ P + F P + Y + Sbjct: 117 GRELRALGVNMNLAPVADVNNNPANPVIGV-RSFGEDPQAVGDMVAAAVEGYAE 169 >gi|258404301|ref|YP_003197043.1| glycoside hydrolase family 3 domain-containing protein [Desulfohalobium retbaense DSM 5692] gi|257796528|gb|ACV67465.1| glycoside hydrolase family 3 domain protein [Desulfohalobium retbaense DSM 5692] Length = 379 Score = 67.1 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETF-IAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G +N +PV+DL P+ I + F P A F Sbjct: 150 IGQRLRNLGCTINLAPVVDLNTNPDNPAIGKLERSFGANPDTVTRQAAAFIHGLHD 205 >gi|157364542|ref|YP_001471309.1| glycoside hydrolase family 3 protein [Thermotoga lettingae TMO] gi|157315146|gb|ABV34245.1| glycoside hydrolase family 3 domain protein [Thermotoga lettingae TMO] Length = 502 Score = 67.1 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A + + GI N +PVLD+ P F P K + A+ F + + Sbjct: 107 LALEMKSLGITWNLAPVLDINDNPNNPGIGV-RSFGDTPQKVIKFAKAFYKGLSE 160 >gi|317130448|ref|YP_004096730.1| glycoside hydrolase [Bacillus cellulosilyticus DSM 2522] gi|315475396|gb|ADU31999.1| glycoside hydrolase family 3 domain protein [Bacillus cellulosilyticus DSM 2522] Length = 384 Score = 67.1 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G N+NF+PVLD+ P+ + F P E Sbjct: 139 IGRELSALGFNMNFAPVLDIYSNPDNEVIG-DRAFGDNPKIVSELGISTMEGLAD 192 >gi|282861033|ref|ZP_06270098.1| glycoside hydrolase family 3 domain protein [Streptomyces sp. ACTE] gi|282563691|gb|EFB69228.1| glycoside hydrolase family 3 domain protein [Streptomyces sp. ACTE] Length = 507 Score = 67.1 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+N+N++P D+ P + F P + + Sbjct: 114 LGRRLAECGVNLNWAPSADVNSNPGNPVIGV-RSFGADPDLVARHTAAYVQGLQ 166 >gi|302387922|ref|YP_003823744.1| Beta-N-acetylhexosaminidase [Clostridium saccharolyticum WM1] gi|302198550|gb|ADL06121.1| Beta-N-acetylhexosaminidase [Clostridium saccharolyticum WM1] Length = 518 Score = 67.1 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN N +PVLD+ P + F E + Y+ Sbjct: 123 GQELRELGINFNLAPVLDINNNPHNPVIGV-RSFGPDSTVVTEYGCEMVKGYLD 175 >gi|170076710|ref|YP_001733348.1| glycosy hydrolase family protein [Synechococcus sp. PCC 7002] gi|169884379|gb|ACA98092.1| glycosyl hydrolase family 3 [Synechococcus sp. PCC 7002] Length = 532 Score = 67.1 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ ++ GIN +PVLD+ P + F P + F R + Sbjct: 132 AQEALSLGINWVLAPVLDVNNNPHNPVINI-RAFGETPDQVSALGTAFIRGAQQ 184 >gi|332290721|ref|YP_004429330.1| Beta-N-acetylhexosaminidase [Krokinobacter diaphorus 4H-3-7-5] gi|332168807|gb|AEE18062.1| Beta-N-acetylhexosaminidase [Krokinobacter diaphorus 4H-3-7-5] Length = 973 Score = 67.1 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + ++ G+++NF+PV+D+ P I F E A F + Sbjct: 151 IGEHSKRLGVHINFAPVVDININPANPIIG-NRSFGEDKINVTEKAIAFMEGMQE 204 >gi|291336355|gb|ADD95913.1| glycosy hydrolase family protein [uncultured organism MedDCM-OCT-S01-C81] Length = 367 Score = 67.1 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ + G +VNFSPV+D+ P+ + F + + F R + Sbjct: 113 LAREIRAIGFDVNFSPVVDVNTNPDNPVIGS-RSFGAVADLVGTHGRAFYRGLHE 166 >gi|313679304|ref|YP_004057043.1| glycoside hydrolase family 3 domain protein [Oceanithermus profundus DSM 14977] gi|313152019|gb|ADR35870.1| glycoside hydrolase family 3 domain protein [Oceanithermus profundus DSM 14977] Length = 519 Score = 67.1 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + + G NV+ +PVLD+ P I F P F+R + Sbjct: 115 IGQEVAYLGANVDLAPVLDVNVNPRNPIIGL-RSFGADPEAVIRHGLAFARGLEE 168 >gi|123480157|ref|XP_001323233.1| glycosyl hydrolase [Trichomonas vaginalis G3] gi|121906094|gb|EAY11010.1| Glycosyl hydrolase family 3 N terminal domain containing protein [Trichomonas vaginalis G3] Length = 474 Score = 67.1 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L GIN+NF+PV D+ I F P + Q + + + K Sbjct: 74 ALELNDVGINLNFAPVSDVNSNIHNPIVG-DRSFGDNPNVVSKYVQNYIKGHKK 126 >gi|90021435|ref|YP_527262.1| glycosyl hydrolase [Saccharophagus degradans 2-40] gi|30911093|tpg|DAA01340.1| TPA_exp: putative N-acetyl-glucosaminidase [Saccharophagus degradans 2-40] gi|89951035|gb|ABD81050.1| beta-N-acetylhexosaminidase. Glycosyl Hydrolase family 3 [Saccharophagus degradans 2-40] Length = 344 Score = 67.1 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L I+++F+PVLD+ + I FS P A F + Sbjct: 113 MASELRAYDIDISFAPVLDVDDSFSSIIG--DRAFSSDPKAVTALAGAFIDGMQQ 165 >gi|22298587|ref|NP_681834.1| putative hydrolase [Thermosynechococcus elongatus BP-1] gi|22294767|dbj|BAC08596.1| tll1043 [Thermosynechococcus elongatus BP-1] Length = 519 Score = 67.1 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A + G+N +PV+D+ P + F P A F P Sbjct: 131 AAEALAIGLNWVLAPVVDVNNNPANPVINV-RAFGEEPDIVSALATAFIEGARTYP 185 >gi|260063455|ref|YP_003196535.1| glycosyl hydrolase family 3 protein [Robiginitalea biformata HTCC2501] gi|88782899|gb|EAR14073.1| glycosyl hydrolase, family 3 [Robiginitalea biformata HTCC2501] Length = 534 Score = 67.1 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + +GI+ N +PV D+ P + F P A LF R Sbjct: 139 MAADCRDAGIHWNLAPVADVNCNPGNPVIG-YRAFGTTPEGVARRASLFYRGLKD 192 >gi|221110039|ref|XP_002170884.1| PREDICTED: hypothetical protein, partial [Hydra magnipapillata] Length = 863 Score = 67.1 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA GI+ F PV+D+ P+ I F E A + R Sbjct: 411 MADQSKRLGIHFTFGPVVDINTNPKNPIIG-NRSFGETKENVAEKAVAYMRGLQ 463 >gi|323436149|ref|ZP_01050888.2| beta-hexosaminidase [Dokdonia donghaensis MED134] gi|321496464|gb|EAQ38395.2| beta-hexosaminidase [Dokdonia donghaensis MED134] Length = 973 Score = 67.1 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + ++ G+++NF+PV+D+ P I F E A F + Sbjct: 151 IGEHSKRLGVHINFAPVVDININPANPIIG-NRSFGEDKINVTEKAIAFMEGMQE 204 >gi|271963593|ref|YP_003337789.1| beta-glucosidase [Streptosporangium roseum DSM 43021] gi|270506768|gb|ACZ85046.1| Beta-glucosidase-related glycosidase-like protein [Streptosporangium roseum DSM 43021] Length = 503 Score = 66.7 bits (162), Expect = 9e-10, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++L +G+N++F+P D+ P+ + F P + R Sbjct: 110 LGRDLAAAGVNLDFAPSADVNSNPDNPVIGL-RSFGADPDLVSRHTAAWVRGMQ 162 >gi|120435988|ref|YP_861674.1| family 3 glycosyl hydrolase/beta-lactamase fusion protein [Gramella forsetii KT0803] gi|117578138|emb|CAL66607.1| family 3 glycosyl hydrolase/beta-lactamase fusion protein [Gramella forsetii KT0803] Length = 978 Score = 66.7 bits (162), Expect = 9e-10, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 ++++ G++ NF+PV+D+ P+ I F E A F Sbjct: 156 ISRHTKRLGVHFNFAPVVDINTNPDNPIIG-NRSFGEDKINVTEKALAFMNGMH 208 >gi|226288599|gb|EEH44111.1| beta-hexosaminidase [Paracoccidioides brasiliensis Pb18] Length = 911 Score = 66.7 bits (162), Expect = 9e-10, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L GIN PVLD L P + F + Y Sbjct: 103 AEELSAVGINWILGPVLDALTNARNQPLGV-RSVGDDPQEVSAYGIEFIKGYQD 155 >gi|225681464|gb|EEH19748.1| beta-hexosaminidase [Paracoccidioides brasiliensis Pb03] Length = 888 Score = 66.7 bits (162), Expect = 9e-10, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L GIN PVLD L P + F + Y Sbjct: 80 AEELSAVGINWILGPVLDALTNARNQPLGV-RSVGDDPQEVSAYGIEFIKGYQD 132 >gi|91214844|ref|ZP_01251817.1| putative hydrolase/beta lactamase fusion protein [Psychroflexus torquis ATCC 700755] gi|91187271|gb|EAS73641.1| putative hydrolase/beta lactamase fusion protein [Psychroflexus torquis ATCC 700755] Length = 971 Score = 66.7 bits (162), Expect = 9e-10, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K+ G+++NF+PV D+ P I F + + + Sbjct: 151 IGKHSKRLGVHINFAPVADINTNPNNPIIG-NRSFGETKDIVISHSLALMQGMHE 204 >gi|119470704|ref|ZP_01613372.1| Beta-hexosaminidase A precursor [Alteromonadales bacterium TW-7] gi|119446174|gb|EAW27452.1| Beta-hexosaminidase A precursor [Alteromonadales bacterium TW-7] Length = 603 Score = 66.7 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A L GINVN++P +D+ P+ + F P + E + N Sbjct: 141 IANELTALGINVNYAPTIDVNMNPDNPVINV-RSFGENPQRVSELGAAQVAGFESN 195 >gi|320450158|ref|YP_004202254.1| beta-N-acetylglucosaminidase [Thermus scotoductus SA-01] gi|320150327|gb|ADW21705.1| beta-N-acetylglucosaminidase [Thermus scotoductus SA-01] Length = 503 Score = 66.7 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 + + G +VN +PVLD+ P+ I F P + F+R Sbjct: 111 LGCQVRRLGADVNLAPVLDVNTNPDNPIIGL-RSFGADPERVARMGLAFARG 161 >gi|110636440|ref|YP_676647.1| b-glucosidase [Cytophaga hutchinsonii ATCC 33406] gi|110279121|gb|ABG57307.1| b-glycosidase, glycoside hydrolase family 3 protein [Cytophaga hutchinsonii ATCC 33406] Length = 990 Score = 66.7 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K G+++NF+PV+D+ + F + A + + Sbjct: 153 IGKQCKRLGVHINFAPVVDVNSNANNPVIGV-RSFGEDKINVSQKAIAYMKGMQ 205 >gi|89256591|ref|YP_513953.1| Beta-glucosidase-related glycosidase [Francisella tularensis subsp. holarctica LVS] gi|115315020|ref|YP_763743.1| beta-N-acetylhexosaminidase [Francisella tularensis subsp. holarctica OSU18] gi|134301843|ref|YP_001121811.1| glycosy hydrolase family protein [Francisella tularensis subsp. tularensis WY96-3418] gi|156502721|ref|YP_001428786.1| glycoside hydrolase family 3 protein [Francisella tularensis subsp. holarctica FTNF002-00] gi|167010618|ref|ZP_02275549.1| beta-glucosidase-related glycosidase [Francisella tularensis subsp. holarctica FSC200] gi|254367909|ref|ZP_04983929.1| beta-glucosidase-related glycosidase [Francisella tularensis subsp. holarctica 257] gi|254369422|ref|ZP_04985434.1| hypothetical protein FTAG_00403 [Francisella tularensis subsp. holarctica FSC022] gi|290953846|ref|ZP_06558467.1| glycoside hydrolase family 3 protein [Francisella tularensis subsp. holarctica URFT1] gi|295312783|ref|ZP_06803519.1| glycoside hydrolase family 3 protein [Francisella tularensis subsp. holarctica URFT1] gi|89144422|emb|CAJ79721.1| Beta-glucosidase-related glycosidase [Francisella tularensis subsp. holarctica LVS] gi|115129919|gb|ABI83106.1| beta-N-acetylhexosaminidase [Francisella tularensis subsp. holarctica OSU18] gi|134049620|gb|ABO46691.1| Glycosyl hydrolase, family 3 [Francisella tularensis subsp. tularensis WY96-3418] gi|134253719|gb|EBA52813.1| beta-glucosidase-related glycosidase [Francisella tularensis subsp. holarctica 257] gi|156253324|gb|ABU61830.1| Glycosyl hydrolase family 3, domain protein [Francisella tularensis subsp. holarctica FTNF002-00] gi|157122372|gb|EDO66512.1| hypothetical protein FTAG_00403 [Francisella tularensis subsp. holarctica FSC022] Length = 555 Score = 66.7 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L + GIN+NF+P +D+ I +S P + A+ Y Sbjct: 122 IGDELYSLGININFAPAVDVNSNKNNPIIGV-RSYSDNPDIVIDYAKNAINGYHD 175 >gi|194334961|ref|YP_002016821.1| beta-N-acetylhexosaminidase [Prosthecochloris aestuarii DSM 271] gi|194312779|gb|ACF47174.1| Beta-N-acetylhexosaminidase [Prosthecochloris aestuarii DSM 271] Length = 375 Score = 66.7 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIK 55 A L + IN+NF+PV D+ P+ + + FS PA A + + Sbjct: 149 AATLQSMHINLNFAPVADVNINPDNPVIGRLERSFSSDPAIVALHAAATVQAMHE 203 >gi|308172061|ref|YP_003918766.1| beta-hexosaminidase, lipoprotein [Bacillus amyloliquefaciens DSM 7] gi|307604925|emb|CBI41296.1| putative beta-hexosaminidase, putative lipoprotein [Bacillus amyloliquefaciens DSM 7] Length = 636 Score = 66.7 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L GIN NF+PVLD+ P + FS + K Sbjct: 155 IGKELKALGINTNFAPVLDINNNPGNPVIGV-RSFSSDRDLTASLGLASMKAQQK 208 >gi|325507592|gb|ADZ19228.1| Beta-glucosidase [Clostridium acetobutylicum EA 2018] Length = 518 Score = 66.7 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+N+N +PV+D+ P + +S P K E + + Sbjct: 118 GEELRGLGVNMNLAPVMDVNCNPSNPVIGV-RSYSDSPEKVAELGLELIKGLKE 170 >gi|15893475|ref|NP_346824.1| beta-glucosidase-like protein [Clostridium acetobutylicum ATCC 824] gi|15023012|gb|AAK78164.1|AE007531_6 Beta-glucosidase homolog [Clostridium acetobutylicum ATCC 824] Length = 520 Score = 66.7 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+N+N +PV+D+ P + +S P K E + + Sbjct: 120 GEELRGLGVNMNLAPVMDVNCNPSNPVIGV-RSYSDSPEKVAELGLELIKGLKE 172 >gi|284040228|ref|YP_003390158.1| beta-N-acetylhexosaminidase [Spirosoma linguale DSM 74] gi|283819521|gb|ADB41359.1| Beta-N-acetylhexosaminidase [Spirosoma linguale DSM 74] Length = 953 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI++NF+PV D+ P + F A + R + Sbjct: 121 IGRQCQRLGIHINFAPVSDINSNPANPVIGV-RSFGESKENVALKASAYMRGLQQ 174 >gi|56708028|ref|YP_169924.1| Beta-glucosidase-related glycosidase [Francisella tularensis subsp. tularensis SCHU S4] gi|110670499|ref|YP_667056.1| Beta-glucosidase-related glycosidase [Francisella tularensis subsp. tularensis FSC198] gi|254370511|ref|ZP_04986516.1| glycosyl hydrolase family 3 [Francisella tularensis subsp. tularensis FSC033] gi|56604520|emb|CAG45561.1| Beta-glucosidase-related glycosidase [Francisella tularensis subsp. tularensis SCHU S4] gi|110320832|emb|CAL08944.1| Beta-glucosidase-related glycosidase [Francisella tularensis subsp. tularensis FSC198] gi|151568754|gb|EDN34408.1| glycosyl hydrolase family 3 [Francisella tularensis subsp. tularensis FSC033] gi|282159218|gb|ADA78609.1| Beta-glucosidase-related glycosidase [Francisella tularensis subsp. tularensis NE061598] Length = 555 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L + GIN+NF+P +D+ I +S P + A+ Y Sbjct: 122 IGDELYSLGININFAPAVDVNSNKNNPIIGV-RSYSDNPDIVIDYAKNAINGYHD 175 >gi|328910128|gb|AEB61724.1| putative beta-hexosaminidase, putative lipoprotein [Bacillus amyloliquefaciens LL3] Length = 636 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L GIN NF+PVLD+ P + FS + K Sbjct: 155 IGKELKALGINTNFAPVLDINNNPGNPVIGV-RSFSSDRDLTASLGLASMKAQQK 208 >gi|328551872|gb|AEB22364.1| beta-hexosaminidase, lipoprotein [Bacillus amyloliquefaciens TA208] Length = 637 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L GIN NF+PVLD+ P + FS + K Sbjct: 155 IGKELKALGINTNFAPVLDINNNPGNPVIGV-RSFSSDRDLTASLGLASMKAQQK 208 >gi|187931621|ref|YP_001891605.1| glycosyl hydrolase family 3 [Francisella tularensis subsp. mediasiatica FSC147] gi|187712530|gb|ACD30827.1| glycosyl hydrolase family 3 [Francisella tularensis subsp. mediasiatica FSC147] Length = 555 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L + GIN+NF+P +D+ I +S P + A+ Y Sbjct: 122 IGDELYSLGININFAPAVDVNSNKNNPIIGV-RSYSDNPDIVIDYAKNAINGYHD 175 >gi|290957496|ref|YP_003488678.1| sugar hydrolase [Streptomyces scabiei 87.22] gi|260647022|emb|CBG70121.1| putative sugar hydrolase [Streptomyces scabiei 87.22] Length = 512 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+N+N++P D+ P + F PA + Sbjct: 123 LGRRLAECGVNLNWAPSADVNANPSNPVIGV-RSFGADPALVARHTAAYVTGLQD 176 >gi|88802422|ref|ZP_01117949.1| beta-N-acetylglucosaminidase [Polaribacter irgensii 23-P] gi|88781280|gb|EAR12458.1| beta-N-acetylglucosaminidase [Polaribacter irgensii 23-P] Length = 973 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ GI+VNF+PV+D+ PE I F E A F + Sbjct: 149 LGQHAKRIGIHVNFAPVIDINVNPENPIIG-NRSFGENKVNVTEKAIAFIKGMQ 201 >gi|300774380|ref|ZP_07084244.1| B-glycosidase [Chryseobacterium gleum ATCC 35910] gi|300507024|gb|EFK38158.1| B-glycosidase [Chryseobacterium gleum ATCC 35910] Length = 567 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A++ GIN +F+PV+D+ P+ I F + SA +S N Sbjct: 152 IAEDCHRMGINWDFAPVVDVNTNPDNPIIG-NRSFGSEVSNVISSALSYSNGLQDN 206 >gi|194719503|gb|ACF93787.1| HexI [Collimonas fungivorans Ter331] Length = 521 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ + + G N NF+PVLDL P + F P +A E A + ++ Sbjct: 121 ARGIRSLGFNWNFAPVLDLNNNPANPVIG-ERSFGSDPQRATELALAWMEGSLE 173 >gi|325285156|ref|YP_004260946.1| glycoside hydrolase family 3 domain-containing protein [Cellulophaga lytica DSM 7489] gi|324320610|gb|ADY28075.1| glycoside hydrolase family 3 domain protein [Cellulophaga lytica DSM 7489] Length = 574 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +AK+ +G++ N +PV+D+ P+ + F ++A F Sbjct: 182 IAKDCKDAGVHWNLAPVVDINNNPKNPVIG-YRSFGENKELVTKNAIAFVNGMQ 234 >gi|260436351|ref|ZP_05790321.1| possible beta-N-acetylglucosaminidase [Synechococcus sp. WH 8109] gi|260414225|gb|EEX07521.1| possible beta-N-acetylglucosaminidase [Synechococcus sp. WH 8109] Length = 533 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + G+N PV D+ P + + P A A F + + Sbjct: 127 GEQARRCGLNWVLGPVCDVNNNPANPVINV-RAWGEDPNTASALAVAFQQGLKQ 179 >gi|154684689|ref|YP_001419850.1| YbbD [Bacillus amyloliquefaciens FZB42] gi|154350540|gb|ABS72619.1| YbbD [Bacillus amyloliquefaciens FZB42] Length = 637 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L GIN NF+PVLD+ P + FS + K Sbjct: 155 IGKELKALGINTNFAPVLDINNNPGNPVIGV-RSFSSDRDLTASLGLASMKAQQK 208 >gi|330929531|ref|XP_003302679.1| hypothetical protein PTT_14588 [Pyrenophora teres f. teres 0-1] gi|311321821|gb|EFQ89235.1| hypothetical protein PTT_14588 [Pyrenophora teres f. teres 0-1] Length = 934 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ + GIN F P LD+L P + F + Y Sbjct: 126 AQEIAACGINWIFGPCLDVLTNARNQPLGV-RTAGDDPQEVSAFGVAFMQGYKD 178 >gi|189204298|ref|XP_001938484.1| beta-hexosaminidase [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187985583|gb|EDU51071.1| beta-hexosaminidase [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 764 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ + GIN F P LD+L P + F + Y Sbjct: 106 AQEIAACGINWIFGPCLDVLTNARNQPLGV-RTAGDDPQEVSAFGVAFMQGYKD 158 >gi|126650902|ref|ZP_01723118.1| beta-hexosaminidase [Bacillus sp. B14905] gi|126592567|gb|EAZ86585.1| beta-hexosaminidase [Bacillus sp. B14905] Length = 566 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + L G N++F+PV+D+ P I FS P + + Sbjct: 320 LGEQLKAFGFNLDFAPVMDVNSNPNNPIIG-DRSFSNKPDIVSQLGIQTMQGL 371 >gi|317050968|ref|YP_004112084.1| glycoside hydrolase family 3 domain-containing protein [Desulfurispirillum indicum S5] gi|316946052|gb|ADU65528.1| glycoside hydrolase family 3 domain protein [Desulfurispirillum indicum S5] Length = 370 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTY 53 MA+ L G+N+NF+PV+D+ PE + FS + + F+R Sbjct: 145 MAQALAGLGVNLNFAPVVDVNMNPENPVIGSLGRSFSADASAVARHGEQFARAM 198 >gi|229495828|ref|ZP_04389556.1| glycosyl hydrolase, family 3 [Porphyromonas endodontalis ATCC 35406] gi|229317402|gb|EEN83307.1| glycosyl hydrolase, family 3 [Porphyromonas endodontalis ATCC 35406] Length = 1001 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA+ T GI+VNF+PV+D+ P+ + F + + +SR + Sbjct: 159 MAEQCKTVGIHVNFAPVVDVNNNPKNPVIGT-RSFGEKTQDVIDYSLAYSRGLEE 212 >gi|67521918|ref|XP_659020.1| hypothetical protein AN1416.2 [Aspergillus nidulans FGSC A4] gi|40745390|gb|EAA64546.1| hypothetical protein AN1416.2 [Aspergillus nidulans FGSC A4] gi|259486725|tpe|CBF84813.1| TPA: beta-N-acetylglucosaminidase, putative (AFU_orthologue; AFUA_8G04060) [Aspergillus nidulans FGSC A4] Length = 923 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G N PVLD+L + P + + F + Y + Sbjct: 127 AQELKAVGFNWILGPVLDVLTNVRNQLMGV-RTCGDDPQEVSQYGVEFMKGYQQ 179 >gi|317477159|ref|ZP_07936400.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bacteroides eggerthii 1_2_48FAA] gi|316906702|gb|EFV28415.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bacteroides eggerthii 1_2_48FAA] Length = 489 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA+ G+ VNF+PV D+ P+ + F P ++R Sbjct: 165 MARQCKELGVQVNFAPVADVNINPKNPVINT-RSFGEDPVNVANKVIAYARGLED 218 >gi|223039793|ref|ZP_03610078.1| glycosyl hyrolase, family 3 [Campylobacter rectus RM3267] gi|222878985|gb|EEF14081.1| glycosyl hyrolase, family 3 [Campylobacter rectus RM3267] Length = 363 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 25/54 (46%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA+ L GINVNF+PV D+L T I + FS + A F + Sbjct: 143 MAQQLKDVGINVNFAPVADVLNPKSTIIGSRGRAFSADIDEVSLYASEFMKASQ 196 >gi|218132064|ref|ZP_03460868.1| hypothetical protein BACEGG_03691 [Bacteroides eggerthii DSM 20697] gi|217985714|gb|EEC52055.1| hypothetical protein BACEGG_03691 [Bacteroides eggerthii DSM 20697] Length = 1012 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA+ G+ VNF+PV D+ P+ + F P ++R Sbjct: 165 MARQCKELGVQVNFAPVADVNINPKNPVINT-RSFGEDPVNVANKVIAYARGLED 218 >gi|78213859|ref|YP_382638.1| putative beta-glucosidase [Synechococcus sp. CC9605] gi|78198318|gb|ABB36083.1| putative beta-glucosidase [Synechococcus sp. CC9605] Length = 538 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + G+N PV D+ P + + P A A F R + Sbjct: 132 GEQARRCGLNWVLGPVCDVNNNPANPVINM-RAWGEDPKSASALAVAFQRGLKQ 184 >gi|95929642|ref|ZP_01312384.1| glycoside hydrolase, family 3-like [Desulfuromonas acetoxidans DSM 684] gi|95134339|gb|EAT15996.1| glycoside hydrolase, family 3-like [Desulfuromonas acetoxidans DSM 684] Length = 411 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIA-QKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L T GIN+N +PV+DL P+ + + FS P + + A + + + Sbjct: 161 LATTLATFGINLNLAPVVDLCSNPDNPVIARLDRCFSATPDQVTDQAGAYIAGHHQ 216 >gi|295134579|ref|YP_003585255.1| family 3 glycosyl hydrolase/beta-lactamase fusion protein [Zunongwangia profunda SM-A87] gi|294982594|gb|ADF53059.1| family 3 glycosyl hydrolase/beta-lactamase fusion protein [Zunongwangia profunda SM-A87] Length = 978 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 ++++ GI++NF+PV+D+ P I F E A F R Sbjct: 156 ISRHTKRLGIHINFAPVVDINTNPLNPIIG-NRSFGENKINVTEKALAFMRGMH 208 >gi|295671635|ref|XP_002796364.1| beta-hexosaminidase [Paracoccidioides brasiliensis Pb01] gi|226283344|gb|EEH38910.1| beta-hexosaminidase [Paracoccidioides brasiliensis Pb01] Length = 915 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L GIN PVLD L P + F + Y Sbjct: 103 AQELSAVGINWILGPVLDALTNARNQPLGV-RSVGDDPQEVSAYGIEFMKGYQD 155 >gi|328676893|gb|AEB27763.1| Beta-hexosaminidase [Francisella cf. novicida Fx1] Length = 540 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L + GIN+NF+P +D+ I +S P + A+ Y Sbjct: 107 IGDELYSLGININFAPAVDVNSNKNNPIIGV-RSYSDNPNVVTDYAKNAINGYHD 160 >gi|229542760|ref|ZP_04431820.1| glycoside hydrolase family 3 domain protein [Bacillus coagulans 36D1] gi|229327180|gb|EEN92855.1| glycoside hydrolase family 3 domain protein [Bacillus coagulans 36D1] Length = 586 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L + GIN++F+P LD+ P + +S P + Sbjct: 178 MAVELKSLGINMDFAPDLDVNVNPANPVIGV-RSYSENPDLVASLGTAQIAGFQ 230 >gi|77918922|ref|YP_356737.1| putative glycosyl hydrolase [Pelobacter carbinolicus DSM 2380] gi|77545005|gb|ABA88567.1| putative glycosyl hydrolase [Pelobacter carbinolicus DSM 2380] Length = 382 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIK 55 A+ L +GIN+N SPV+DL P I + + FS P A+ R + + Sbjct: 156 ARTLQQAGINLNLSPVVDLNVNPANPIIGRLQRSFSAEPGTVISHAREVIRAHHQ 210 >gi|254372759|ref|ZP_04988248.1| hypothetical protein FTCG_00329 [Francisella tularensis subsp. novicida GA99-3549] gi|151570486|gb|EDN36140.1| hypothetical protein FTCG_00329 [Francisella novicida GA99-3549] Length = 555 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L + GIN+NF+P +D+ I +S P + A+ Y Sbjct: 122 IGDELYSLGININFAPAVDVNSNKNNPIIGV-RSYSDNPNVVTDYAKNAINGYHD 175 >gi|326798218|ref|YP_004316037.1| beta-N-acetylhexosaminidase [Sphingobacterium sp. 21] gi|326548982|gb|ADZ77367.1| Beta-N-acetylhexosaminidase [Sphingobacterium sp. 21] Length = 568 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +AK+ G+NVNF+PV+D+ P + F A + R + Sbjct: 150 IAKDFKRLGLNVNFAPVVDINNNPRNPVINF-RSFGENKGNVTRKASAYMRGMMD 203 >gi|333028928|ref|ZP_08456992.1| putative hydrolase [Streptomyces sp. Tu6071] gi|332748780|gb|EGJ79221.1| putative hydrolase [Streptomyces sp. Tu6071] Length = 518 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L +G++++++P D+ P+ I F P + R Sbjct: 110 LGHTLRAAGVSLDYAPSADVNSNPDNPIIGV-RSFGADPDSVARHTSAWIRGLQ 162 >gi|255322696|ref|ZP_05363840.1| glycosyl hydrolase, family 3 [Campylobacter showae RM3277] gi|255300257|gb|EET79530.1| glycosyl hydrolase, family 3 [Campylobacter showae RM3277] Length = 361 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 25/54 (46%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA+ L G+NVNF+PV D+L T I + FS + A F R Sbjct: 141 MAQQLKDVGVNVNFAPVADVLNPKSTIIGSRGRAFSTDIDEVSLYASEFMRASQ 194 >gi|302517371|ref|ZP_07269713.1| hydrolase [Streptomyces sp. SPB78] gi|302426266|gb|EFK98081.1| hydrolase [Streptomyces sp. SPB78] Length = 518 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L +G++++++P D+ P+ I F P + R Sbjct: 110 LGHTLRAAGVSLDYAPSADVNSNPDNPIIGV-RSFGADPDSVARHTSAWIRGLQ 162 >gi|158336220|ref|YP_001517394.1| beta-glucosidase [Acaryochloris marina MBIC11017] gi|158306461|gb|ABW28078.1| beta-glucosidase, putative [Acaryochloris marina MBIC11017] Length = 538 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A+ + G+N +PV+D+ P+ + F P + + F + P Sbjct: 134 AQEALAIGLNWVLAPVVDVNNNPQNPVINV-RAFGETPELVSQLSTAFIQGAQPYP 188 >gi|317130397|ref|YP_004096679.1| glycoside hydrolase [Bacillus cellulosilyticus DSM 2522] gi|315475345|gb|ADU31948.1| glycoside hydrolase family 3 domain protein [Bacillus cellulosilyticus DSM 2522] Length = 518 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L GIN N +PVLD+ P+ + F + + Sbjct: 114 GRELKALGINWNLAPVLDVNNNPKNPVIGV-RSFGESAELVSQFGIAAMKGMQ 165 >gi|226226452|ref|YP_002760558.1| beta-N-acetylhexosaminidase [Gemmatimonas aurantiaca T-27] gi|226089643|dbj|BAH38088.1| beta-N-acetylhexosaminidase [Gemmatimonas aurantiaca T-27] Length = 658 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A GI++ F+PVLD+ P+ + F PA R +N Sbjct: 211 AVEGRAMGIHMAFAPVLDVNNNPKNPVI-SGRSFGEDPALVSRMGAALVRGIQEN 264 >gi|126656850|ref|ZP_01728028.1| beta-glucosidase [Cyanothece sp. CCY0110] gi|126621688|gb|EAZ92397.1| beta-glucosidase [Cyanothece sp. CCY0110] Length = 539 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 AK + GIN SP++D+ P+ + F E A+ F P Sbjct: 132 AKEALAIGINWILSPIVDVNNNPDNPVINI-RSFGDNSKAVGELAKAFIEGAKNYP 186 >gi|317036379|ref|XP_001398206.2| beta-N-acetylglucosaminidase [Aspergillus niger CBS 513.88] Length = 931 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L + P + + F + Y K Sbjct: 127 AQELKAVGVNWILGPVLDVLTNVRSQPLGV-RTTGDDPQEVSQYGVEFMKGYQK 179 >gi|134083771|emb|CAK47105.1| unnamed protein product [Aspergillus niger] Length = 1107 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L + P + + F + Y K Sbjct: 303 AQELKAVGVNWILGPVLDVLTNVRSQPLGV-RTTGDDPQEVSQYGVEFMKGYQK 355 >gi|194333015|ref|YP_002014875.1| glycoside hydrolase family 3 domain-containing protein [Prosthecochloris aestuarii DSM 271] gi|194310833|gb|ACF45228.1| glycoside hydrolase family 3 domain protein [Prosthecochloris aestuarii DSM 271] Length = 573 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A GI ++ P DL P+ I + K A F N Sbjct: 154 IAGEAKALGIYQSYGPSTDLNLNPDNPIINT-RSYGDNVEKTISMANAFIDGLQDN 208 >gi|302542633|ref|ZP_07294975.1| LOW QUALITY PROTEIN: putative sugar hydrolase [Streptomyces hygroscopicus ATCC 53653] gi|302460251|gb|EFL23344.1| LOW QUALITY PROTEIN: putative sugar hydrolase [Streptomyces himastatinicus ATCC 53653] Length = 319 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+N+N++P D+ P+ + F P + Sbjct: 114 LGRRLAACGVNLNWAPSADVNSNPDNPVIGV-RSFGATPQLVARHTAAWIEGLQ 166 >gi|169827957|ref|YP_001698115.1| lipoprotein ybbD [Lysinibacillus sphaericus C3-41] gi|168992445|gb|ACA39985.1| Hypothetical lipoprotein ybbD precursor [Lysinibacillus sphaericus C3-41] Length = 566 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + L G N++F+PV+D+ P I FS P + + Sbjct: 320 LGEQLKAFGFNLDFAPVMDVNSNPNNPIIG-DRSFSNKPDIVSQLGIQTMQGL 371 >gi|318058907|ref|ZP_07977630.1| hydrolase [Streptomyces sp. SA3_actG] gi|318077234|ref|ZP_07984566.1| hydrolase [Streptomyces sp. SA3_actF] Length = 518 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L +G++++++P D+ P+ I F P + R Sbjct: 110 LGHTLRAAGVSLDYAPSADVNSNPDNPIIGV-RSFGADPDSVARHTAAWIRGLQ 162 >gi|325287505|ref|YP_004263295.1| beta-N-acetylhexosaminidase [Cellulophaga lytica DSM 7489] gi|324322959|gb|ADY30424.1| Beta-N-acetylhexosaminidase [Cellulophaga lytica DSM 7489] Length = 978 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K+ G+++NF+P +D+ P I F + F + K Sbjct: 156 IGKHSKRMGVHINFAPDIDINTNPLNPIIG-NRSFGEDKRNVAKKGIAFVNGFEK 209 >gi|169599452|ref|XP_001793149.1| hypothetical protein SNOG_02547 [Phaeosphaeria nodorum SN15] gi|160704613|gb|EAT90759.2| hypothetical protein SNOG_02547 [Phaeosphaeria nodorum SN15] Length = 781 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK + GIN F P LD+L P + F + Y + Sbjct: 20 AKEIAACGINWIFGPCLDVLTNARNQPLGV-RTAGDDPQEVSAFGCAFMQGYKE 72 >gi|254483231|ref|ZP_05096463.1| Glycosyl hydrolase family 3 N terminal domain protein [marine gamma proteobacterium HTCC2148] gi|214036454|gb|EEB77129.1| Glycosyl hydrolase family 3 N terminal domain protein [marine gamma proteobacterium HTCC2148] Length = 567 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L GIN+NF P LD+ P + F PA + Sbjct: 128 AAELKALGININFVPSLDVNSDPANPVIGV-RSFGDDPAAVASLGSELLSGLQE 180 >gi|215406235|ref|ZP_03418416.1| putative lipoprotein LpqI [Mycobacterium tuberculosis 02_1987] gi|289748007|ref|ZP_06507385.1| lipoprotein lpqI [Mycobacterium tuberculosis 02_1987] gi|289688535|gb|EFD56023.1| lipoprotein lpqI [Mycobacterium tuberculosis 02_1987] Length = 388 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI ++F+PV+D+ P+ + F PA A +++ Sbjct: 163 GRQMRKLGITIDFAPVVDVTDAPDDPVIG-DRSFGSDPATVTAYAGAYAQGLRD 215 >gi|220919499|ref|YP_002494803.1| glycoside hydrolase family 3 domain protein [Anaeromyxobacter dehalogenans 2CP-1] gi|219957353|gb|ACL67737.1| glycoside hydrolase family 3 domain protein [Anaeromyxobacter dehalogenans 2CP-1] Length = 365 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GI+ +++PV+D+ P + SR P + Sbjct: 112 LGRELRAVGIDQDYAPVVDVDTNPANPVIG-DRSLSRDPETVGRLGAAIALGLQ 164 >gi|86134048|ref|ZP_01052630.1| beta-N-acetylglucosaminidase [Polaribacter sp. MED152] gi|85820911|gb|EAQ42058.1| beta-N-acetylglucosaminidase [Polaribacter sp. MED152] Length = 979 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + ++ GI++NF+PVLD+ PE I F + A F++ K Sbjct: 156 LGQHCQRLGIHINFAPVLDVNVNPENPIIG-NRSFGESKENVTQKAIAFTQGMQK 209 >gi|85059931|ref|YP_455633.1| putative glycosidase [Sodalis glossinidius str. 'morsitans'] gi|84780451|dbj|BAE75228.1| putative glycosidase [Sodalis glossinidius str. 'morsitans'] Length = 650 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 MA+ L + GINVNF+PV+D+ + FS PA+ ++ A+ + Sbjct: 190 MAQELRSLGINVNFAPVVDVNSNQANPVINV-RAFSDSPARVDKLARELVKG 240 >gi|296876267|ref|ZP_06900320.1| beta-hexosaminidase A [Streptococcus parasanguinis ATCC 15912] gi|296432772|gb|EFH18566.1| beta-hexosaminidase A [Streptococcus parasanguinis ATCC 15912] Length = 803 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+NV+F+PVLD P+ + FS P + + Sbjct: 221 IGRELSALGLNVDFAPVLDTNNNPQNPVIGL-RSFSSDPNRVAYLGIPMMKGIQD 274 >gi|332533054|ref|ZP_08408924.1| beta-hexosaminidase A precursor [Pseudoalteromonas haloplanktis ANT/505] gi|332037533|gb|EGI73986.1| beta-hexosaminidase A precursor [Pseudoalteromonas haloplanktis ANT/505] Length = 603 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +AK L + GINVN++P +D+ P+ + F PA + + N Sbjct: 141 IAKELNSLGINVNYAPTVDVNMNPDNPVINV-RSFGENPALVSKLGAAQVAGFESN 195 >gi|302384093|ref|YP_003819916.1| glycoside hydrolase [Brevundimonas subvibrioides ATCC 15264] gi|302194721|gb|ADL02293.1| glycoside hydrolase family 3 domain protein [Brevundimonas subvibrioides ATCC 15264] Length = 348 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA +L + GIN++ +PVLD+ I +++ PA + + + + Sbjct: 107 MAHDLKSVGINIDCAPVLDVPTAGAHDIIG-DRAYAQDPATVTQLGRAVAEGLL 159 >gi|270157239|ref|ZP_06185896.1| glycosyl hydrolase [Legionella longbeachae D-4968] gi|289164364|ref|YP_003454502.1| N-acetyl-beta-glucosaminidase [Legionella longbeachae NSW150] gi|269989264|gb|EEZ95518.1| glycosyl hydrolase [Legionella longbeachae D-4968] gi|288857537|emb|CBJ11375.1| putative N-acetyl-beta-glucosaminidase [Legionella longbeachae NSW150] Length = 380 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQ-KRSIFSRIPAKAEESAQLFSRTYIK 55 M + L +G N+NF+P LD+ P+ I K FS P + A ++++ ++ Sbjct: 153 MTQTLKNTGFNLNFAPELDVNVNPDNPIIGKKDRSFSSDPKQIIRYASIYTQQFLN 208 >gi|317157898|ref|XP_001826639.2| beta-N-acetylglucosaminidase [Aspergillus oryzae RIB40] Length = 932 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L GIN PVLD+L + P + + F + Y + Sbjct: 127 AQELKAVGINWILGPVLDVLTNVRSQPLGV-RTTGDDPQEVSQYGVEFMKGYKE 179 >gi|238508524|ref|XP_002385454.1| beta-N-acetylglucosaminidase, putative [Aspergillus flavus NRRL3357] gi|220688973|gb|EED45325.1| beta-N-acetylglucosaminidase, putative [Aspergillus flavus NRRL3357] Length = 733 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L GIN PVLD+L + P + + F + Y + Sbjct: 103 AQELKAVGINWILGPVLDVLTNVRSQPLGV-RTTGDDPQEVSQYGVEFMKGYKE 155 >gi|83775386|dbj|BAE65506.1| unnamed protein product [Aspergillus oryzae] Length = 961 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L GIN PVLD+L + P + + F + Y + Sbjct: 156 AQELKAVGINWILGPVLDVLTNVRSQPLGV-RTTGDDPQEVSQYGVEFMKGYKE 208 >gi|124515181|gb|EAY56692.1| Beta-N-acetylhexosaminidase [Leptospirillum rubarum] Length = 342 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + L +GI+++F+PVLD+ P+ + FSR P + + FS Sbjct: 111 LGRALRQTGIDIDFAPVLDVDSNPDNPVIG-DRSFSREPWEVARLSMAFSHGL 162 >gi|241668593|ref|ZP_04756171.1| glycosy hydrolase family protein [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|254877127|ref|ZP_05249837.1| glycosyl hydrolase [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|254843148|gb|EET21562.1| glycosyl hydrolase [Francisella philomiragia subsp. philomiragia ATCC 25015] Length = 555 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L + GIN+NF+P +D+ I +S P + A+ Y Sbjct: 122 IGDELYSLGININFAPAVDVNSNKNNPIIGV-RSYSDNPNVVTDYAKNAINGYHD 175 >gi|118497398|ref|YP_898448.1| glycosy hydrolase family protein [Francisella tularensis subsp. novicida U112] gi|195536090|ref|ZP_03079097.1| beta-glucosidase-related glycosidase [Francisella tularensis subsp. novicida FTE] gi|208779193|ref|ZP_03246539.1| beta-glucosidase-related glycosidase [Francisella novicida FTG] gi|118423304|gb|ABK89694.1| glycosyl hydrolase family 3 [Francisella novicida U112] gi|194372567|gb|EDX27278.1| beta-glucosidase-related glycosidase [Francisella tularensis subsp. novicida FTE] gi|208744993|gb|EDZ91291.1| beta-glucosidase-related glycosidase [Francisella novicida FTG] Length = 555 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L + GIN+NF+P +D+ I +S P + A+ Y Sbjct: 122 IGDELYSLGININFAPAIDVNSNKNNPIIGV-RSYSDNPNVVTDYAKNAINGYHD 175 >gi|197124780|ref|YP_002136731.1| glycoside hydrolase [Anaeromyxobacter sp. K] gi|196174629|gb|ACG75602.1| glycoside hydrolase family 3 domain protein [Anaeromyxobacter sp. K] Length = 365 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GI+ +++PV+D+ P + SR P + Sbjct: 112 LGRELRAVGIDQDYAPVVDVDTNPANPVIG-DRSLSRDPETVGRLGAAIALGLQ 164 >gi|160901962|ref|YP_001567543.1| glycoside hydrolase family 3 protein [Petrotoga mobilis SJ95] gi|160359606|gb|ABX31220.1| glycoside hydrolase family 3 domain protein [Petrotoga mobilis SJ95] Length = 528 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +AK ++ GI+ N +PV+D+ P+ + FS + A+ + + Sbjct: 108 LAKEMLAVGIDWNLAPVVDINNNPKNSVIGI-RSFSDDKNVVLKFAREYVKGLHD 161 >gi|56697349|ref|YP_167717.1| beta-N-acetylhexosaminidase, putative [Ruegeria pomeroyi DSS-3] gi|56679086|gb|AAV95752.1| beta-N-acetylhexosaminidase, putative [Ruegeria pomeroyi DSS-3] Length = 335 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+ N +P+LDL + + P + ++ ++ Sbjct: 106 IAHELRAVGIDSNCAPMLDLARDETHP-FLRNRCYGSDPETVARLGRAVAQGHLD 159 >gi|291298886|ref|YP_003510164.1| beta-N-acetylhexosaminidase [Stackebrandtia nassauensis DSM 44728] gi|290568106|gb|ADD41071.1| Beta-N-acetylhexosaminidase [Stackebrandtia nassauensis DSM 44728] Length = 600 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 12/51 (23%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GIN NF+P D+ P+ + +S P + + Y Sbjct: 183 ELRAVGINQNFAPSGDVNVNPQNPVIGV-RSYSSDPKLVAKFTGEQVKGYQ 232 >gi|332299859|ref|YP_004441780.1| Beta-N-acetylhexosaminidase [Porphyromonas asaccharolytica DSM 20707] gi|332176922|gb|AEE12612.1| Beta-N-acetylhexosaminidase [Porphyromonas asaccharolytica DSM 20707] Length = 438 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA GI V+F+PVLD+ P+ + P +R Sbjct: 182 MALQCRVMGIQVSFAPVLDVNNNPKNPVIGT-RSLGATPDIVISHGLALARGMED 235 >gi|313886242|ref|ZP_07819971.1| glycosyl hydrolase family 3 N-terminal domain protein [Porphyromonas asaccharolytica PR426713P-I] gi|312924313|gb|EFR35093.1| glycosyl hydrolase family 3 N-terminal domain protein [Porphyromonas asaccharolytica PR426713P-I] Length = 408 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA GI V+F+PVLD+ P+ + P +R Sbjct: 152 MALQCRVMGIQVSFAPVLDVNNNPKNPVIGT-RSLGATPDIVISHGLALARGMED 205 >gi|86160680|ref|YP_467465.1| glycoside hydrolase family protein [Anaeromyxobacter dehalogenans 2CP-C] gi|85777191|gb|ABC84028.1| glycoside hydrolase, family 3-like protein [Anaeromyxobacter dehalogenans 2CP-C] Length = 365 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GI+ +++PV+D+ P + SR P + Sbjct: 112 LGRELRAVGIDQDYAPVVDVDTNPANPVIG-DRSLSRDPETVGRLGAAIALGLQ 164 >gi|325300098|ref|YP_004260015.1| Beta-N-acetylhexosaminidase [Bacteroides salanitronis DSM 18170] gi|324319651|gb|ADY37542.1| Beta-N-acetylhexosaminidase [Bacteroides salanitronis DSM 18170] Length = 987 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+ VNF+PV D+ + F P + ++R Sbjct: 150 ARQLREIGVQVNFAPVADVDNNSANPVINV-RSFGSGPKEVARKVIAYARGLED 202 >gi|322699281|gb|EFY91044.1| beta-N-acetylglucosaminidase, putative [Metarhizium acridum CQMa 102] Length = 536 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L GIN+N++PV D+ P + P + A +R + Sbjct: 117 GNTLRHFGINMNYAPVGDVNSEPLNPVIGV-RSPGDDPDRVARFAVECARGLRE 169 >gi|168016310|ref|XP_001760692.1| predicted protein [Physcomitrella patens subsp. patens] gi|162688052|gb|EDQ74431.1| predicted protein [Physcomitrella patens subsp. patens] Length = 433 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +AK L +++N +PVLD+ PE + K F+ PA+ + R Sbjct: 158 IAKELRAVNVDMNLAPVLDVDTNPENTVIGK-RSFATTPARVANLGFAYIRGLQ 210 >gi|312219895|emb|CBX99837.1| similar to beta-N-acetylglucosaminidase [Leptosphaeria maculans] Length = 886 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ + GIN F P LD+L P + F + Y + Sbjct: 106 AQEIAACGINWIFGPCLDVLTNARNQPLGV-RTAGDDPQEVSAFGCAFMQGYKE 158 >gi|167751746|ref|ZP_02423873.1| hypothetical protein EUBSIR_02755 [Eubacterium siraeum DSM 15702] gi|167655554|gb|EDR99683.1| hypothetical protein EUBSIR_02755 [Eubacterium siraeum DSM 15702] Length = 406 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G N++F+PV D P+ + + PA Sbjct: 188 IGSYLKELGFNLDFAPVADTNTNPQNIVIG-DRSYGSDPALVARMVSAQLDGMHD 241 >gi|167628036|ref|YP_001678536.1| glycosyl hydrolase family protein [Francisella philomiragia subsp. philomiragia ATCC 25017] gi|167598037|gb|ABZ88035.1| glycosyl hydrolase family 3 [Francisella philomiragia subsp. philomiragia ATCC 25017] Length = 555 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L + GIN+NF+P +D+ I +S P + A+ Y Sbjct: 122 IGDELYSLGININFAPAVDVNSNKNNPIIGV-RSYSDNPNVVTDYAKNAINGYHD 175 >gi|332184028|gb|AEE26282.1| Beta-hexosaminidase [Francisella cf. novicida 3523] Length = 555 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L + GIN+NF+P +D+ I +S P + A+ Y Sbjct: 122 IGDELYSLGININFAPAVDVNSNKNNPIIGV-RSYSDNPNVVTDYAKNAINGYHD 175 >gi|325970839|ref|YP_004247030.1| beta-N-acetylhexosaminidase [Spirochaeta sp. Buddy] gi|324026077|gb|ADY12836.1| Beta-N-acetylhexosaminidase [Spirochaeta sp. Buddy] Length = 515 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK L G+ VNF+P LD+ P + + Sbjct: 114 AKELRALGVTVNFAPCLDVNSNPRNPVIGV-RSYGDTSDVVSSFGLSMIEGLQ 165 >gi|89890708|ref|ZP_01202217.1| glycoside hydrolase [Flavobacteria bacterium BBFL7] gi|89516853|gb|EAS19511.1| glycoside hydrolase [Flavobacteria bacterium BBFL7] Length = 983 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ G+++NF+P +D+ P+ I F +Q F + Sbjct: 160 IGQHCKRLGVHINFAPDVDINTNPDNPIIG-NRSFGEDMYNVTNKSQAFMKGMQ 212 >gi|327349774|gb|EGE78631.1| beta-N-acetylglucosaminidase [Ajellomyces dermatitidis ATCC 18188] Length = 924 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD L P + F + Y Sbjct: 117 AQELSAVGVNWILGPVLDALTNARNQPLGV-RSVGDDPQEVSAYGIEFMKGYQD 169 >gi|239615108|gb|EEQ92095.1| beta-N-acetylglucosaminidase [Ajellomyces dermatitidis ER-3] Length = 917 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD L P + F + Y Sbjct: 110 AQELSAVGVNWILGPVLDALTNARNQPLGV-RSVGDDPQEVSAYGIEFMKGYQD 162 >gi|261192222|ref|XP_002622518.1| beta-N-acetylglucosaminidase [Ajellomyces dermatitidis SLH14081] gi|239589393|gb|EEQ72036.1| beta-N-acetylglucosaminidase [Ajellomyces dermatitidis SLH14081] Length = 917 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD L P + F + Y Sbjct: 110 AQELSAVGVNWILGPVLDALTNARNQPLGV-RSVGDDPQEVSAYGIEFMKGYQD 162 >gi|296415057|ref|XP_002837208.1| hypothetical protein [Tuber melanosporum Mel28] gi|295633069|emb|CAZ81399.1| unnamed protein product [Tuber melanosporum] Length = 889 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK LV GIN NF+P+LD++ + + F P F+ Sbjct: 135 AKELVAVGINWNFAPLLDVISESNSSVIGV-RAFGDDPQVVGRYGVAFAEGLR 186 >gi|240276786|gb|EER40297.1| beta-N-acetylglucosaminidase [Ajellomyces capsulatus H143] gi|325095173|gb|EGC48483.1| beta-N-acetylglucosaminidase [Ajellomyces capsulatus H88] Length = 910 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L GIN PVLD L P + F + Y + Sbjct: 103 AQELSAVGINWILGPVLDALTNARNQPLGV-RSVGDDPQEVSAYGIEFMKGYQE 155 >gi|225554834|gb|EEH03129.1| glycosyl hyrolase [Ajellomyces capsulatus G186AR] Length = 930 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L GIN PVLD L P + F + Y + Sbjct: 117 AQELSAVGINWILGPVLDALTNARNQPLGV-RSVGDDPQEVSAYGIEFMKGYQE 169 >gi|154272379|ref|XP_001537042.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1] gi|150409029|gb|EDN04485.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1] Length = 876 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L GIN PVLD L P + F + Y + Sbjct: 103 AQELSAVGINWILGPVLDALTNARNQPLGV-RSVGDDPQEVSAYGIEFMKGYQE 155 >gi|189501346|ref|YP_001960816.1| Beta-N-acetylhexosaminidase [Chlorobium phaeobacteroides BS1] gi|189496787|gb|ACE05335.1| Beta-N-acetylhexosaminidase [Chlorobium phaeobacteroides BS1] Length = 373 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYI 54 AK L SGINVNF+PV+DL PE + FS A + A+ + Sbjct: 147 AKTLHNSGINVNFAPVVDLNSNPENPVIGSLERSFSADAAIVYKHARATVEAFH 200 >gi|307328574|ref|ZP_07607748.1| glycoside hydrolase family 3 domain protein [Streptomyces violaceusniger Tu 4113] gi|306885842|gb|EFN16854.1| glycoside hydrolase family 3 domain protein [Streptomyces violaceusniger Tu 4113] Length = 519 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+N+N++P D+ P+ + F P + Sbjct: 114 LGRRLAECGVNLNWAPSADVNSNPDNPVIGV-RSFGAEPGLVARHTAAYIEGLQ 166 >gi|256830691|ref|YP_003159419.1| beta-N-acetylhexosaminidase [Desulfomicrobium baculatum DSM 4028] gi|256579867|gb|ACU91003.1| Beta-N-acetylhexosaminidase [Desulfomicrobium baculatum DSM 4028] Length = 382 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETF-IAQKRSIFSRIPAKAEESAQLFSRTYI 54 K L G+N+NF+PV D+ P++ I FS P A F R + Sbjct: 149 GKLLADLGVNLNFAPVADVDINPQSPAIGALERSFSADPDLVALHAHAFCRGLL 202 >gi|329964726|ref|ZP_08301780.1| beta-lactamase [Bacteroides fluxus YIT 12057] gi|328525126|gb|EGF52178.1| beta-lactamase [Bacteroides fluxus YIT 12057] Length = 1015 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA+ G+ VNF+PV D+ P + F P + +S+ Sbjct: 165 MARQCRELGVQVNFAPVADVNINPRNPVINT-RSFGENPRDVADKVIAYSKGLED 218 >gi|295697245|ref|YP_003590483.1| glycoside hydrolase family 3 domain protein [Bacillus tusciae DSM 2912] gi|295412847|gb|ADG07339.1| glycoside hydrolase family 3 domain protein [Bacillus tusciae DSM 2912] Length = 391 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA+ L G N +F+PVLD+ P+ + F P A R Sbjct: 146 MAEELRAFGFNTDFAPVLDINSNPDNPVIG-DRSFGSTPDAASRQGVAEMRGIQD 199 >gi|54294135|ref|YP_126550.1| hypothetical protein lpl1199 [Legionella pneumophila str. Lens] gi|53753967|emb|CAH15438.1| hypothetical protein lpl1199 [Legionella pneumophila str. Lens] Length = 382 Score = 64.8 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQ-KRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L ++G N+NF P LD+ P+ I K FS IP + AQL++ +I + Sbjct: 156 MANTLKSTGFNLNFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFITH 212 >gi|1346276|sp|P48823|HEXA_PSEO7 RecName: Full=Beta-hexosaminidase A; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=Chitobiase; AltName: Full=N-acetyl-beta-glucosaminidase; Flags: Precursor gi|2120573|pir||I39596 chitobiase - Alteromonas sp gi|641934|dbj|BAA04223.1| chitobiase 60 precursor [Pseudoalteromonas piscicida] Length = 598 Score = 64.8 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + K L + GINVNF+P +D+ P + FS P + + + Sbjct: 147 IGKELNSLGINVNFAPTVDVNSNPNNPVINV-RSFSENPTVVTKLGLAQVKAF 198 >gi|254433881|ref|ZP_05047389.1| Glycosyl hydrolase family 3 N terminal domain protein [Nitrosococcus oceani AFC27] gi|207090214|gb|EDZ67485.1| Glycosyl hydrolase family 3 N terminal domain protein [Nitrosococcus oceani AFC27] Length = 335 Score = 64.8 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L G++ +FSPVLDL G I F P A+ + R Sbjct: 102 MAVELRAVGVDFSFSPVLDLDRGVSAVIG--DRAFHGEPDAVIALARAYIRGM 152 >gi|77165648|ref|YP_344173.1| glycoside hydrolase family protein [Nitrosococcus oceani ATCC 19707] gi|97180194|sp|Q3J953|NAGZ_NITOC RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|76883962|gb|ABA58643.1| Glycoside hydrolase, family 3-like protein [Nitrosococcus oceani ATCC 19707] Length = 341 Score = 64.8 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L G++ +FSPVLDL G I F P A+ + R Sbjct: 108 MAVELRAVGVDFSFSPVLDLDRGVSAVIG--DRAFHGEPDAVIALARAYIRGM 158 >gi|189423788|ref|YP_001950965.1| beta-N-acetylhexosaminidase [Geobacter lovleyi SZ] gi|189420047|gb|ACD94445.1| Beta-N-acetylhexosaminidase [Geobacter lovleyi SZ] Length = 392 Score = 64.8 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETF-IAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L T+G+N+NF+PV+DL P++ I FS P+ A++F T+ N Sbjct: 168 IGATLATNGLNMNFAPVVDLNINPQSPAIGALERSFSADPSIVTNHARIFVETHDAN 224 >gi|315024018|gb|EFT37020.1| glycoside hydrolase [Riemerella anatipestifer RA-YM] gi|325335621|gb|ADZ11895.1| Beta-glucosidase-related glycosidase [Riemerella anatipestifer RA-GD] Length = 565 Score = 64.8 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A++ GI +F+PV+D+ P I F K E +S N Sbjct: 142 IAEDCKRMGIYWDFAPVVDVNTNPINPIIG-NRSFGSNVKKVIEKGLAYSYGLQDN 196 >gi|310818891|ref|YP_003951249.1| beta-glucosidase-like glycosidase [Stigmatella aurantiaca DW4/3-1] gi|309391963|gb|ADO69422.1| Beta-glucosidase-like glycosidase [Stigmatella aurantiaca DW4/3-1] Length = 594 Score = 64.8 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++L G N+N +PVLD+ P + + + E + F+R + Sbjct: 162 GEDLRRLGFNMNLAPVLDVNLNPHNPVIGI-RSYGDSVSLVSEMGRAFARGQQE 214 >gi|167761811|ref|ZP_02433938.1| hypothetical protein BACSTE_00152 [Bacteroides stercoris ATCC 43183] gi|167700317|gb|EDS16896.1| hypothetical protein BACSTE_00152 [Bacteroides stercoris ATCC 43183] Length = 1011 Score = 64.8 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA+ G+ VNF+PV D+ P+ + F P ++R Sbjct: 165 MARQCRELGVQVNFAPVADVNINPKNPVINT-RSFGENPVNVANKVIAYARGLED 218 >gi|115378036|ref|ZP_01465216.1| beta-glucosidase [Stigmatella aurantiaca DW4/3-1] gi|115364975|gb|EAU64030.1| beta-glucosidase [Stigmatella aurantiaca DW4/3-1] Length = 611 Score = 64.8 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++L G N+N +PVLD+ P + + + E + F+R + Sbjct: 179 GEDLRRLGFNMNLAPVLDVNLNPHNPVIGI-RSYGDSVSLVSEMGRAFARGQQE 231 >gi|332827548|gb|EGK00294.1| hypothetical protein HMPREF9455_03433 [Dysgonomonas gadei ATCC BAA-286] Length = 1024 Score = 64.8 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ GI+VNF+P +D+ P + F P + ++++ Sbjct: 158 ARQCRLMGIHVNFAPAMDVNSNPANPVIG-NRSFGEDPGNVSKLGVMYAKGL 208 >gi|254374220|ref|ZP_04989702.1| glycosyl hydrolase family 3 [Francisella novicida GA99-3548] gi|151571940|gb|EDN37594.1| glycosyl hydrolase family 3 [Francisella novicida GA99-3548] Length = 555 Score = 64.8 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L + GIN+NF+P +D+ I +S P + A+ Y Sbjct: 122 IGDELYSLGININFAPAVDVNSNKNNPIIGV-RSYSDNPNVVTDYAKNAINGYHD 175 >gi|146337722|ref|YP_001202770.1| glycoside hydrolase family protein [Bradyrhizobium sp. ORS278] gi|146190528|emb|CAL74527.1| putative Glycosyl hydrolase, family 3 [Bradyrhizobium sp. ORS278] Length = 369 Score = 64.8 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 14/48 (29%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Query: 9 GINVNFSPVLDLLYGPETFIAQ-KRSIFSRIPAKAEESAQLFSRTYIK 55 INVN +PV+DL P I ++ + P A F + + K Sbjct: 136 HINVNLAPVVDLNTNPANPIIGQRQRSYGSEPDTVVRYAAAFVQAHRK 183 >gi|331006315|ref|ZP_08329629.1| Beta N-acetyl-glucosaminidase [gamma proteobacterium IMCC1989] gi|330419862|gb|EGG94214.1| Beta N-acetyl-glucosaminidase [gamma proteobacterium IMCC1989] Length = 362 Score = 64.8 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ G++ +F+PVLD+ I FS P + A F R Sbjct: 107 MAVELLAVGVDFSFAPVLDVDDNFCKVI--ADRSFSSDPDEVSALAGAFMRGMND 159 >gi|295840546|ref|ZP_06827479.1| hydrolase [Streptomyces sp. SPB74] gi|295828044|gb|EDY43557.2| hydrolase [Streptomyces sp. SPB74] Length = 518 Score = 64.8 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L +G++++++P D+ P+ I F PA + R Sbjct: 110 LGHTLRAAGVSLDYAPSADVNSNPDNPIIGV-RSFGADPATVSRHTAAWIRGLQ 162 >gi|313206942|ref|YP_004046119.1| glycoside hydrolase family 3 domain protein [Riemerella anatipestifer DSM 15868] gi|312446258|gb|ADQ82613.1| glycoside hydrolase family 3 domain protein [Riemerella anatipestifer DSM 15868] Length = 577 Score = 64.8 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A++ GI +F+PV+D+ P I F K E +S N Sbjct: 154 IAEDCKRMGIYWDFAPVVDVNTNPINPIIG-NRSFGSNVKKVIEKGLAYSYGLQDN 208 >gi|239617267|ref|YP_002940589.1| glycoside hydrolase family 3 domain protein [Kosmotoga olearia TBF 19.5.1] gi|239506098|gb|ACR79585.1| glycoside hydrolase family 3 domain protein [Kosmotoga olearia TBF 19.5.1] Length = 528 Score = 64.8 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 K L GIN++F+PVLD+ P I F P + + F + + Sbjct: 129 GKALRDLGINMDFAPVLDVNSNPFNPIIGV-RSFWNEPTRVATNGVAFFKGLL 180 >gi|325955314|ref|YP_004238974.1| beta-N-acetylhexosaminidase [Weeksella virosa DSM 16922] gi|323437932|gb|ADX68396.1| Beta-N-acetylhexosaminidase [Weeksella virosa DSM 16922] Length = 568 Score = 64.8 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A G+ +F+P +D+ P I F P + R KN Sbjct: 148 IADQANRMGVKFDFAPSVDVNVNPNNPIIG-NRSFGSDPENVWLKGEALMRGLQKN 202 >gi|125972843|ref|YP_001036753.1| glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405] gi|256005885|ref|ZP_05430832.1| glycoside hydrolase family 3 domain protein [Clostridium thermocellum DSM 2360] gi|125713068|gb|ABN51560.1| glycoside hydrolase, family 3-like protein [Clostridium thermocellum ATCC 27405] gi|255990154|gb|EEU00289.1| glycoside hydrolase family 3 domain protein [Clostridium thermocellum DSM 2360] gi|316940921|gb|ADU74955.1| glycoside hydrolase family 3 domain protein [Clostridium thermocellum DSM 1313] Length = 444 Score = 64.8 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G N+NF+PV D+ P+ + F P K Q S+ + Sbjct: 190 LGAELSALGFNMNFAPVADVNTNPDNPVIG-DRSFGSDPYKVGLMVQAMSKGMQE 243 >gi|312141421|ref|YP_004008757.1| glycosyl hydrolase family 3 [Rhodococcus equi 103S] gi|311890760|emb|CBH50079.1| putative secreted glycosyl hydrolase family 3 [Rhodococcus equi 103S] Length = 401 Score = 64.8 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L + GI VNF+P +D+ P+ + FS P A ++R Sbjct: 179 GRKLRSVGITVNFAPDVDVSSQPDDSVIG-DRSFSDDPEVVTRYADAYARGMRD 231 >gi|325673158|ref|ZP_08152851.1| lipoprotein LpqI [Rhodococcus equi ATCC 33707] gi|325555993|gb|EGD25662.1| lipoprotein LpqI [Rhodococcus equi ATCC 33707] Length = 401 Score = 64.8 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L + GI VNF+P +D+ P+ + FS P A ++R Sbjct: 179 GRKLRSVGITVNFAPDVDVSSQPDDSVIG-DRSFSDDPEVVTRYADAYARGMRD 231 >gi|172057233|ref|YP_001813693.1| Beta-N-acetylhexosaminidase [Exiguobacterium sibiricum 255-15] gi|171989754|gb|ACB60676.1| Beta-N-acetylhexosaminidase [Exiguobacterium sibiricum 255-15] Length = 412 Score = 64.8 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + G N++F+PVLD+ P I S P + + K Sbjct: 168 LGSISRFYGFNMDFAPVLDVNSNPANPIIG-DRALSADPQQVARLGVPLMQGMKK 221 >gi|150389116|ref|YP_001319165.1| glycoside hydrolase family 3 protein [Alkaliphilus metalliredigens QYMF] gi|149948978|gb|ABR47506.1| glycoside hydrolase, family 3 domain protein [Alkaliphilus metalliredigens QYMF] Length = 434 Score = 64.4 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L++ G N+N +PV D+ + + FS P + A +R Sbjct: 184 LGRELLSLGFNMNLAPVADVNTNAKNPVIG-DRSFSDNPQEVGIMASEMARGLQN 237 >gi|319900132|ref|YP_004159860.1| glycoside hydrolase family 3 domain protein [Bacteroides helcogenes P 36-108] gi|319415163|gb|ADV42274.1| glycoside hydrolase family 3 domain protein [Bacteroides helcogenes P 36-108] Length = 1000 Score = 64.4 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA+ GI VNF+PV D+ P+ + F P + +S+ Sbjct: 165 MARQCHELGIQVNFAPVADVNINPQNPVINT-RSFGENPVNVAKKVIAYSKGLED 218 >gi|256374428|ref|YP_003098088.1| glycoside hydrolase family 3 domain protein [Actinosynnema mirum DSM 43827] gi|255918731|gb|ACU34242.1| glycoside hydrolase family 3 domain protein [Actinosynnema mirum DSM 43827] Length = 580 Score = 64.4 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L GI NF+P D+ P + FS P A R Y + Sbjct: 167 ARELRALGITQNFAPDADVNSNPANPVIGV-RSFSSDPDLAATMVAAQVRGYQQ 219 >gi|206603689|gb|EDZ40169.1| Beta-N-acetylhexosaminidase [Leptospirillum sp. Group II '5-way CG'] Length = 342 Score = 64.4 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + L +GI+++F+PVLD+ P+ + FSR P + + FS Sbjct: 111 LGTALRQTGIDIDFAPVLDVDSNPDNPVIG-DRSFSREPWEVARLSMAFSHGL 162 >gi|294776422|ref|ZP_06741900.1| beta-lactamase [Bacteroides vulgatus PC510] gi|294449748|gb|EFG18270.1| beta-lactamase [Bacteroides vulgatus PC510] Length = 975 Score = 64.4 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G+ +NF+PV D+ P + F P + ++R Sbjct: 138 ARQCKEIGVQINFAPVADVDVNPRNPVINT-RSFGGDPRNVAQKVVAYARGLED 190 >gi|254882247|ref|ZP_05254957.1| glycoside hydrolase family beta-glycosidase [Bacteroides sp. 4_3_47FAA] gi|319643191|ref|ZP_07997819.1| glycoside hydrolase family 3 [Bacteroides sp. 3_1_40A] gi|254835040|gb|EET15349.1| glycoside hydrolase family beta-glycosidase [Bacteroides sp. 4_3_47FAA] gi|317385095|gb|EFV66046.1| glycoside hydrolase family 3 [Bacteroides sp. 3_1_40A] Length = 992 Score = 64.4 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G+ +NF+PV D+ P + F P + ++R Sbjct: 155 ARQCKEIGVQINFAPVADVDVNPRNPVINT-RSFGGDPRNVAQKVVAYARGLED 207 >gi|237712589|ref|ZP_04543070.1| glycoside hydrolase family 3 protein [Bacteroides sp. 9_1_42FAA] gi|229453910|gb|EEO59631.1| glycoside hydrolase family 3 protein [Bacteroides sp. 9_1_42FAA] Length = 992 Score = 64.4 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G+ +NF+PV D+ P + F P + ++R Sbjct: 155 ARQCKEIGVQINFAPVADVDVNPRNPVINT-RSFGGDPRNVAQKVVAYARGLED 207 >gi|237726899|ref|ZP_04557380.1| glycoside hydrolase family beta-glycosidase [Bacteroides sp. D4] gi|265752268|ref|ZP_06088061.1| glycoside hydrolase family beta-glycosidase [Bacteroides sp. 3_1_33FAA] gi|229435425|gb|EEO45502.1| glycoside hydrolase family beta-glycosidase [Bacteroides dorei 5_1_36/D4] gi|263237060|gb|EEZ22530.1| glycoside hydrolase family beta-glycosidase [Bacteroides sp. 3_1_33FAA] Length = 992 Score = 64.4 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G+ +NF+PV D+ P + F P + ++R Sbjct: 155 ARQCKEIGVQINFAPVADVDVNPRNPVINT-RSFGGDPRNVAQKVVAYARGLED 207 >gi|212690927|ref|ZP_03299055.1| hypothetical protein BACDOR_00415 [Bacteroides dorei DSM 17855] gi|212666159|gb|EEB26731.1| hypothetical protein BACDOR_00415 [Bacteroides dorei DSM 17855] Length = 975 Score = 64.4 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G+ +NF+PV D+ P + F P + ++R Sbjct: 138 ARQCKEIGVQINFAPVADVDVNPRNPVINT-RSFGGDPRNVAQKVVAYARGLED 190 >gi|150002751|ref|YP_001297495.1| glycoside hydrolase family beta-glycosidase [Bacteroides vulgatus ATCC 8482] gi|149931175|gb|ABR37873.1| glycoside hydrolase family 3, candidate beta-glycosidase [Bacteroides vulgatus ATCC 8482] Length = 992 Score = 64.4 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G+ +NF+PV D+ P + F P + ++R Sbjct: 155 ARQCKEIGVQINFAPVADVDVNPRNPVINT-RSFGGDPRNVAQKVVAYARGLED 207 >gi|224026833|ref|ZP_03645199.1| hypothetical protein BACCOPRO_03590 [Bacteroides coprophilus DSM 18228] gi|224020069|gb|EEF78067.1| hypothetical protein BACCOPRO_03590 [Bacteroides coprophilus DSM 18228] Length = 988 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G++VNF+PV D+ P+ + F +P +S+ Sbjct: 152 ARQLKLIGVHVNFAPVADIDNNPDNPVINT-RSFGSVPENVAHKVIAYSKGLED 204 >gi|159123782|gb|EDP48901.1| beta-N-acetylglucosaminidase, putative [Aspergillus fumigatus A1163] Length = 931 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L T P + + F + Y K Sbjct: 127 AQELKAVGVNWILGPVLDVLTNVRTQPLGV-RTTGDDPQEVSQYGVEFMKGYKK 179 >gi|146324731|ref|XP_747213.2| beta-N-acetylglucosaminidase [Aspergillus fumigatus Af293] gi|129556126|gb|EAL85175.2| beta-N-acetylglucosaminidase, putative [Aspergillus fumigatus Af293] Length = 931 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L T P + + F + Y K Sbjct: 127 AQELKAVGVNWILGPVLDVLTNVRTQPLGV-RTTGDDPQEVSQYGVEFMKGYKK 179 >gi|119484098|ref|XP_001261952.1| beta-N-acetylglucosaminidase, putative [Neosartorya fischeri NRRL 181] gi|119410108|gb|EAW20055.1| beta-N-acetylglucosaminidase, putative [Neosartorya fischeri NRRL 181] Length = 931 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L T P + + F + Y K Sbjct: 127 AQELKAVGVNWILGPVLDVLTNVRTQPLGV-RTTGDDPQEVSQYGVEFMKGYKK 179 >gi|312130178|ref|YP_003997518.1| glycoside hydrolase family 3 domain protein [Leadbetterella byssophila DSM 17132] gi|311906724|gb|ADQ17165.1| glycoside hydrolase family 3 domain protein [Leadbetterella byssophila DSM 17132] Length = 1067 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 K GI+VN++PV+D+ P+ + F A + + Sbjct: 147 GKQSKRMGIHVNYAPVVDINNNPKNPVINF-RSFGEDKWTVANKALAYMKGMQ 198 >gi|146302546|ref|YP_001197137.1| glycoside hydrolase family 3 protein [Flavobacterium johnsoniae UW101] gi|146156964|gb|ABQ07818.1| Candidate beta-glycosidase; Glycoside hydrolase family 3 [Flavobacterium johnsoniae UW101] Length = 997 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA G++ NF+PVLD+ P+ I F E A N Sbjct: 177 MANENKRIGVHFNFAPVLDINTNPKNPIIG-NRSFGEDKVNVSEKAIALMNGIQGN 231 >gi|87125211|ref|ZP_01081057.1| putative beta-glucosidase [Synechococcus sp. RS9917] gi|86166980|gb|EAQ68241.1| putative beta-glucosidase [Synechococcus sp. RS9917] Length = 552 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 15/53 (28%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G+N PV D+ P + + PA F R Sbjct: 128 GRQARRCGLNWVLGPVADVNNNPANPVINV-RAWGDTPATVIALTCAFQRGLQ 179 >gi|332664339|ref|YP_004447127.1| beta-N-acetylhexosaminidase [Haliscomenobacter hydrossis DSM 1100] gi|332333153|gb|AEE50254.1| Beta-N-acetylhexosaminidase [Haliscomenobacter hydrossis DSM 1100] Length = 991 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ G+NVNF+PV D+ + F A + + N Sbjct: 153 IARQGKRIGLNVNFAPVADINSNARNPVIG-YRSFGEDRYNVTVKAYHYMKGMQDN 207 >gi|189464225|ref|ZP_03013010.1| hypothetical protein BACINT_00562 [Bacteroides intestinalis DSM 17393] gi|189438015|gb|EDV07000.1| hypothetical protein BACINT_00562 [Bacteroides intestinalis DSM 17393] Length = 1051 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA+ G+ VNF+PV D+ P+ + F PA + ++R + Sbjct: 167 MARQCRELGVQVNFAPVADVNINPKNPVINT-RSFGESPANVADKVIAYARGLEE 220 >gi|154494473|ref|ZP_02033793.1| hypothetical protein PARMER_03828 [Parabacteroides merdae ATCC 43184] gi|154085917|gb|EDN84962.1| hypothetical protein PARMER_03828 [Parabacteroides merdae ATCC 43184] Length = 993 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ GI++NF+P +D+ + + F P + ++R Sbjct: 151 ARQCKEMGIHINFAPDMDVNSNTDNPVIGL-RSFGENPEAVADKGLAYARGL 201 >gi|320333474|ref|YP_004170185.1| glycoside hydrolase family 3 domain-containing protein [Deinococcus maricopensis DSM 21211] gi|319754763|gb|ADV66520.1| glycoside hydrolase family 3 domain protein [Deinococcus maricopensis DSM 21211] Length = 496 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ L+ GIN NF+P LD+ P + F P + +++ Sbjct: 104 ARGLLDLGINWNFAPALDVNVNPLNPVIG-ERSFGADPHEVARLGVAWAQGL 154 >gi|159037380|ref|YP_001536633.1| glycoside hydrolase family 3 protein [Salinispora arenicola CNS-205] gi|157916215|gb|ABV97642.1| glycoside hydrolase family 3 domain protein [Salinispora arenicola CNS-205] Length = 499 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L GI +N++P D+ P+ + F PA+ + R Sbjct: 111 LGAELAALGITLNYAPDADVNSDPDNPVIGV-RSFGADPARVARHTAAWVRGLQ 163 >gi|67922612|ref|ZP_00516118.1| Glycoside hydrolase, family 3, N-terminal [Crocosphaera watsonii WH 8501] gi|67855540|gb|EAM50793.1| Glycoside hydrolase, family 3, N-terminal [Crocosphaera watsonii WH 8501] Length = 476 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A+ + GIN SP++D+ P+ + F+ P E A+ F P Sbjct: 69 AQEALAMGINWILSPIVDVNNNPDNPVINI-RSFADSPKVVSELAKAFIAGSKNYP 123 >gi|220906275|ref|YP_002481586.1| Beta-N-acetylhexosaminidase [Cyanothece sp. PCC 7425] gi|219862886|gb|ACL43225.1| Beta-N-acetylhexosaminidase [Cyanothece sp. PCC 7425] Length = 552 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A + G+N +PV+D+ P+ + F + + F +P Sbjct: 132 AAEALAIGLNWVLAPVVDVNNNPDNPVINV-RAFGENTGEVSQLTTAFIEGAQTHP 186 >gi|240168462|ref|ZP_04747121.1| lipoprotein LpqI [Mycobacterium kansasii ATCC 12478] Length = 391 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + T GI V+F+PV+D+ P+ + F P K A +++ Sbjct: 166 GRQMRTLGITVDFAPVVDVTDAPDDTVIG-DRSFGSDPDKVTAYAGAYAQGLRD 218 >gi|218263350|ref|ZP_03477488.1| hypothetical protein PRABACTJOHN_03173 [Parabacteroides johnsonii DSM 18315] gi|218222797|gb|EEC95447.1| hypothetical protein PRABACTJOHN_03173 [Parabacteroides johnsonii DSM 18315] Length = 994 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ GI++NF+P +D+ + + F P + ++R Sbjct: 151 ARQCKEMGIHINFAPDMDVNSNTDNPVIGL-RSFGENPQAVADKGLAYARGL 201 >gi|304407924|ref|ZP_07389574.1| glycoside hydrolase family 3 domain protein [Paenibacillus curdlanolyticus YK9] gi|304342943|gb|EFM08787.1| glycoside hydrolase family 3 domain protein [Paenibacillus curdlanolyticus YK9] Length = 515 Score = 64.4 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L+ G+ +N++PVLD+ + + P + F R + Sbjct: 120 IGSQLIELGVPMNWAPVLDVNTNIANPVVGI-RAYGESPEQVASFGAAFIRGLHE 173 >gi|302656942|ref|XP_003020206.1| beta-glucosidase [Trichophyton verrucosum HKI 0517] gi|291184014|gb|EFE39588.1| beta-glucosidase [Trichophyton verrucosum HKI 0517] Length = 855 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN+N++PV D+ P + A A F++ + Sbjct: 119 GEMLDALGINMNYAPVCDVNSEPSNPVIGI-RSPGDDGASVGRIASAFAKGLRE 171 >gi|262383827|ref|ZP_06076963.1| glycoside hydrolase family beta-glycosidase [Bacteroides sp. 2_1_33B] gi|262294725|gb|EEY82657.1| glycoside hydrolase family beta-glycosidase [Bacteroides sp. 2_1_33B] Length = 993 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + GI++NF+P +D+ + + F P E ++R Sbjct: 145 GRQCREMGIHINFAPDMDVNSNVDNPVIGL-RSFGENPEAVAEKGIAYARGL 195 >gi|325281835|ref|YP_004254377.1| Beta-N-acetylhexosaminidase [Odoribacter splanchnicus DSM 20712] gi|324313644|gb|ADY34197.1| Beta-N-acetylhexosaminidase [Odoribacter splanchnicus DSM 20712] Length = 1001 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 +A++ G++VNF+PV+D+ P I F P + + A L++ Sbjct: 143 IARHCQELGVHVNFAPVVDINSNPRNPIIGM-RSFGEDPEEVTQKAILYA 191 >gi|166363718|ref|YP_001655991.1| putative beta-glucosidase [Microcystis aeruginosa NIES-843] gi|166086091|dbj|BAG00799.1| putative beta-glucosidase [Microcystis aeruginosa NIES-843] Length = 526 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 AK + GIN +P++D+ P+ + F+ P AQ F Sbjct: 128 AKEALAIGINWILAPIVDVNNNPDNPVINI-RSFAETPEIVANLAQAFI 175 >gi|224537509|ref|ZP_03678048.1| hypothetical protein BACCELL_02388 [Bacteroides cellulosilyticus DSM 14838] gi|224520888|gb|EEF89993.1| hypothetical protein BACCELL_02388 [Bacteroides cellulosilyticus DSM 14838] Length = 1046 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA+ G+ VNF+PV D+ P+ + F P + ++R Sbjct: 165 MARQCRELGVQVNFAPVADVNINPKNPVINT-RSFGESPVNVADKVIAYARGLED 218 >gi|182677858|ref|YP_001832004.1| glycoside hydrolase family 3 protein [Beijerinckia indica subsp. indica ATCC 9039] gi|182633741|gb|ACB94515.1| glycoside hydrolase family 3 domain protein [Beijerinckia indica subsp. indica ATCC 9039] Length = 370 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M L + GIN+NF+PVLD+ P + F+ P A F R Sbjct: 118 MGCELASLGINLNFAPVLDIHTNPANPVIG-ERAFATTPEAVTPLALGFLRAMQ 170 >gi|328884947|emb|CCA58186.1| Beta-hexosaminidase [Streptomyces venezuelae ATCC 10712] Length = 507 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+++N++P D+ E + F P + Sbjct: 114 LGRRLAACGVDLNWAPSADVNSNAENPVIGV-RSFGADPDLVARHTVAYVDGLQ 166 >gi|225012970|ref|ZP_03703387.1| glycoside hydrolase family 3 domain protein [Flavobacteria bacterium MS024-2A] gi|225002869|gb|EEG40848.1| glycoside hydrolase family 3 domain protein [Flavobacteria bacterium MS024-2A] Length = 969 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M + GI +FSPVLD+ I + + A + + Sbjct: 151 MGEQEKRLGIQYSFSPVLDINTNANNPIIG-NRSYGSSNERVSRQALAIMQGHHD 204 >gi|290960208|ref|YP_003491390.1| sugar hydrolase [Streptomyces scabiei 87.22] gi|260649734|emb|CBG72850.1| putative sugar hydrolase [Streptomyces scabiei 87.22] Length = 600 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G+ +++PV D+ P + F P + + Y + Sbjct: 172 GAELRALGVRQDYAPVADVNVNPANPVIGV-RSFGADPKAVSKLVAAQVKGYQE 224 >gi|115490953|ref|XP_001210104.1| conserved hypothetical protein [Aspergillus terreus NIH2624] gi|114196964|gb|EAU38664.1| conserved hypothetical protein [Aspergillus terreus NIH2624] Length = 907 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L + P + + F + Y + Sbjct: 103 AQELKAVGVNWILGPVLDVLTNVRSQPLGV-RTTGDDPQEVSQYGVEFMKGYRE 155 >gi|332885930|gb|EGK06174.1| hypothetical protein HMPREF9456_00048 [Dysgonomonas mossii DSM 22836] Length = 1015 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+ VNF+P LD+ P + F P + + ++S+ Sbjct: 156 ARQCRQIGVQVNFAPALDVNSNPNNPVIG-NRSFGEDPDRVAQLGVMYSKGL 206 >gi|221133969|ref|ZP_03560274.1| Beta-hexosaminidase A precursor [Glaciecola sp. HTCC2999] Length = 599 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++L + GINVNF+P +D+ P + F E + Sbjct: 143 IGRDLASVGINVNFAPSIDVNANPSNPVINV-RSFGESAEMVSELGGALVQHMQ 195 >gi|327405500|ref|YP_004346338.1| beta-N-acetylhexosaminidase [Fluviicola taffensis DSM 16823] gi|327321008|gb|AEA45500.1| Beta-N-acetylhexosaminidase [Fluviicola taffensis DSM 16823] Length = 985 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M GI++NFSPV D+ P+ + F P + + + Sbjct: 164 MGVECDMLGIHMNFSPVADVNLNPKNPVIGF-RAFGSNPQQVAKHTAAMVKGIED 217 >gi|239941373|ref|ZP_04693310.1| putative beta-N-acetylglucosaminidase [Streptomyces roseosporus NRRL 15998] gi|239987834|ref|ZP_04708498.1| putative beta-N-acetylglucosaminidase [Streptomyces roseosporus NRRL 11379] gi|291444816|ref|ZP_06584206.1| beta-N-acetylglucosaminidase [Streptomyces roseosporus NRRL 15998] gi|291347763|gb|EFE74667.1| beta-N-acetylglucosaminidase [Streptomyces roseosporus NRRL 15998] Length = 610 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GIN N++P D+ P + F P + + Y Sbjct: 182 GTELAALGINQNYAPDADVNVNPANPVIGV-RSFGSDPDAVADLVAAQVKGYQ 233 >gi|215409727|ref|ZP_03418535.1| putative lipoprotein LpqI [Mycobacterium tuberculosis 94_M4241A] gi|298523705|ref|ZP_07011114.1| lipoprotein lpqI [Mycobacterium tuberculosis 94_M4241A] gi|298493499|gb|EFI28793.1| lipoprotein lpqI [Mycobacterium tuberculosis 94_M4241A] Length = 378 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI ++F+PV+D+ P+ + F PA A +++ Sbjct: 163 GRQMRKLGITIDFAPVVDVTDAPDDTVIG-DRSFGSDPATVTAYAGAYAQGLRD 215 >gi|257389213|ref|YP_003178986.1| glycoside hydrolase [Halomicrobium mukohataei DSM 12286] gi|257171520|gb|ACV49279.1| glycoside hydrolase family 3 domain protein [Halomicrobium mukohataei DSM 12286] Length = 528 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L + G+N + +PVLD+ P+ + F P + + Sbjct: 120 GAELASIGVNFDLTPVLDVNNNPDNPVIGV-RSFGEEPELVGDLGAAMADGMQ 171 >gi|329956818|ref|ZP_08297387.1| beta-lactamase [Bacteroides clarus YIT 12056] gi|328523857|gb|EGF50944.1| beta-lactamase [Bacteroides clarus YIT 12056] Length = 1012 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA+ G+ VNF+PV D+ P+ + F P + +++ Sbjct: 165 MARQCRELGVQVNFAPVADVNINPKNPVINT-RSFGESPVNVADKVTAYAKGLED 218 >gi|298375829|ref|ZP_06985785.1| glycosyl hydrolase, family 3 [Bacteroides sp. 3_1_19] gi|298266866|gb|EFI08523.1| glycosyl hydrolase, family 3 [Bacteroides sp. 3_1_19] Length = 1000 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + GI++NF+P +D+ + + F P E ++R Sbjct: 152 GRQCREMGIHINFAPDMDVNSNVDNPVIGL-RSFGENPEAVAEKGIAYARGL 202 >gi|23097725|ref|NP_691191.1| beta-hexosaminidase [Oceanobacillus iheyensis HTE831] gi|22775949|dbj|BAC12226.1| beta-hexosaminidase [Oceanobacillus iheyensis HTE831] Length = 424 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G N+NF+PVLD+ P+ + F P + + Sbjct: 160 LGQQMRGLGFNLNFAPVLDVNSNPDNPVIG-DRSFGDSPDIVTDMGIQSMKGIQ 212 >gi|126663658|ref|ZP_01734654.1| b-glycosidase, glycoside hydrolase family 3 protein [Flavobacteria bacterium BAL38] gi|126624241|gb|EAZ94933.1| b-glycosidase, glycoside hydrolase family 3 protein [Flavobacteria bacterium BAL38] Length = 971 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MAK GI+ NF+PV+D+ P+ I F A + Sbjct: 150 MAKQSKRMGIHFNFAPVVDINTNPKNPIIG-NRSFGETKDNVTVRALALMKGLQD 203 >gi|160879274|ref|YP_001558242.1| glycoside hydrolase family 3 protein [Clostridium phytofermentans ISDg] gi|160427940|gb|ABX41503.1| glycoside hydrolase family 3 domain protein [Clostridium phytofermentans ISDg] Length = 517 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L T G N + +PV D+ + + + P + + + Sbjct: 114 GQQLRTLGFNFDLAPVADINSNMDNPVIGV-RSYGDEPDQVAKYCVAMMKGLTD 166 >gi|254366684|ref|ZP_04982728.1| lipoprotein lpqI [Mycobacterium tuberculosis str. Haarlem] gi|134152196|gb|EBA44241.1| lipoprotein lpqI [Mycobacterium tuberculosis str. Haarlem] Length = 396 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI ++F+PV+D+ P+ + F PA A +++ Sbjct: 171 GRQMRKLGITIDFAPVVDVTDAPDDTVIG-DRSFGSDPATVTAYAGAYAQGLRD 223 >gi|315186989|gb|EFU20746.1| glycoside hydrolase family 3 domain protein [Spirochaeta thermophila DSM 6578] Length = 559 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L GI +NF+P +D+ PE + F P A F + Sbjct: 151 IGKELRALGITMNFAPTVDVYVNPEAHVIGP-RSFGSDPRLVATLALSFYHGSLD 204 >gi|307718450|ref|YP_003873982.1| hypothetical protein STHERM_c07580 [Spirochaeta thermophila DSM 6192] gi|306532175|gb|ADN01709.1| hypothetical protein STHERM_c07580 [Spirochaeta thermophila DSM 6192] Length = 560 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L GI +NF+P +D+ PE + F P A F + Sbjct: 152 IGKELRALGITMNFAPTVDVYVNPEAHVIGP-RSFGSDPRLVATLALSFYHGSLD 205 >gi|254388994|ref|ZP_05004225.1| sugar hydrolase [Streptomyces clavuligerus ATCC 27064] gi|294814930|ref|ZP_06773573.1| Putative sugar hydrolase [Streptomyces clavuligerus ATCC 27064] gi|326443301|ref|ZP_08218035.1| putative sugar hydrolase [Streptomyces clavuligerus ATCC 27064] gi|197702712|gb|EDY48524.1| sugar hydrolase [Streptomyces clavuligerus ATCC 27064] gi|294327529|gb|EFG09172.1| Putative sugar hydrolase [Streptomyces clavuligerus ATCC 27064] Length = 513 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+N+N++P D+ P+ + F + Sbjct: 115 LGRMLADCGVNLNWAPTADVNANPDNPVIGV-RSFGDDARLVTRHTLAYVEGMQ 167 >gi|159030295|emb|CAO91190.1| unnamed protein product [Microcystis aeruginosa PCC 7806] Length = 526 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 AK + GIN +P++D+ P+ + F+ P AQ F Sbjct: 128 AKEALAIGINWILAPIVDVNNNPDNPVINI-RSFAETPEIVANLAQAFI 175 >gi|319954620|ref|YP_004165887.1| beta-n-acetylhexosaminidase [Cellulophaga algicola DSM 14237] gi|319423280|gb|ADV50389.1| Beta-N-acetylhexosaminidase [Cellulophaga algicola DSM 14237] Length = 969 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + K+ G+++NF+P +D+ P+ I F + F + Sbjct: 148 IGKHAKRLGVHINFAPDIDINTNPKNPIIG-NRSFGENRENVTRNGIAFMKGM 199 >gi|297564760|ref|YP_003683732.1| Beta-N-acetylhexosaminidase [Meiothermus silvanus DSM 9946] gi|296849209|gb|ADH62224.1| Beta-N-acetylhexosaminidase [Meiothermus silvanus DSM 9946] Length = 511 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + L++ GIN +++PVLD+ P + F PAK E ++R Sbjct: 107 GRGLISLGINWDYAPVLDVNTDPRNPVIG-DRSFGSDPAKVAELGLSWARGL 157 >gi|326476101|gb|EGE00111.1| hypothetical protein TESG_07433 [Trichophyton tonsurans CBS 112818] Length = 853 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN+N++PV D+ P + A F++ + Sbjct: 119 GELLDALGINMNYAPVCDVNSEPSNPVIGV-RSPGDDGVTVGRIASAFAKGLRE 171 >gi|119358267|ref|YP_912911.1| glycoside hydrolase family 3 protein [Chlorobium phaeobacteroides DSM 266] gi|119355616|gb|ABL66487.1| glycoside hydrolase, family 3 domain protein [Chlorobium phaeobacteroides DSM 266] Length = 589 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +AK GI+ N++P +DL P I FS PA A + N Sbjct: 169 IAKEARIVGIHQNYAPTVDLNINPANPIINT-RSFSDNPALAIAMSNAVIEGLQSN 223 >gi|145233039|ref|XP_001399892.1| beta-N-acetylglucosaminidase [Aspergillus niger CBS 513.88] gi|134056816|emb|CAK37722.1| unnamed protein product [Aspergillus niger] Length = 859 Score = 63.6 bits (154), Expect = 7e-09, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L SGIN+N++PV D+ P + F P A ++ ++ Sbjct: 117 GEILSASGINMNYAPVCDINSEPLNPVIGV-RSFGDNPEFVARFASASAQGLREH 170 >gi|229819897|ref|YP_002881423.1| glycoside hydrolase family 3 domain protein [Beutenbergia cavernae DSM 12333] gi|229565810|gb|ACQ79661.1| glycoside hydrolase family 3 domain protein [Beutenbergia cavernae DSM 12333] Length = 530 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L +G++V+ +PV D+ P + F PA + Sbjct: 123 IAGELREAGVDVDLAPVADVNVDPRNPVIGT-RSFGADPALVARHTAAYVAGLQ 175 >gi|218438839|ref|YP_002377168.1| glycoside hydrolase [Cyanothece sp. PCC 7424] gi|218171567|gb|ACK70300.1| glycoside hydrolase family 3 domain protein [Cyanothece sp. PCC 7424] Length = 537 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A ++ GIN +P++D+ P+ + F P E A F P Sbjct: 128 AVEALSIGINWILAPIVDININPDNPVINV-RSFGDNPQLVTELATAFIGGANNYP 182 >gi|119717607|ref|YP_924572.1| glycoside hydrolase family 3 protein [Nocardioides sp. JS614] gi|119538268|gb|ABL82885.1| beta-N-acetylhexosaminidase [Nocardioides sp. JS614] Length = 631 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L G+ +++PV D+ P + PA + R + Sbjct: 204 IGAELAAVGVTQDYAPVADVNVNPNNPVIGI-RSIGSDPALVSDLVAAQVRGFH 256 >gi|123474548|ref|XP_001320456.1| glycosyl hydrolase [Trichomonas vaginalis G3] gi|121903262|gb|EAY08233.1| Glycosyl hydrolase family 3 N terminal domain containing protein [Trichomonas vaginalis G3] Length = 515 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK L++ GIN+N +PV D+ + F P K + + K Sbjct: 121 AKVLLSLGINMNLAPVCDINDNSRNPVIGA-RSFGFDPQKISNYIKAHINGHKK 173 >gi|254431036|ref|ZP_05044739.1| beta-glucosidase [Cyanobium sp. PCC 7001] gi|197625489|gb|EDY38048.1| beta-glucosidase [Cyanobium sp. PCC 7001] Length = 551 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 ++ G+N +PV D+ + + PA F R Sbjct: 127 GRDARRLGLNWVLAPVCDVNNNAANPVINV-RAWGEDPATVAALTTAFCRGL 177 >gi|163788344|ref|ZP_02182790.1| b-glycosidase, glycoside hydrolase family 3 protein [Flavobacteriales bacterium ALC-1] gi|159876664|gb|EDP70722.1| b-glycosidase, glycoside hydrolase family 3 protein [Flavobacteriales bacterium ALC-1] Length = 972 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M ++ G++ NF+PV+D+ P+ I F + + Sbjct: 150 MGEHCKRLGVHFNFAPVVDINTNPKNPIIG-NRSFGEDRDNVTNKSLALMKGMQ 202 >gi|255534378|ref|YP_003094749.1| glycoside hydrolase [Flavobacteriaceae bacterium 3519-10] gi|255340574|gb|ACU06687.1| glycoside hydrolase [Flavobacteriaceae bacterium 3519-10] Length = 523 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A++ G+N +F+PV+D+ P+ I F + SA +S +N Sbjct: 97 IAEDCQRMGVNWDFAPVVDVNTNPQNPIIG-NRSFGSEVSNVVGSAMAYSNGLQQN 151 >gi|225010771|ref|ZP_03701240.1| glycoside hydrolase family 3 domain protein [Flavobacteria bacterium MS024-3C] gi|225005142|gb|EEG43095.1| glycoside hydrolase family 3 domain protein [Flavobacteria bacterium MS024-3C] Length = 558 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M G+++NF+PV+D+ P I F + A S+ Sbjct: 150 MGMQAKRLGVHMNFAPVVDVNINPNNPIIG-NRSFGSDVRRVSARALALSQGMN 202 >gi|169343145|ref|ZP_02864170.1| putative beta-N-acetylhexosaminidase [Clostridium perfringens C str. JGS1495] gi|169298783|gb|EDS80858.1| putative beta-N-acetylhexosaminidase [Clostridium perfringens C str. JGS1495] Length = 845 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L G+NV+F+PVLD PE + S P + + ++ Sbjct: 165 IGKELNALGVNVDFAPVLDTNNNPENPVIGV-RSISSNPELVGKLGKNIAKGIQD 218 >gi|110798758|ref|YP_694721.1| putative beta-N-acetylhexosaminidase [Clostridium perfringens ATCC 13124] gi|168214114|ref|ZP_02639739.1| putative beta-N-acetylhexosaminidase [Clostridium perfringens CPE str. F4969] gi|110673405|gb|ABG82392.1| putative beta-N-acetylhexosaminidase [Clostridium perfringens ATCC 13124] gi|170714401|gb|EDT26583.1| putative beta-N-acetylhexosaminidase [Clostridium perfringens CPE str. F4969] Length = 845 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L G+NV+F+PVLD PE + S P + + ++ Sbjct: 165 IGKELNALGVNVDFAPVLDTNNNPENPVIGV-RSISSNPELVGKLGKNIAKGIQD 218 >gi|313679320|ref|YP_004057059.1| glycoside hydrolase family 3 domain protein [Oceanithermus profundus DSM 14977] gi|313152035|gb|ADR35886.1| glycoside hydrolase family 3 domain protein [Oceanithermus profundus DSM 14977] Length = 492 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G N+NF+PVLDL P + F P +A E A + +++ Sbjct: 103 ARGLAAYGFNLNFAPVLDLNTNPANPVI-AERSFGADPERASELALAWHEGHVQ 155 >gi|265765224|ref|ZP_06093499.1| beta-N-acetylglucosaminidase [Bacteroides sp. 2_1_16] gi|263254608|gb|EEZ26042.1| beta-N-acetylglucosaminidase [Bacteroides sp. 2_1_16] Length = 1017 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA+ G+ VNF+PV D+ P+ + F P K + ++ Sbjct: 174 MARQCREMGVQVNFAPVADVNINPDNPVINT-RSFGEDPVKVADKVIAYASGL 225 >gi|60680086|ref|YP_210230.1| putative hydrolase/beta lactamase fusion protein [Bacteroides fragilis NCTC 9343] gi|60491520|emb|CAH06272.1| putative hydrolase/beta lactamase fusion protein [Bacteroides fragilis NCTC 9343] Length = 1027 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA+ G+ VNF+PV D+ P+ + F P K + ++ Sbjct: 184 MARQCREMGVQVNFAPVADVNINPDNPVINT-RSFGEDPVKVADKVIAYASGL 235 >gi|53711858|ref|YP_097850.1| beta-N-acetylglucosaminidase [Bacteroides fragilis YCH46] gi|52214723|dbj|BAD47316.1| beta-N-acetylglucosaminidase [Bacteroides fragilis YCH46] Length = 1017 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA+ G+ VNF+PV D+ P+ + F P K + ++ Sbjct: 174 MARQCREMGVQVNFAPVADVNINPDNPVINT-RSFGEDPVKVADKVIAYASGL 225 >gi|282865964|ref|ZP_06275013.1| glycoside hydrolase family 3 domain protein [Streptomyces sp. ACTE] gi|282559288|gb|EFB64841.1| glycoside hydrolase family 3 domain protein [Streptomyces sp. ACTE] Length = 608 Score = 63.6 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GIN N++P D+ P + F P + Y Sbjct: 180 GAELAALGINQNYAPDADVNVNPANPVIGV-RSFGSDPQSVAGLVTAQVKGYQ 231 >gi|121705828|ref|XP_001271177.1| beta-N-acetylglucosaminidase, putative [Aspergillus clavatus NRRL 1] gi|119399323|gb|EAW09751.1| beta-N-acetylglucosaminidase, putative [Aspergillus clavatus NRRL 1] Length = 853 Score = 63.6 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN+N++PV D+ P + P A ++ + Sbjct: 117 GETLRFFGINMNYAPVCDINSEPLNPVIGV-RSPGDDPEFVGRFASATAQGLRE 169 >gi|329939700|ref|ZP_08289001.1| sugar hydrolase [Streptomyces griseoaurantiacus M045] gi|329301270|gb|EGG45165.1| sugar hydrolase [Streptomyces griseoaurantiacus M045] Length = 501 Score = 63.6 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+N+N++P D+ P + F P + Sbjct: 114 LGRRLAACGVNLNWAPSADVNSNPANPVIGV-RSFGAEPELVARHTAAYVGGLQ 166 >gi|326203214|ref|ZP_08193079.1| glycoside hydrolase family 3 domain protein [Clostridium papyrosolvens DSM 2782] gi|325986472|gb|EGD47303.1| glycoside hydrolase family 3 domain protein [Clostridium papyrosolvens DSM 2782] Length = 448 Score = 63.6 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L + G+N++F+PVLD+ P+ I F P + + Sbjct: 206 IGEELKSFGMNMDFAPVLDINSNPKNPIIG-DRAFGTGPNLVSKLGVQTMKGLQ 258 >gi|315503130|ref|YP_004082017.1| glycoside hydrolase family 3 domain protein [Micromonospora sp. L5] gi|315409749|gb|ADU07866.1| glycoside hydrolase family 3 domain protein [Micromonospora sp. L5] Length = 499 Score = 63.6 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L G+ ++++P D+ P + F P + R Sbjct: 115 LGAELAAVGVTLDYAPDADVNSNPANPVIGV-RSFGADPDLVARHTAAWVRGLQ 167 >gi|256396819|ref|YP_003118383.1| glycoside hydrolase family 3 domain-containing protein [Catenulispora acidiphila DSM 44928] gi|256363045|gb|ACU76542.1| glycoside hydrolase family 3 domain protein [Catenulispora acidiphila DSM 44928] Length = 594 Score = 63.6 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++L +GIN+N++P DL P+ + F P A + + R Sbjct: 113 IGRSLWRAGINLNYAPDADLNTNPDNPVIGT-RSFGSDPVVAARHSAAYVRGLQ 165 >gi|168206632|ref|ZP_02632637.1| putative beta-N-acetylhexosaminidase [Clostridium perfringens E str. JGS1987] gi|170662002|gb|EDT14685.1| putative beta-N-acetylhexosaminidase [Clostridium perfringens E str. JGS1987] Length = 845 Score = 63.6 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L G+NV+F+PVLD PE + S P + + ++ Sbjct: 165 IGKELNALGVNVDFAPVLDTNNNPENPVIGV-RSISSNPELVGKLGKNIAKGIQD 218 >gi|54027439|ref|YP_121681.1| putative glycosyl hydrolase [Nocardia farcinica IFM 10152] gi|54018947|dbj|BAD60317.1| putative glycosyl hydrolase [Nocardia farcinica IFM 10152] Length = 388 Score = 63.6 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GI VNF+P +D+ P+ + FS PA A+ + R + Sbjct: 166 GRALKDLGITVNFAPDVDVSAQPDDSVIG-DRSFSDDPAVVTRYAEAYIRAMRE 218 >gi|31791415|ref|NP_853908.1| lipoprotein LpqI [Mycobacterium bovis AF2122/97] gi|121636150|ref|YP_976373.1| putative lipoprotein lpqI [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|224988623|ref|YP_002643310.1| putative lipoprotein [Mycobacterium bovis BCG str. Tokyo 172] gi|31617000|emb|CAD93107.1| PROBABLE CONSERVED LIPOPROTEIN LPQI [Mycobacterium bovis AF2122/97] gi|121491797|emb|CAL70259.1| Probable conserved lipoprotein lpqI [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|224771736|dbj|BAH24542.1| putative lipoprotein [Mycobacterium bovis BCG str. Tokyo 172] Length = 388 Score = 63.6 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI ++F+PV+D+ P+ + F PA A +++ Sbjct: 163 GRQMRKLGITIDFAPVVDVTDAPDDTVIG-DRSFGSDPATVTAYAGAYAQGLRD 215 >gi|78357601|ref|YP_389050.1| Beta-N-acetylhexosaminidase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] gi|78220006|gb|ABB39355.1| Beta-N-acetylhexosaminidase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] Length = 398 Score = 63.6 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIKN 56 L G+N+NF+PV+D+ P+ + + FS AQ F + + Sbjct: 160 GAMLHAVGVNLNFAPVVDVNVRPDNPVIGRAGRSFSADSEAVARHAQAFLQGMASH 215 >gi|302866716|ref|YP_003835353.1| glycoside hydrolase family 3 domain-containing protein [Micromonospora aurantiaca ATCC 27029] gi|302569575|gb|ADL45777.1| glycoside hydrolase family 3 domain protein [Micromonospora aurantiaca ATCC 27029] Length = 499 Score = 63.6 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L G+ ++++P D+ P + F P + R Sbjct: 115 LGAELAAVGVTLDYAPDADVNSNPANPVIGV-RSFGADPDMVARHTAAWVRGLQ 167 >gi|301311982|ref|ZP_07217904.1| glycosyl hydrolase, family 3 [Bacteroides sp. 20_3] gi|300830084|gb|EFK60732.1| glycosyl hydrolase, family 3 [Bacteroides sp. 20_3] Length = 999 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + GI++NF+P +D+ + + F P E ++R Sbjct: 151 GRQCREMGIHINFAPDMDVNSNVDNPVIGL-RSFGENPEAVSEKGIAYARGL 201 >gi|242794879|ref|XP_002482466.1| beta-N-acetylglucosaminidase, putative [Talaromyces stipitatus ATCC 10500] gi|218719054|gb|EED18474.1| beta-N-acetylglucosaminidase, putative [Talaromyces stipitatus ATCC 10500] Length = 950 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L + P + + + Y + Sbjct: 127 AQELRAVGVNWILGPVLDVLTNVRSQPIGV-RTSGDDPQEVSQYGVETMKGYQE 179 >gi|212536110|ref|XP_002148211.1| beta-N-acetylglucosaminidase, putative [Penicillium marneffei ATCC 18224] gi|210070610|gb|EEA24700.1| beta-N-acetylglucosaminidase, putative [Penicillium marneffei ATCC 18224] Length = 952 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L + P + + + Y + Sbjct: 127 AQELRAVGVNWILGPVLDVLTNVRSQPIGV-RTSGDDPQEVSQYGVETMKGYQE 179 >gi|88807130|ref|ZP_01122642.1| putative beta-glucosidase [Synechococcus sp. WH 7805] gi|88788344|gb|EAR19499.1| putative beta-glucosidase [Synechococcus sp. WH 7805] Length = 542 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N +PV D+ P+ + + ++P A+ F R Sbjct: 125 ADQARRCGLNWVLAPVCDVNSNPDNPVINV-RAWGQVPEATAALAEAFQRGLQ 176 >gi|254495607|ref|ZP_05108529.1| glycosyl hydrolase [Legionella drancourtii LLAP12] gi|254355177|gb|EET13790.1| glycosyl hydrolase [Legionella drancourtii LLAP12] Length = 358 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLL-YGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA+ L G N+NF+PV+DL Y + I FS P A+ F + Sbjct: 129 MAETLKALGFNLNFAPVVDLHMYDQQGIIGALHRSFSDDPETVIRMARQFVDVFR 183 >gi|15839618|ref|NP_334655.1| putative lipoprotein [Mycobacterium tuberculosis CDC1551] gi|57116706|ref|YP_177702.1| lipoprotein LpqI [Mycobacterium tuberculosis H37Rv] gi|148660002|ref|YP_001281525.1| putative lipoprotein LpqI [Mycobacterium tuberculosis H37Ra] gi|215433159|ref|ZP_03431078.1| putative lipoprotein LpqI [Mycobacterium tuberculosis EAS054] gi|215448524|ref|ZP_03435276.1| putative lipoprotein LpqI [Mycobacterium tuberculosis T85] gi|218755978|ref|ZP_03534774.1| putative lipoprotein LpqI [Mycobacterium tuberculosis GM 1503] gi|219556035|ref|ZP_03535111.1| putative lipoprotein LpqI [Mycobacterium tuberculosis T17] gi|253797161|ref|YP_003030162.1| lipoprotein lpqI [Mycobacterium tuberculosis KZN 1435] gi|254549178|ref|ZP_05139625.1| lipoprotein lpqI [Mycobacterium tuberculosis '98-R604 INH-RIF-EM'] gi|260185102|ref|ZP_05762576.1| lipoprotein lpqI [Mycobacterium tuberculosis CPHL_A] gi|260199235|ref|ZP_05766726.1| lipoprotein lpqI [Mycobacterium tuberculosis T46] gi|260203382|ref|ZP_05770873.1| lipoprotein lpqI [Mycobacterium tuberculosis K85] gi|289441614|ref|ZP_06431358.1| lipoprotein lpqI [Mycobacterium tuberculosis T46] gi|289445770|ref|ZP_06435514.1| lipoprotein lpqI [Mycobacterium tuberculosis CPHL_A] gi|289552490|ref|ZP_06441700.1| lipoprotein lpqI [Mycobacterium tuberculosis KZN 605] gi|289568141|ref|ZP_06448368.1| lipoprotein lpqI [Mycobacterium tuberculosis T17] gi|289572816|ref|ZP_06453043.1| lipoprotein lpqI [Mycobacterium tuberculosis K85] gi|289756303|ref|ZP_06515681.1| lipoprotein [Mycobacterium tuberculosis EAS054] gi|289760343|ref|ZP_06519721.1| conserved hypothetical protein [Mycobacterium tuberculosis T85] gi|289764354|ref|ZP_06523732.1| lipoprotein lpqI [Mycobacterium tuberculosis GM 1503] gi|294994712|ref|ZP_06800403.1| lipoprotein lpqI [Mycobacterium tuberculosis 210] gi|297632718|ref|ZP_06950498.1| lipoprotein lpqI [Mycobacterium tuberculosis KZN 4207] gi|297729692|ref|ZP_06958810.1| lipoprotein lpqI [Mycobacterium tuberculosis KZN R506] gi|307082713|ref|ZP_07491826.1| lipoprotein lpqI [Mycobacterium tuberculosis SUMu012] gi|313657018|ref|ZP_07813898.1| lipoprotein lpqI [Mycobacterium tuberculosis KZN V2475] gi|7478258|pir||A70938 probable lpqI protein - Mycobacterium tuberculosis (strain H37RV) gi|13879735|gb|AAK44469.1| lipoprotein, putative [Mycobacterium tuberculosis CDC1551] gi|41352746|emb|CAE55256.1| PROBABLE CONSERVED LIPOPROTEIN LPQI [Mycobacterium tuberculosis H37Rv] gi|148504154|gb|ABQ71963.1| putative conserved lipoprotein LpqI [Mycobacterium tuberculosis H37Ra] gi|253318664|gb|ACT23267.1| lipoprotein lpqI [Mycobacterium tuberculosis KZN 1435] gi|289414533|gb|EFD11773.1| lipoprotein lpqI [Mycobacterium tuberculosis T46] gi|289418728|gb|EFD15929.1| lipoprotein lpqI [Mycobacterium tuberculosis CPHL_A] gi|289437122|gb|EFD19615.1| lipoprotein lpqI [Mycobacterium tuberculosis KZN 605] gi|289537247|gb|EFD41825.1| lipoprotein lpqI [Mycobacterium tuberculosis K85] gi|289541894|gb|EFD45543.1| lipoprotein lpqI [Mycobacterium tuberculosis T17] gi|289696890|gb|EFD64319.1| lipoprotein [Mycobacterium tuberculosis EAS054] gi|289711860|gb|EFD75876.1| lipoprotein lpqI [Mycobacterium tuberculosis GM 1503] gi|289715907|gb|EFD79919.1| conserved hypothetical protein [Mycobacterium tuberculosis T85] gi|308367584|gb|EFP56435.1| lipoprotein lpqI [Mycobacterium tuberculosis SUMu012] gi|323717228|gb|EGB26437.1| lipoprotein lpqI [Mycobacterium tuberculosis CDC1551A] gi|326905993|gb|EGE52926.1| lipoprotein lpqI [Mycobacterium tuberculosis W-148] gi|328456948|gb|AEB02371.1| lipoprotein lpqI [Mycobacterium tuberculosis KZN 4207] Length = 388 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI ++F+PV+D+ P+ + F PA A +++ Sbjct: 163 GRQMRKLGITIDFAPVVDVTDAPDDTVIG-DRSFGSDPATVTAYAGAYAQGLRD 215 >gi|303328151|ref|ZP_07358590.1| glycosyl hydrolase, family 3 [Desulfovibrio sp. 3_1_syn3] gi|302861977|gb|EFL84912.1| glycosyl hydrolase, family 3 [Desulfovibrio sp. 3_1_syn3] Length = 375 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETF-IAQKRSIFSRIPAKAEESAQLFSRTY 53 + L + GI+V+ +PV D+ P+ I + FS P E A F + Sbjct: 150 LGAELASLGISVDLAPVADVDSNPDNPAIGRLGRSFSPNPRLVAEHALAFGQGL 203 >gi|300692206|ref|YP_003753201.1| beta-hexosaminidase A precursor (N-acetyl-beta-glucosaminidase) (beta-N-acetylhexosaminidase) (chitobiase) [Ralstonia solanacearum PSI07] gi|299079266|emb|CBJ51938.2| putative Beta-hexosaminidase A precursor (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) (Chitobiase) [Ralstonia solanacearum PSI07] Length = 734 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L G+NVNF+PV+D+ P + + PA + +R Sbjct: 217 LASELAAVGMNVNFAPVVDVNSNPLNPVINV-RAYGDDPAMVGLLGRHMARGM 268 >gi|145594312|ref|YP_001158609.1| glycoside hydrolase family 3 protein [Salinispora tropica CNB-440] gi|145303649|gb|ABP54231.1| glycoside hydrolase, family 3 domain protein [Salinispora tropica CNB-440] Length = 498 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L GI +N++P D+ P+ + F P + R Sbjct: 111 LGTELAALGITLNYAPDADVNSNPDNPVIGV-RSFGADPNLTARHTAAWVRGLQ 163 >gi|255948496|ref|XP_002565015.1| Pc22g10060 [Penicillium chrysogenum Wisconsin 54-1255] gi|211592032|emb|CAP98294.1| Pc22g10060 [Penicillium chrysogenum Wisconsin 54-1255] Length = 908 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L P +A F + Y + Sbjct: 109 AQELKAVGVNWILGPVLDVLTNVRNQPLGV-RTAGDDPQEASRYGVQFMKGYQE 161 >gi|148821431|ref|YP_001286185.1| lipoprotein lpqI [Mycobacterium tuberculosis F11] gi|148719958|gb|ABR04583.1| lipoprotein lpqI [Mycobacterium tuberculosis F11] Length = 388 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI ++F+PV+D+ P+ + F PA A +++ Sbjct: 163 GRQMRKLGITIDFAPVVDVTDAPDDTVIG-DRSFGSDPATVTAYAGAYAQGLRD 215 >gi|256841063|ref|ZP_05546570.1| glycoside hydrolase family beta-glycosidase [Parabacteroides sp. D13] gi|256736906|gb|EEU50233.1| glycoside hydrolase family beta-glycosidase [Parabacteroides sp. D13] Length = 1000 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + GI++NF+P +D+ + + F P E ++R Sbjct: 152 GRQCREMGIHINFAPDMDVNSNVDNPVIGL-RSFGENPEAVSEKGIAYARGL 202 >gi|150008942|ref|YP_001303685.1| glycoside hydrolase family beta-glycosidase [Parabacteroides distasonis ATCC 8503] gi|149937366|gb|ABR44063.1| glycoside hydrolase family 3, candidate beta-glycosidase [Parabacteroides distasonis ATCC 8503] Length = 999 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + GI++NF+P +D+ + + F P E ++R Sbjct: 151 GRQCREMGIHINFAPDMDVNSNVDNPVIGL-RSFGENPEAVSEKGIAYARGL 201 >gi|255942415|ref|XP_002561976.1| Pc18g01310 [Penicillium chrysogenum Wisconsin 54-1255] gi|211586709|emb|CAP94355.1| Pc18g01310 [Penicillium chrysogenum Wisconsin 54-1255] Length = 852 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L GIN+N++PV D+ P + P A +R ++ Sbjct: 117 GETLSFFGINMNYAPVCDINSEPLNPVIGV-RSPGDDPEFVGRFASAAARGLREH 170 >gi|167968959|ref|ZP_02551236.1| putative conserved lipoprotein LpqI [Mycobacterium tuberculosis H37Ra] Length = 373 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI ++F+PV+D+ P+ + F PA A +++ Sbjct: 148 GRQMRKLGITIDFAPVVDVTDAPDDTVIG-DRSFGSDPATVTAYAGAYAQGLRD 200 >gi|315041250|ref|XP_003170002.1| beta-N-acetylglucosaminidase/beta-glucosidase [Arthroderma gypseum CBS 118893] gi|311345964|gb|EFR05167.1| beta-N-acetylglucosaminidase/beta-glucosidase [Arthroderma gypseum CBS 118893] Length = 1047 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L GIN PVLD+L + P + + Y Sbjct: 127 AQELRAVGINWILGPVLDVLTDGKNQPLGV-RSVGDDPQEVATYGVESMKGYQD 179 >gi|255014771|ref|ZP_05286897.1| glycoside hydrolase family beta-glycosidase [Bacteroides sp. 2_1_7] Length = 999 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + GI++NF+P +D+ + + F P E ++R Sbjct: 151 GRQCREMGIHINFAPDMDVNSNVDNPVIGL-RSFGENPEAVSEKGIAYARGL 201 >gi|18309248|ref|NP_561182.1| beta-hexosamidase A [Clostridium perfringens str. 13] gi|18143924|dbj|BAB79972.1| probable beta-hexosamidase A [Clostridium perfringens str. 13] Length = 845 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L G+NV+F+PVLD PE + S P + + + Sbjct: 165 IGKELNALGVNVDFAPVLDTNNNPENPVIGV-RSISSNPELVGKLGKNIANGIQD 218 >gi|237808299|ref|YP_002892739.1| glycoside hydrolase family 3 domain-containing protein [Tolumonas auensis DSM 9187] gi|259511218|sp|C4LEY6|NAGZ_TOLAT RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|237500560|gb|ACQ93153.1| glycoside hydrolase family 3 domain protein [Tolumonas auensis DSM 9187] Length = 334 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++F+PVLDL G I FS P + + A F + Sbjct: 102 MAAELLAHDIDLSFAPVLDLERG-SNVIG--DRSFSSDPEQVIQLASAFIDGMHQ 153 >gi|84498183|ref|ZP_00996980.1| putative beta-N-acetylhexosaminidase [Janibacter sp. HTCC2649] gi|84381683|gb|EAP97566.1| putative beta-N-acetylhexosaminidase [Janibacter sp. HTCC2649] Length = 617 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L G+ +++PV D+ P + + A + Y Sbjct: 190 IGSELAAVGVTQDYAPVSDVNINPNNPVIGI-RSIGGDAKLVSDLAVAQIKGYR 242 >gi|332676547|gb|AEE73363.1| lipoprotein YbbD [Propionibacterium acnes 266] Length = 656 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 194 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 246 >gi|327335328|gb|EGE77038.1| putative beta-N-acetylglucosaminidase [Propionibacterium acnes HL097PA1] Length = 623 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 161 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 213 >gi|50843601|ref|YP_056828.1| putative beta-N-acetylglucosaminidase precursor [Propionibacterium acnes KPA171202] gi|50841203|gb|AAT83870.1| putative beta-N-acetylglucosaminidase precursor [Propionibacterium acnes KPA171202] Length = 656 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 194 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 246 >gi|17545488|ref|NP_518890.1| hydrolase glycosidase [Ralstonia solanacearum GMI1000] gi|17427780|emb|CAD14299.1| putative hydrolase glycosidase protein [Ralstonia solanacearum GMI1000] Length = 734 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L G+NVNF+PV+D+ P + + PA + +R Sbjct: 217 LASELAAVGMNVNFAPVVDVNSNPLNPVINV-RAYGDDPAMVGLLGRHMARGM 268 >gi|119491534|ref|XP_001263288.1| beta-N-acetylglucosaminidase, putative [Neosartorya fischeri NRRL 181] gi|119411448|gb|EAW21391.1| beta-N-acetylglucosaminidase, putative [Neosartorya fischeri NRRL 181] Length = 854 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN+N++PV D+ P + P A ++ + Sbjct: 117 GETLRFFGINMNYAPVCDINSEPLNPVIGV-RSPGDDPEFVGRFASAAAQGLRE 169 >gi|311029144|ref|ZP_07707234.1| Beta-N-acetylhexosaminidase [Bacillus sp. m3-13] Length = 534 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K L GIN+N++P +D+ P + + + + Sbjct: 118 GKELRLLGINMNYAPCIDVNNNPLNPVIGV-RSYGESEEFVAKMGVQAVKGLQD 170 >gi|3426176|dbj|BAA32403.1| beta-N-Acetylglucosaminidase [Streptomyces thermoviolaceus] Length = 632 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L G+N ++SP D+ P + F P + Y Sbjct: 203 GAELRAMGVNQDYSPDADVNVNPANPVIGV-RSFGADPDAVARMVAAQVKGYQ 254 >gi|294629464|ref|ZP_06708024.1| glycosyl hydrolase domain-containing protein [Streptomyces sp. e14] gi|292832797|gb|EFF91146.1| glycosyl hydrolase domain-containing protein [Streptomyces sp. e14] Length = 626 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L G+N ++SP D+ P + F P R Y Sbjct: 200 GAELRAMGVNQDYSPDADVNVNPANPVIGV-RSFGADPDAVARLVAAEVRGYQ 251 >gi|251773004|gb|EES53560.1| Beta-N-acetylhexosaminidase [Leptospirillum ferrodiazotrophum] Length = 321 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G +V+F+PVLD+ P+ I FS P +A A F+R + Sbjct: 103 LGEALHRLGFDVDFAPVLDVDSNPQNPIIG-DRAFSSDPEEAGVKALAFARGLL 155 >gi|315083851|gb|EFT55827.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL027PA2] Length = 623 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 161 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 213 >gi|313818218|gb|EFS55932.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL046PA2] gi|314961923|gb|EFT06024.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL002PA2] gi|315087260|gb|EFT59236.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL002PA3] Length = 623 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 161 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 213 >gi|289427922|ref|ZP_06429626.1| glycosyl hydrolase family 3 N-terminal domain protein [Propionibacterium acnes J165] gi|295131684|ref|YP_003582347.1| glycosyl hydrolase family 3 N-terminal domain protein [Propionibacterium acnes SK137] gi|289158805|gb|EFD07005.1| glycosyl hydrolase family 3 N-terminal domain protein [Propionibacterium acnes J165] gi|291375236|gb|ADD99090.1| glycosyl hydrolase family 3 N-terminal domain protein [Propionibacterium acnes SK137] Length = 629 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 167 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 219 >gi|269128222|ref|YP_003301592.1| glycoside hydrolase family 3 domain-containing protein [Thermomonospora curvata DSM 43183] gi|268313180|gb|ACY99554.1| glycoside hydrolase family 3 domain protein [Thermomonospora curvata DSM 43183] Length = 543 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN N++PV D+ P + F P + Y Sbjct: 159 IGTELRAVGINQNYAPVADVNVNPANPVIGV-RSFGSDPGLVSLMLGGALQGYRD 212 >gi|313821123|gb|EFS58837.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL036PA1] gi|313824046|gb|EFS61760.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL036PA2] Length = 623 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 161 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 213 >gi|313765621|gb|EFS36985.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL013PA1] gi|313816590|gb|EFS54304.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL059PA1] gi|314916631|gb|EFS80462.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL005PA4] gi|314918910|gb|EFS82741.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL050PA1] gi|314920921|gb|EFS84752.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL050PA3] gi|314956640|gb|EFT00892.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL027PA1] gi|314959519|gb|EFT03621.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL002PA1] gi|315100287|gb|EFT72263.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL059PA2] gi|315102427|gb|EFT74403.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL046PA1] gi|327455743|gb|EGF02398.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL087PA3] gi|327458093|gb|EGF04748.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL083PA2] gi|328757253|gb|EGF70869.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL087PA1] gi|328757638|gb|EGF71254.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL025PA2] Length = 623 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 161 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 213 >gi|301161614|emb|CBW21154.1| putative hydrolase/beta lactamase fusion protein [Bacteroides fragilis 638R] Length = 1027 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA+ G+ VNF+PV D+ P+ + F P K + ++ Sbjct: 184 MARQCREMGVQVNFAPVADVNINPDNPVINI-RSFGEDPVKVADKVIAYASGL 235 >gi|253564088|ref|ZP_04841545.1| beta-N-acetylglucosaminidase [Bacteroides sp. 3_2_5] gi|251947864|gb|EES88146.1| beta-N-acetylglucosaminidase [Bacteroides sp. 3_2_5] Length = 1017 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA+ G+ VNF+PV D+ P+ + F P K + ++ Sbjct: 174 MARQCREMGVQVNFAPVADVNINPDNPVINI-RSFGEDPVKVADKVIAYASGL 225 >gi|327326660|gb|EGE68448.1| putative beta-N-acetylglucosaminidase [Propionibacterium acnes HL096PA3] Length = 623 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 161 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 213 >gi|313793635|gb|EFS41666.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL110PA1] gi|313802945|gb|EFS44156.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL110PA2] gi|313839421|gb|EFS77135.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL086PA1] gi|314964715|gb|EFT08815.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL082PA1] gi|315079348|gb|EFT51349.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL053PA2] gi|315082409|gb|EFT54385.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL078PA1] gi|327455968|gb|EGF02623.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL092PA1] Length = 623 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 161 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 213 >gi|320010707|gb|ADW05557.1| glycoside hydrolase family 3 domain protein [Streptomyces flavogriseus ATCC 33331] Length = 612 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GIN N++P D+ P + F P + Y Sbjct: 182 GAELAALGINQNYAPDADVNVNPANPVIGV-RSFGSDPESVAGMVAAQVKGYQ 233 >gi|323700659|ref|ZP_08112571.1| glycoside hydrolase family 3 domain protein [Desulfovibrio sp. ND132] gi|323460591|gb|EGB16456.1| glycoside hydrolase family 3 domain protein [Desulfovibrio desulfuricans ND132] Length = 380 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETF-IAQKRSIFSRIPAKAEESAQLFSRTYI 54 +L + G N+NF+PV+D+ P++ I + FS P + A +F Sbjct: 159 GADLSSVGFNLNFAPVVDVNVDPDSPAIGRLGRSFSSDPERVARCAGIFMDELH 212 >gi|314931439|gb|EFS95270.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL067PA1] Length = 618 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 161 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 213 >gi|313771829|gb|EFS37795.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL074PA1] gi|313808361|gb|EFS46828.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL087PA2] gi|313810689|gb|EFS48403.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL083PA1] gi|313813717|gb|EFS51431.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL025PA1] gi|313827208|gb|EFS64922.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL063PA1] gi|313829668|gb|EFS67382.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL063PA2] gi|313831489|gb|EFS69203.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL007PA1] gi|313833461|gb|EFS71175.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL056PA1] gi|314926911|gb|EFS90742.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL036PA3] gi|314968880|gb|EFT12978.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL037PA1] gi|314974816|gb|EFT18911.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL053PA1] gi|314977857|gb|EFT21951.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL045PA1] gi|314979543|gb|EFT23637.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL072PA2] gi|314988386|gb|EFT32477.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL005PA2] gi|314990282|gb|EFT34373.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL005PA3] gi|315089678|gb|EFT61654.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL072PA1] gi|315095626|gb|EFT67602.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL038PA1] gi|315107728|gb|EFT79704.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL030PA1] gi|315109319|gb|EFT81295.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL030PA2] gi|327332923|gb|EGE74655.1| putative beta-N-acetylglucosaminidase [Propionibacterium acnes HL096PA2] gi|327448626|gb|EGE95280.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL043PA1] gi|327449522|gb|EGE96176.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL013PA2] gi|327451147|gb|EGE97801.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL043PA2] gi|328757441|gb|EGF71057.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL020PA1] gi|328761973|gb|EGF75480.1| putative beta-N-acetylglucosaminidase [Propionibacterium acnes HL099PA1] Length = 623 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 161 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 213 >gi|312128537|ref|YP_003993411.1| beta-N-acetylhexosaminidase [Caldicellulosiruptor hydrothermalis 108] gi|311778556|gb|ADQ08042.1| Beta-N-acetylhexosaminidase [Caldicellulosiruptor hydrothermalis 108] Length = 579 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + G+N F+PV+D+ + I F P + E F + + Sbjct: 134 GREAKALGLNWAFAPVVDIDFNFRNPITNT-RTFGSDPERVAEMGCAFIKAVQQ 186 >gi|289425984|ref|ZP_06427731.1| glycosyl hydrolase family 3 N-terminal domain protein [Propionibacterium acnes SK187] gi|289153527|gb|EFD02241.1| glycosyl hydrolase family 3 N-terminal domain protein [Propionibacterium acnes SK187] Length = 629 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 167 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 219 >gi|300704820|ref|YP_003746423.1| beta-hexosaminidase a [Ralstonia solanacearum CFBP2957] gi|299072484|emb|CBJ43834.1| putative Beta-hexosaminidase A precursor [Ralstonia solanacearum CFBP2957] Length = 684 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L G+NVNF+PV+D+ P + + P + +R Sbjct: 159 LASELAAVGMNVNFAPVVDVNSNPLNPVINV-RAYGDDPDMVGLLGRDMARGM 210 >gi|314984733|gb|EFT28825.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL005PA1] Length = 623 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 161 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 213 >gi|314924416|gb|EFS88247.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL001PA1] gi|314967201|gb|EFT11300.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL082PA2] gi|327328720|gb|EGE70480.1| putative beta-N-acetylglucosaminidase [Propionibacterium acnes HL103PA1] Length = 623 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 161 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 213 >gi|300113593|ref|YP_003760168.1| glycoside hydrolase family 3 domain-containing protein [Nitrosococcus watsonii C-113] gi|299539530|gb|ADJ27847.1| glycoside hydrolase family 3 domain protein [Nitrosococcus watsonii C-113] Length = 341 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L G++V+F+PVLDL G I F P A+ + R Sbjct: 108 MAVELRAIGVDVSFAPVLDLAQGVSAVIG--DRAFHAEPDAVIALARAYIRGM 158 >gi|282854935|ref|ZP_06264269.1| glycosyl hydrolase family 3 N-terminal domain protein [Propionibacterium acnes J139] gi|282582081|gb|EFB87464.1| glycosyl hydrolase family 3 N-terminal domain protein [Propionibacterium acnes J139] Length = 629 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 167 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 219 >gi|145221019|ref|YP_001131697.1| Beta-N-acetylhexosaminidase [Mycobacterium gilvum PYR-GCK] gi|145213505|gb|ABP42909.1| Beta-N-acetylhexosaminidase [Mycobacterium gilvum PYR-GCK] Length = 328 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + GI V+F+PV+D+ P+ + F P + A +++ Sbjct: 104 GAKMRNLGITVDFAPVVDVSDAPDNTVIG-DRSFGADPTTVTDYAGAYAQGLRD 156 >gi|314981666|gb|EFT25759.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL110PA3] gi|315092305|gb|EFT64281.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL110PA4] Length = 623 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 161 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 213 >gi|170749172|ref|YP_001755432.1| Beta-N-acetylhexosaminidase [Methylobacterium radiotolerans JCM 2831] gi|170655694|gb|ACB24749.1| Beta-N-acetylhexosaminidase [Methylobacterium radiotolerans JCM 2831] Length = 334 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA +L GINV+ +PVLD+ I + P + E + + Sbjct: 106 MAHDLAEVGINVDCAPVLDVPAPGSHDIIG-DRAYGTSPERVAEIGRAVAEGL 157 >gi|327305615|ref|XP_003237499.1| hypothetical protein TERG_02217 [Trichophyton rubrum CBS 118892] gi|326460497|gb|EGD85950.1| hypothetical protein TERG_02217 [Trichophyton rubrum CBS 118892] Length = 831 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN+N++PV D+ P + A F+R + Sbjct: 119 GELLDALGINMNYAPVCDVNSEPSNPVIGI-RSPGDDGVSVGRIASAFARGLRE 171 >gi|315104675|gb|EFT76651.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL050PA2] Length = 623 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 161 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 213 >gi|315094668|gb|EFT66644.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL060PA1] Length = 614 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L GINV+F+P +D+ P + P + R Sbjct: 161 LGRELAALGINVDFAPDVDVNTNPANPVIGV-RSMGDDPVRVGVLGVEQIRGIQ 213 >gi|255077145|ref|XP_002502223.1| glycoside hydrolase family 3 protein [Micromonas sp. RCC299] gi|226517488|gb|ACO63481.1| glycoside hydrolase family 3 protein [Micromonas sp. RCC299] Length = 366 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L +++ +PVLD+ P + + A F Sbjct: 94 IGSELRACHVDMTLAPVLDVNTNPNNAVIG-DRSYGSDARVASACGAAFIDALQ 146 >gi|315123010|ref|YP_004065016.1| beta-hexosaminidase A [Pseudoalteromonas sp. SM9913] gi|315016770|gb|ADT70107.1| beta-hexosaminidase A [Pseudoalteromonas sp. SM9913] Length = 603 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A L GINVN++P +D+ P+ + FS P + KN Sbjct: 141 LATELSALGINVNYAPTVDVNMNPDNPVINV-RSFSENPNDVAVLGAAQVSEFEKN 195 >gi|291333723|gb|ADD93410.1| b N acetylglucosaminidase glycoside hydrolase family 3 protein [uncultured marine bacterium MedDCM-OCT-S04-C102] Length = 262 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 25/55 (45%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L G+NVNF+PV+DL FI F R K ++ F + +N Sbjct: 36 SDLLKELGVNVNFAPVVDLAINTSNFIYNAERSFGRDSDKVYYHSRNFINAHREN 90 >gi|113955031|ref|YP_731752.1| beta-N-acetylglucosaminidase [Synechococcus sp. CC9311] gi|113882382|gb|ABI47340.1| Possible beta-N-acetylglucosaminidase [Synechococcus sp. CC9311] Length = 552 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 15/52 (28%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 G+N +PV D+ P + + P E F R Sbjct: 124 GNQAKRCGLNWVLAPVCDVNSNPNNPVINV-RAWGEDPHTVGELTGAFQRGL 174 >gi|84495291|ref|ZP_00994410.1| putative beta-N-acetylhexosaminidase [Janibacter sp. HTCC2649] gi|84384784|gb|EAQ00664.1| putative beta-N-acetylhexosaminidase [Janibacter sp. HTCC2649] Length = 522 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L GI+++++P D+ P + F PA + Sbjct: 120 IGTLLARVGIDLDYAPDADVNNNPANPVIGV-RSFGADPALVARHTAAWITGLQ 172 >gi|254501037|ref|ZP_05113188.1| Glycosyl hydrolase family 3 N terminal domain protein [Labrenzia alexandrii DFL-11] gi|222437108|gb|EEE43787.1| Glycosyl hydrolase family 3 N terminal domain protein [Labrenzia alexandrii DFL-11] Length = 412 Score = 62.9 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQ-KRSIFSRIPAKAEESAQLFSRTYI 54 A L INVNF PV+D+ P I K+ FS P A F + Sbjct: 149 AAQLGAYNINVNFGPVVDVDINPGNPIIGKKKRSFSADPTTVTNCAAGFIAAHQ 202 >gi|124024304|ref|YP_001018611.1| beta-N-acetylglucosaminidase [Prochlorococcus marinus str. MIT 9303] gi|123964590|gb|ABM79346.1| Possible beta-N-acetylglucosaminidase [Prochlorococcus marinus str. MIT 9303] Length = 549 Score = 62.9 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 15/52 (28%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 G+N +PV D+ P + + A A F + Sbjct: 127 GHQARRCGLNWVLAPVCDVNNNPANPVINV-RAWGEDTATVSALACAFQQGL 177 >gi|159902669|ref|YP_001550013.1| Beta-glucosidase-related glycosidase [Prochlorococcus marinus str. MIT 9211] gi|159887845|gb|ABX08059.1| Beta-glucosidase-related glycosidase [Prochlorococcus marinus str. MIT 9211] Length = 543 Score = 62.9 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + V G+N +PV D+ P + +S P + A F R Sbjct: 126 IGYESVICGLNWVLAPVCDVNSNPLNPVINM-RAWSDNPQTVADLACAFHRGL 177 >gi|326484069|gb|EGE08079.1| beta-N-acetylglucosaminidase [Trichophyton equinum CBS 127.97] Length = 273 Score = 62.9 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN+N++PV D+ P + A F++ + Sbjct: 119 GELLDALGINMNYAPVCDVNSEPSNPVIGV-RSPGDDGVTVGRIASAFAKGLRE 171 >gi|193211795|ref|YP_001997748.1| glycoside hydrolase family 3 domain-containing protein [Chlorobaculum parvum NCIB 8327] gi|193085272|gb|ACF10548.1| glycoside hydrolase family 3 domain protein [Chlorobaculum parvum NCIB 8327] Length = 570 Score = 62.9 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ GI N++P +DL P + F + F N Sbjct: 150 IAREARAVGIQQNYAPTVDLNINPANPVINT-RSFGDRIPLVNTMSAAFIDGMQSN 204 >gi|332878119|ref|ZP_08445848.1| beta-lactamase [Capnocytophaga sp. oral taxon 329 str. F0087] gi|332683857|gb|EGJ56725.1| beta-lactamase [Capnocytophaga sp. oral taxon 329 str. F0087] Length = 970 Score = 62.9 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ G+ NF+P +D+ PE I F + F+R Sbjct: 151 IGQHCKQIGMQFNFAPDIDINTNPENPIIG-NRSFGEDKENVAQKGLAFTRGMQ 203 >gi|159127460|gb|EDP52575.1| beta-N-acetylglucosaminidase, putative [Aspergillus fumigatus A1163] Length = 814 Score = 62.9 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN+N++PV D+ P + P A ++ + Sbjct: 77 GETLRFFGINMNYAPVCDINSEPLNPVIGP-RSPGDDPEFVGRFASAAAQGLRE 129 >gi|70999448|ref|XP_754443.1| beta-N-acetylglucosaminidase [Aspergillus fumigatus Af293] gi|66852080|gb|EAL92405.1| beta-N-acetylglucosaminidase, putative [Aspergillus fumigatus Af293] Length = 814 Score = 62.9 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN+N++PV D+ P + P A ++ + Sbjct: 77 GETLRFFGINMNYAPVCDINSEPLNPVIGP-RSPGDDPEFVGRFASAAAQGLRE 129 >gi|124002449|ref|ZP_01687302.1| glycosyl hydrolase, family 3 [Microscilla marina ATCC 23134] gi|123992278|gb|EAY31646.1| glycosyl hydrolase, family 3 [Microscilla marina ATCC 23134] Length = 383 Score = 62.9 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ + G NVNF+PV DL P+ I K FS + A F+ + K+ Sbjct: 158 IAQKVKAMGFNVNFAPVTDLNVNPKAPIIGKLGRSFSGDVNTLVQHALKFTEVHQKH 214 >gi|256785286|ref|ZP_05523717.1| sugar hydrolase [Streptomyces lividans TK24] gi|289769179|ref|ZP_06528557.1| sugar hydrolase [Streptomyces lividans TK24] gi|289699378|gb|EFD66807.1| sugar hydrolase [Streptomyces lividans TK24] Length = 496 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L +G+N N++P D+ P+ + F + Sbjct: 114 LGRRLAAAGVNFNWAPSADVNSNPDNPVIGV-RAFGSDTDLVARHTAAYITGMQ 166 >gi|238063829|ref|ZP_04608538.1| glycoside hydrolase family 3 [Micromonospora sp. ATCC 39149] gi|237885640|gb|EEP74468.1| glycoside hydrolase family 3 [Micromonospora sp. ATCC 39149] Length = 461 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L + G+ ++++P D+ P + F PA + R Sbjct: 112 LGRELASVGVTLDYAPDADVNSNPANPVIGV-RAFGADPALVARHTAAWVRGLQ 164 >gi|332140001|ref|YP_004425739.1| Beta-hexosaminidase A precursor [Alteromonas macleodii str. 'Deep ecotype'] gi|327550023|gb|AEA96741.1| Beta-hexosaminidase A precursor [Alteromonas macleodii str. 'Deep ecotype'] Length = 687 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K L+ GIN NF+P +D+ P+ + FS P + Q F Sbjct: 201 IGKTLLPLGINTNFAPSVDINSEPKNPVINV-RSFSEHPEQVAALGQTFVEAMQ 253 >gi|284008745|emb|CBA75455.1| glycosyl hydrolase family protein [Arsenophonus nasoniae] Length = 615 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L+ G N NF+PV+D+ + I +S P E A + + Sbjct: 157 GYELMHLGFNFNFAPVVDINNNQDNPIIGV-RSYSDRPQLVAEMANSYIQGIH 208 >gi|21223603|ref|NP_629382.1| sugar hydrolase [Streptomyces coelicolor A3(2)] gi|8546901|emb|CAB94620.1| putative sugar hydrolase [Streptomyces coelicolor A3(2)] Length = 496 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L +G+N N++P D+ P+ + F + Sbjct: 114 LGRRLAAAGVNFNWAPSADVNSNPDNPVIGV-RAFGSDTDLVARHTAAYITGMQ 166 >gi|305666573|ref|YP_003862860.1| beta-N-acetylglucosaminidase [Maribacter sp. HTCC2170] gi|88708844|gb|EAR01079.1| beta-N-acetylglucosaminidase [Maribacter sp. HTCC2170] Length = 970 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + G+++NF+P +D+ P I F + F + Sbjct: 148 IGVHAKRLGVHINFAPDIDINTNPLNPIIG-NRSFGEDRDNVADKGVAFMKGM 199 >gi|182438588|ref|YP_001826307.1| putative beta-N-acetylglucosaminidase [Streptomyces griseus subsp. griseus NBRC 13350] gi|178467104|dbj|BAG21624.1| putative beta-N-acetylglucosaminidase [Streptomyces griseus subsp. griseus NBRC 13350] Length = 610 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GIN N++P D+ P + F PA + Y Sbjct: 182 GAELAALGINQNYAPDADVNVNPANPVIGV-RSFGSDPAAVAALVAEQVKGYQ 233 >gi|318060198|ref|ZP_07978921.1| sugar hydrolase [Streptomyces sp. SA3_actG] Length = 494 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+ N++P D+ P+ + F PA + Sbjct: 114 LGRRLAACGVRFNWAPSADVNSDPDNPVIGV-RSFGADPALVARHTAAYVEGLQ 166 >gi|302521853|ref|ZP_07274195.1| sugar hydrolase [Streptomyces sp. SPB78] gi|302430748|gb|EFL02564.1| sugar hydrolase [Streptomyces sp. SPB78] Length = 343 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+ N++P D+ P+ + F PA + Sbjct: 114 LGRRLAACGVRFNWAPSADVNSDPDNPVIGV-RSFGADPALVARHTAAYVEGLQ 166 >gi|121719621|ref|XP_001276509.1| beta-N-acetylglucosaminidase, putative [Aspergillus clavatus NRRL 1] gi|119404721|gb|EAW15083.1| beta-N-acetylglucosaminidase, putative [Aspergillus clavatus NRRL 1] Length = 931 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L P + + F + Y + Sbjct: 127 AQELKAVGVNWILGPVLDVLTNVRKQPLGV-RTSGDDPQEVSQYGVEFMKGYQE 179 >gi|116073899|ref|ZP_01471161.1| putative beta-glucosidase [Synechococcus sp. RS9916] gi|116069204|gb|EAU74956.1| putative beta-glucosidase [Synechococcus sp. RS9916] Length = 546 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 7/51 (13%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 + G+N +P++D+ P + + P F + Sbjct: 128 GRQARHCGLNWVLAPIVDVNNNPANPVINV-RAWGDDPDTVTRLTLAFQKG 177 >gi|333024507|ref|ZP_08452571.1| putative sugar hydrolase [Streptomyces sp. Tu6071] gi|332744359|gb|EGJ74800.1| putative sugar hydrolase [Streptomyces sp. Tu6071] Length = 494 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+ N++P D+ P+ + F PA + Sbjct: 114 LGRRLAACGVRFNWAPSADVNSDPDNPVIGV-RSFGADPALVARHTAAYVEGLQ 166 >gi|257057545|ref|YP_003135377.1| beta-glucosidase-like glycosyl hydrolase [Saccharomonospora viridis DSM 43017] gi|256587417|gb|ACU98550.1| beta-glucosidase-like glycosyl hydrolase [Saccharomonospora viridis DSM 43017] Length = 618 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L GIN NF+PV D+ P + FS P A E + Y Sbjct: 190 ELRAMGINQNFAPVADVNSNPLNPVIGS-RSFSADPELAGEFVEAQVDGYQN 240 >gi|326779236|ref|ZP_08238501.1| Beta-N-acetylhexosaminidase [Streptomyces cf. griseus XylebKG-1] gi|326659569|gb|EGE44415.1| Beta-N-acetylhexosaminidase [Streptomyces cf. griseus XylebKG-1] Length = 610 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GIN N++P D+ P + F PA + Y Sbjct: 182 GAELAALGINQNYAPDADVNVNPANPVIGV-RSFGSDPAAVAALVAEQVKGYQ 233 >gi|187250506|ref|YP_001874988.1| putative Beta-glucosidase [Elusimicrobium minutum Pei191] gi|186970666|gb|ACC97651.1| Putative beta-glucosidase [Elusimicrobium minutum Pei191] Length = 541 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 13/50 (26%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 L +GI++NFSPV+D+ P I F P Sbjct: 138 ELRKAGIHINFSPVVDVNINPGNPIIGV-RSFGSSPELVGRMGAAVVSGL 186 >gi|254467833|ref|ZP_05081239.1| beta-hexosaminidase [beta proteobacterium KB13] gi|207086643|gb|EDZ63926.1| beta-hexosaminidase [beta proteobacterium KB13] Length = 339 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L I++N+SPVLD+ YG + I FS P E A+ F Sbjct: 107 IASELGELHIDLNYSPVLDINYGKSSVIG--NRSFSDNPKAIIELAKAFIDGQH 158 >gi|326479351|gb|EGE03361.1| beta-N-acetylglucosaminidase [Trichophyton equinum CBS 127.97] Length = 1010 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L + P + + Y Sbjct: 95 AQELRAVGVNWILGPVLDVLTDGKNQPLGV-RSVGDDPQEVATYGVESMKGYQD 147 >gi|326471256|gb|EGD95265.1| beta-N-acetylglucosaminidase [Trichophyton tonsurans CBS 112818] Length = 1048 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L + P + + Y Sbjct: 127 AQELRAVGVNWILGPVLDVLTDGKNQPLGV-RSVGDDPQEVATYGVESMKGYQD 179 >gi|327302972|ref|XP_003236178.1| beta-N-acetylglucosaminidase [Trichophyton rubrum CBS 118892] gi|326461520|gb|EGD86973.1| beta-N-acetylglucosaminidase [Trichophyton rubrum CBS 118892] Length = 1083 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L + P + + Y Sbjct: 127 AQELRAVGVNWILGPVLDVLTDGKNQPLGV-RSVGDDPQEVATYGVESMKGYQD 179 >gi|302652647|ref|XP_003018170.1| hypothetical protein TRV_07866 [Trichophyton verrucosum HKI 0517] gi|291181782|gb|EFE37525.1| hypothetical protein TRV_07866 [Trichophyton verrucosum HKI 0517] Length = 1065 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L + P + + Y Sbjct: 132 AQELRAVGVNWILGPVLDVLTDGKNQPLGV-RSVGDDPQEVATYGVESMKGYQD 184 >gi|302509698|ref|XP_003016809.1| hypothetical protein ARB_05102 [Arthroderma benhamiae CBS 112371] gi|291180379|gb|EFE36164.1| hypothetical protein ARB_05102 [Arthroderma benhamiae CBS 112371] Length = 1137 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L + P + + Y Sbjct: 132 AQELRAVGVNWILGPVLDVLTDGKNQPLGV-RSVGDDPQEVATYGVESMKGYQD 184 >gi|203284521|ref|YP_002222261.1| beta-glucosidase, putative [Borrelia duttonii Ly] gi|201083964|gb|ACH93555.1| beta-glucosidase, putative [Borrelia duttonii Ly] Length = 551 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GIN+NF+P+ D+ E FI +S P A F + + Sbjct: 149 IANELKQLGININFAPITDIYSNEENFIIGP-RTYSNNPQIVSLFALAFYKGQKQ 202 >gi|228473693|ref|ZP_04058443.1| family 3 glycosyl hydrolase/beta-lactamase fusion protein [Capnocytophaga gingivalis ATCC 33624] gi|228274907|gb|EEK13722.1| family 3 glycosyl hydrolase/beta-lactamase fusion protein [Capnocytophaga gingivalis ATCC 33624] Length = 769 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A++ G++++F+P +D+ P+ I F + F++ Sbjct: 146 IAQHCKRLGVHIDFAPDIDINTNPQNPIIG-NRSFGESKFNVAQKGVAFTKGMQ 198 >gi|207744044|ref|YP_002260436.1| hydrolase glycosidase protein [Ralstonia solanacearum IPO1609] gi|206595446|emb|CAQ62373.1| hydrolase glycosidase protein [Ralstonia solanacearum IPO1609] Length = 695 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L G+NVNF+PV+D+ P + + P + +R Sbjct: 170 LASELAAVGMNVNFAPVVDVNSNPLNPVINV-RAYGDDPDMVGLLGRDTARGM 221 >gi|83749001|ref|ZP_00946009.1| Beta-hexosaminidase [Ralstonia solanacearum UW551] gi|83724339|gb|EAP71509.1| Beta-hexosaminidase [Ralstonia solanacearum UW551] Length = 742 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L G+NVNF+PV+D+ P + + P + +R Sbjct: 217 LASELAAVGMNVNFAPVVDVNSNPLNPVINV-RAYGDDPDMVGLLGRDTARGM 268 >gi|148271227|ref|YP_001220788.1| putative beta-N-acetylglucosaminidase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] gi|147829157|emb|CAN00063.1| putative beta-N-acetylglucosaminidase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] Length = 607 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L+ GIN F+PV+D+ P I F P + AQ T+ K Sbjct: 189 ELLAMGINQAFAPVVDVASNPANPIIHV-RSFGDDPDRVALLAQSQIGTFQK 239 >gi|296332128|ref|ZP_06874591.1| putative beta-hexosaminidase, putative lipoprotein [Bacillus subtilis subsp. spizizenii ATCC 6633] gi|305672868|ref|YP_003864539.1| putative beta-hexosaminidase, putative lipoprotein [Bacillus subtilis subsp. spizizenii str. W23] gi|296150620|gb|EFG91506.1| putative beta-hexosaminidase, putative lipoprotein [Bacillus subtilis subsp. spizizenii ATCC 6633] gi|305411111|gb|ADM36229.1| putative beta-hexosaminidase, putative lipoprotein [Bacillus subtilis subsp. spizizenii str. W23] Length = 642 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K L GIN +FSPV+D+ P+ + FS + Sbjct: 160 IGKELSALGINTDFSPVMDINNNPDNPVIGV-RSFSSNRELTARLGLYTMKGLQ 212 >gi|33864229|ref|NP_895789.1| beta-N-acetylglucosaminidase [Prochlorococcus marinus str. MIT 9313] gi|33635813|emb|CAE22138.1| Possible beta-N-acetylglucosaminidase [Prochlorococcus marinus str. MIT 9313] Length = 549 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 15/52 (28%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 G+N +PV D+ P + + A A F + Sbjct: 127 GHQARRCGLNWVLAPVCDVNNNPANPVINV-RAWGEDTATVSSLACAFQQGL 177 >gi|86141387|ref|ZP_01059933.1| beta-N-acetylglucosaminidase [Leeuwenhoekiella blandensis MED217] gi|85831946|gb|EAQ50401.1| beta-N-acetylglucosaminidase [Leeuwenhoekiella blandensis MED217] Length = 971 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+++NF+P +D+ PE I F + + F R Sbjct: 150 IGLHNKRLGVHINFAPDVDINVNPENPIIG-NRSFGEDRDNVTDKSVAFIRGMQ 202 >gi|319779640|ref|YP_004130553.1| Beta N-acetyl-glucosaminidase [Taylorella equigenitalis MCE9] gi|317109664|gb|ADU92410.1| Beta N-acetyl-glucosaminidase [Taylorella equigenitalis MCE9] Length = 351 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L++ G++ +++PVLDL YG T I F + P ++ F + K Sbjct: 112 MAMELLSCGVDFSYAPVLDLDYGFSTVIG--DRAFHKDPKVVAILSRAFIQGLSK 164 >gi|295838779|ref|ZP_06825712.1| beta-N-Acetylglucosaminidase [Streptomyces sp. SPB74] gi|295827190|gb|EDY42260.2| beta-N-Acetylglucosaminidase [Streptomyces sp. SPB74] Length = 622 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+ +++P D+ P + F P R Y + Sbjct: 322 GRELAALGVRQDWAPDADVNVNPANPVIGV-RSFGADPEAVARLVAAQVRGYQE 374 >gi|145642348|ref|ZP_01797910.1| possible beta-hexosamidase A, glycoside hydrolase family 3 [Haemophilus influenzae R3021] gi|145272949|gb|EDK12833.1| possible beta-hexosamidase A, glycoside hydrolase family 3 [Haemophilus influenzae 22.4-21] Length = 463 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 G N +F+P++D+ Y I FS P E A + + + Sbjct: 8 EASAIGCNWSFAPIVDINYNWRNPII-SNRSFSSDPDTVLEMALAYMKGIQE 58 >gi|318077105|ref|ZP_07984437.1| sugar hydrolase [Streptomyces sp. SA3_actF] Length = 333 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+ N++P D+ P+ + F PA + Sbjct: 114 LGRRLAACGVRFNWAPSADVNSDPDNPVIGV-RSFGADPALVARHTAAYVEGLQ 166 >gi|203288055|ref|YP_002223070.1| beta-glucosidase, putative [Borrelia recurrentis A1] gi|201085275|gb|ACH94849.1| beta-glucosidase, putative [Borrelia recurrentis A1] Length = 551 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GIN+NF+P+ D+ E FI +S P A F + + Sbjct: 149 IANELKQLGININFAPITDIYSNEENFIIGP-RTYSNNPQIVSLFALAFYKGQKQ 202 >gi|284033953|ref|YP_003383884.1| glycoside hydrolase family 3 domain-containing protein [Kribbella flavida DSM 17836] gi|283813246|gb|ADB35085.1| glycoside hydrolase family 3 domain protein [Kribbella flavida DSM 17836] Length = 606 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GI +++PV D+ + FS P + + Y K Sbjct: 182 GRELKAMGIRQDYAPVADVNVNALNPVIGV-RSFSSDPQLVSDLTVAQVQGYQK 234 >gi|296805606|ref|XP_002843627.1| beta-N-acetylhexosaminidase [Arthroderma otae CBS 113480] gi|238844929|gb|EEQ34591.1| beta-N-acetylhexosaminidase [Arthroderma otae CBS 113480] Length = 852 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN+N++PV D+ P + A F++ + Sbjct: 118 GELLDALGINMNYAPVCDVNSEPSNPVIGV-RSPGDNGINVGRIASAFAQGLRE 170 >gi|326335415|ref|ZP_08201602.1| B-glycosidase [Capnocytophaga sp. oral taxon 338 str. F0234] gi|325692181|gb|EGD34133.1| B-glycosidase [Capnocytophaga sp. oral taxon 338 str. F0234] Length = 968 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A++ G++++F+P +D+ P+ I F + F++ Sbjct: 146 IAQHCKRLGVHIDFAPDIDINTNPKNPIIG-NRSFGESKFNVAQKGIAFTKGMQ 198 >gi|315046738|ref|XP_003172744.1| beta-hexosaminidase [Arthroderma gypseum CBS 118893] gi|311343130|gb|EFR02333.1| beta-hexosaminidase [Arthroderma gypseum CBS 118893] Length = 852 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN+N++PV D+ P + A F++ + Sbjct: 118 GELLYALGINMNYAPVCDVNSEPANPVIGV-RSPGDDGVSVGRIASAFAKGLRE 170 >gi|297562659|ref|YP_003681633.1| glycoside hydrolase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] gi|296847107|gb|ADH69127.1| glycoside hydrolase family 3 domain protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] Length = 558 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ L G+N+N++P D+ P + F P + A S Y Sbjct: 168 AEELTALGVNLNYAPDADVNTDPGNPVIGI-RSFGSDPDLVAQMAVAESDAY 218 >gi|254384649|ref|ZP_04999988.1| sugar hydrolase [Streptomyces sp. Mg1] gi|194343533|gb|EDX24499.1| sugar hydrolase [Streptomyces sp. Mg1] Length = 414 Score = 62.1 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+N+N++P D+ P+ + F A + Sbjct: 114 LGRRLAACGVNLNWAPSADVNSNPDNPVIGV-RSFGADTRLAARHTAAYVEGLQ 166 >gi|189464226|ref|ZP_03013011.1| hypothetical protein BACINT_00563 [Bacteroides intestinalis DSM 17393] gi|189438016|gb|EDV07001.1| hypothetical protein BACINT_00563 [Bacteroides intestinalis DSM 17393] Length = 1000 Score = 62.1 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G++VNF+P D+ P + F P K E +SR Sbjct: 154 AREFRELGVHVNFAPDADVNTNPLNPVIHV-RSFGEDPKKVAEKVVAYSRGL 204 >gi|307721933|ref|YP_003893073.1| glycoside hydrolase family 3 domain-containing protein [Sulfurimonas autotrophica DSM 16294] gi|306980026|gb|ADN10061.1| glycoside hydrolase family 3 domain protein [Sulfurimonas autotrophica DSM 16294] Length = 560 Score = 62.1 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ L +GIN+NF+PV+DL P I + P + + AQ K+ Sbjct: 141 AQILEDAGINMNFAPVVDLSINPNNKVIVALERSYGSDPKEVVKYAQTMIDVQTKH 196 >gi|148827205|ref|YP_001291958.1| beta-hexosamidase A [Haemophilus influenzae PittGG] gi|148718447|gb|ABQ99574.1| possible beta-hexosamidase A, glycoside hydrolase family 3 [Haemophilus influenzae PittGG] Length = 586 Score = 62.1 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 G N +F+P++D+ Y I FS P E A + + + Sbjct: 131 EASAIGCNWSFAPIVDINYNWRNPII-SNRSFSSDPDTVLEMALAYMKGIQE 181 >gi|218531638|ref|YP_002422454.1| beta-N-acetylhexosaminidase [Methylobacterium chloromethanicum CM4] gi|218523941|gb|ACK84526.1| Beta-N-acetylhexosaminidase [Methylobacterium chloromethanicum CM4] Length = 343 Score = 62.1 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA +L + GINV+ +P+LD+ I + P + E + + Sbjct: 115 MAHDLASVGINVDCAPMLDVPVAGSDNIIG-DRAYGDTPERVIELGRAVAEGL 166 >gi|302560547|ref|ZP_07312889.1| beta-N-Acetylglucosaminidase [Streptomyces griseoflavus Tu4000] gi|302478165|gb|EFL41258.1| beta-N-Acetylglucosaminidase [Streptomyces griseoflavus Tu4000] Length = 553 Score = 62.1 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 12/50 (24%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 L GI N+SPV D+ P + F P + + Y Sbjct: 222 ELRALGIRQNYSPVADVNVNPANPVIGV-RSFGSDPQSVADLVAAEVKGY 270 >gi|315442009|ref|YP_004074888.1| beta-glucosidase-like glycosyl hydrolase [Mycobacterium sp. Spyr1] gi|315260312|gb|ADT97053.1| beta-glucosidase-like glycosyl hydrolase [Mycobacterium sp. Spyr1] Length = 406 Score = 62.1 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + GI V+F+PV+D+ P+ + F P + A +++ + Sbjct: 182 GAKMRNLGITVDFAPVVDVSDAPDNTVIG-DRSFGADPTTVTDYAGAYAQGLRE 234 >gi|311898305|dbj|BAJ30713.1| putative beta-N-acetylhexosaminidase [Kitasatospora setae KM-6054] Length = 524 Score = 62.1 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +L + G+N+N++P D+ P+ + F A + R Sbjct: 113 IGFDLSSVGVNLNYAPDADVNSNPDNPVIGV-RSFGGDGDLAARHTAAYVRGLQ 165 >gi|254562577|ref|YP_003069672.1| beta N-acetyl-glucosaminidase [Methylobacterium extorquens DM4] gi|254269855|emb|CAX25833.1| putative beta N-acetyl-glucosaminidase (nagZ-like) [Methylobacterium extorquens DM4] Length = 343 Score = 62.1 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA +L + GINV+ +P+LD+ I + P + E + + Sbjct: 115 MAHDLASVGINVDCAPMLDVPVAGSDNIIG-DRAYGDTPERVIELGRAVAEGL 166 >gi|325285664|ref|YP_004261454.1| beta-N-acetylhexosaminidase [Cellulophaga lytica DSM 7489] gi|324321118|gb|ADY28583.1| Beta-N-acetylhexosaminidase [Cellulophaga lytica DSM 7489] Length = 979 Score = 62.1 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ + +G+++NF+PV D+ P+ + F K + + + + Sbjct: 152 ARQIKNTGLHLNFAPVADVNNNPDNPVIN-YRSFGEDKYKVAQKSIAYMQGMQN 204 >gi|171920075|gb|ACB59179.1| Hd30 [Streptomyces avermitilis] Length = 606 Score = 62.1 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GI+ NF+PV D+ P I F P + Y Sbjct: 178 GTELAALGIHQNFAPVADVNVNPANPIINI-RSFGADPGEVGRMVAAQVTGYQ 229 >gi|46447459|ref|YP_008824.1| putative beta-N-acetylglucosaminidase [Candidatus Protochlamydia amoebophila UWE25] gi|46401100|emb|CAF24549.1| putative beta-N-acetylglucosaminidase [Candidatus Protochlamydia amoebophila UWE25] Length = 550 Score = 62.1 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L+ GIN+N +PV+D+ P + FS P + + K Sbjct: 153 ANELLAMGINMNLAPVIDVNTQPCNPVIGI-RSFSTCPDEIVRFGSKVVEGFNK 205 >gi|33866740|ref|NP_898299.1| putative beta-glucosidase [Synechococcus sp. WH 8102] gi|33639341|emb|CAE08723.1| putative beta-glucosidase [Synechococcus sp. WH 8102] Length = 533 Score = 62.1 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A G+N PV D+ P + + P A A F R Sbjct: 127 ADQARRCGLNWVLGPVCDVNNNPANPVINV-RAWGEEPTTAGALAAAFQRGL 177 >gi|302339111|ref|YP_003804317.1| beta-N-acetylhexosaminidase [Spirochaeta smaragdinae DSM 11293] gi|301636296|gb|ADK81723.1| Beta-N-acetylhexosaminidase [Spirochaeta smaragdinae DSM 11293] Length = 558 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L GIN+NF+P +D+ P+ + FS P K + + + + Sbjct: 155 IGKELRVLGINMNFAPTVDVYTNPKADVIGP-RAFSSDPVKTAQLSVAYFHGMQE 208 >gi|291299442|ref|YP_003510720.1| glycoside hydrolase family 3 domain-containing protein [Stackebrandtia nassauensis DSM 44728] gi|290568662|gb|ADD41627.1| glycoside hydrolase family 3 domain protein [Stackebrandtia nassauensis DSM 44728] Length = 490 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M L +G+ V+F+P +D+ + + F R P A R Sbjct: 110 MGAELAAAGVTVDFAPSVDVNVEDDNPVIGT-RSFGRDPQGVARHAVAAVRGLH 162 >gi|297160359|gb|ADI10071.1| putative sugar hydrolase [Streptomyces bingchenggensis BCW-1] Length = 637 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 15/53 (28%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GI +++PV D+ P + F P Y Sbjct: 201 GAELAALGIRQDYAPVADVNVDPANPVIGV-RSFGADPKAVARLVAAQIEGYQ 252 >gi|224537510|ref|ZP_03678049.1| hypothetical protein BACCELL_02389 [Bacteroides cellulosilyticus DSM 14838] gi|224520889|gb|EEF89994.1| hypothetical protein BACCELL_02389 [Bacteroides cellulosilyticus DSM 14838] Length = 1000 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G++VNF+P D+ P + F P K E +SR Sbjct: 154 AREFRELGVHVNFAPDADVNTNPLNPVIHV-RSFGEDPKKVAEKVLAYSRGL 204 >gi|322705311|gb|EFY96898.1| beta-N-acetylglucosaminidase, putative [Metarhizium anisopliae ARSEF 23] Length = 566 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L GIN+N++PV D+ P + K A ++ + Sbjct: 147 GNMLRYFGINMNYAPVGDVNNEPLNPVIGV-RSPGDDADKVARFAAECAKGLRE 199 >gi|94971590|ref|YP_593638.1| glycoside hydrolase family protein [Candidatus Koribacter versatilis Ellin345] gi|94553640|gb|ABF43564.1| glycoside hydrolase, family 3-like protein [Candidatus Koribacter versatilis Ellin345] Length = 624 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 14/53 (26%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+ N+ P D+ P I F P + + Sbjct: 166 ALESRAIGVEWNWFPDADVNSNPANPIINT-RSFGEDPQAVASMVKAYIEGAH 217 >gi|17826930|dbj|BAB79300.1| putative sugar hydrolase [Streptomyces griseus] Length = 413 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+N+N++P D+ P + F A + Sbjct: 114 LGRRLAECGVNLNWAPSADVNSNPGNPVIGV-RSFGADTRLAARHTAAYIEGLQ 166 >gi|226364656|ref|YP_002782438.1| glycosidase [Rhodococcus opacus B4] gi|226243145|dbj|BAH53493.1| putative glycosidase [Rhodococcus opacus B4] Length = 391 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+ VNF+P +D+ P+ + +S PA A ++R Sbjct: 169 GRGLKDLGVTVNFAPDVDVSSQPDDSVIG-DRSYSDDPAVVTRYADAYARGMRD 221 >gi|187251933|ref|YP_001876415.1| glycoside hydrolase family [Elusimicrobium minutum Pei191] gi|186972093|gb|ACC99078.1| Glycoside hydrolase family [Elusimicrobium minutum Pei191] Length = 478 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ + GIN F+PV+DL PE I F + P A F Sbjct: 101 ARQARSIGINWIFAPVVDLASDPENPIVNT-RAFGKDPMLVTRLAMAFMSGL 151 >gi|111022163|ref|YP_705135.1| beta-N-acetylhexosaminidase [Rhodococcus jostii RHA1] gi|110821693|gb|ABG96977.1| beta-N-acetylhexosaminidase [Rhodococcus jostii RHA1] Length = 391 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+ VNF+P +D+ P+ + +S PA A ++R Sbjct: 169 GRGLKDLGVTVNFAPDVDVSSQPDDSVIG-DRSYSDDPAVVTRYADAYARGMRD 221 >gi|303323619|ref|XP_003071801.1| glycosyl hydrolase, putative [Coccidioides posadasii C735 delta SOWgp] gi|240111503|gb|EER29656.1| glycosyl hydrolase, putative [Coccidioides posadasii C735 delta SOWgp] gi|320035032|gb|EFW16974.1| beta-hexosaminidase [Coccidioides posadasii str. Silveira] Length = 937 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L + + F + Y + Sbjct: 130 AQELSAVGVNWILGPVLDVLNNARSQPLGV-RSIGDDAQEVSAYGVEFMKGYQE 182 >gi|258575883|ref|XP_002542123.1| conserved hypothetical protein [Uncinocarpus reesii 1704] gi|237902389|gb|EEP76790.1| conserved hypothetical protein [Uncinocarpus reesii 1704] Length = 925 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L + + F + Y + Sbjct: 117 AQELSAVGVNWILGPVLDVLNNARSQPLGV-RSIGDDAQEVSAYGVEFMKGYQE 169 >gi|119188719|ref|XP_001244966.1| hypothetical protein CIMG_04407 [Coccidioides immitis RS] Length = 913 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+N PVLD+L + + F + Y + Sbjct: 106 AQELSAVGVNWILGPVLDVLNNARSQPLGV-RSIGDDAQEVSAYGVEFMKGYQE 158 >gi|292492871|ref|YP_003528310.1| glycoside hydrolase [Nitrosococcus halophilus Nc4] gi|291581466|gb|ADE15923.1| glycoside hydrolase family 3 domain protein [Nitrosococcus halophilus Nc4] Length = 341 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L G++ +F+PVLDL G I F P ++ + R Sbjct: 108 MAAELRAVGVDFSFAPVLDLDQGVSRVIG--DRAFHSEPDAVIALSKAYVRGM 158 >gi|121998051|ref|YP_001002838.1| beta-N-acetylhexosaminidase [Halorhodospira halophila SL1] gi|121589456|gb|ABM62036.1| Beta-N-acetylhexosaminidase [Halorhodospira halophila SL1] Length = 346 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L G++++F+PVLDL G I R PA + R + Sbjct: 107 MAAELRACGVDLSFAPVLDLDGGVSHVIGS--RALHREPAAVARLGHAWMRGMRQ 159 >gi|163852812|ref|YP_001640855.1| Beta-N-acetylhexosaminidase [Methylobacterium extorquens PA1] gi|163664417|gb|ABY31784.1| Beta-N-acetylhexosaminidase [Methylobacterium extorquens PA1] Length = 343 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA +L + GINV+ +P+LD+ I + P + E + + Sbjct: 115 MAHDLASVGINVDCAPMLDVPVAGSDNIIG-DRAYGDTPERVIELGRAVAEGL 166 >gi|207728220|ref|YP_002256614.1| putative hydrolase glycosidase protein (partial sequence c terminus) [Ralstonia solanacearum MolK2] gi|206591465|emb|CAQ57077.1| putative hydrolase glycosidase protein (partial sequence c terminus) [Ralstonia solanacearum MolK2] Length = 343 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L G+NVNF+PV+D+ P + + P + +R Sbjct: 170 LASELAAVGMNVNFAPVVDVNSNPLNPVINV-RAYGDDPDMVGLLGRDTARGM 221 >gi|325104583|ref|YP_004274237.1| glycoside hydrolase family 3 domain protein [Pedobacter saltans DSM 12145] gi|324973431|gb|ADY52415.1| glycoside hydrolase family 3 domain protein [Pedobacter saltans DSM 12145] Length = 563 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A +GI VN++PV+D+ P + F + Sbjct: 147 IADQCHRAGIQVNYAPVVDINNNPANPVINV-RSFGENKEMVALMGTAIMKGMQD 200 >gi|206896505|ref|YP_002246485.1| beta-N-Acetylglucosaminidase [Coprothermobacter proteolyticus DSM 5265] gi|206739122|gb|ACI18200.1| beta-N-Acetylglucosaminidase [Coprothermobacter proteolyticus DSM 5265] Length = 392 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 + + G N++F+PVLD++ P+ + F P + Sbjct: 141 LGTEMKAYGFNMDFAPVLDVVTNPQNKVIG-DRSFGSNPDLVSTLGVATMKG 191 >gi|156048580|ref|XP_001590257.1| hypothetical protein SS1G_09021 [Sclerotinia sclerotiorum 1980] gi|154693418|gb|EDN93156.1| hypothetical protein SS1G_09021 [Sclerotinia sclerotiorum 1980 UF-70] Length = 553 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK L GIN+N++PV D+ P+ F+ FS P +N Sbjct: 137 AKILKAYGINMNYAPVADVNSEPKNFVIGV-RSFSDDPGTVGRFVSSQVEGLQQN 190 >gi|229494480|ref|ZP_04388243.1| glycosyl hydrolase family 3 [Rhodococcus erythropolis SK121] gi|229318842|gb|EEN84700.1| glycosyl hydrolase family 3 [Rhodococcus erythropolis SK121] Length = 392 Score = 61.7 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GI VN++P +D+ P+ + +S P A +++ Sbjct: 170 GRGLKDLGITVNYAPDVDVSSQPDDSVIG-DRSYSDDPQTVVAYAGAYAQGMRD 222 >gi|226304606|ref|YP_002764564.1| glycosidase [Rhodococcus erythropolis PR4] gi|226183721|dbj|BAH31825.1| putative glycosidase [Rhodococcus erythropolis PR4] Length = 392 Score = 61.7 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GI VN++P +D+ P+ + +S P A +++ Sbjct: 170 GRGLKDLGITVNYAPDVDVSSQPDDSVIG-DRSYSDDPQTVVAYAGAYAQGMRD 222 >gi|182436071|ref|YP_001823790.1| putative sugar hydrolase [Streptomyces griseus subsp. griseus NBRC 13350] gi|326776695|ref|ZP_08235960.1| Beta-N-acetylhexosaminidase [Streptomyces cf. griseus XylebKG-1] gi|178464587|dbj|BAG19107.1| putative sugar hydrolase [Streptomyces griseus subsp. griseus NBRC 13350] gi|326657028|gb|EGE41874.1| Beta-N-acetylhexosaminidase [Streptomyces cf. griseus XylebKG-1] Length = 509 Score = 61.7 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+N+N++P D+ P + F A + Sbjct: 114 LGRRLAECGVNLNWAPSADVNSNPGNPVIGV-RSFGADTRLAARHTAAYIEGLQ 166 >gi|167570240|ref|ZP_02363114.1| beta-N-Acetylglucosaminidase [Burkholderia oklahomensis C6786] Length = 701 Score = 61.7 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G NVNF+PV+D+ P + F PA + ++ Sbjct: 187 LAAEIAAVGFNVNFAPVVDVNSNPLNPVINV-RSFGDDPATISLLGRRMAQGMK 239 >gi|119961055|ref|YP_948459.1| beta-N-acetylhexosaminidase [Arthrobacter aurescens TC1] gi|119947914|gb|ABM06825.1| putative beta-N-acetylhexosaminidase [Arthrobacter aurescens TC1] Length = 436 Score = 61.7 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Query: 2 AKNLVTSGINVNFSPVLDLLYGP-----ETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K L + G+NVN +PVLD + P I + + PA F+ Sbjct: 215 GKELRSVGVNVNLAPVLDTVTSPEFSPSNAPIGHFQREYGYDPASVSLLGNAFADGMKD 273 >gi|254495931|ref|ZP_05108839.1| glycosy hydrolase family protein [Legionella drancourtii LLAP12] gi|254354809|gb|EET13436.1| glycosy hydrolase family protein [Legionella drancourtii LLAP12] Length = 379 Score = 61.7 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQ-KRSIFSRIPAKAEESAQLFSRTYIKN 56 M K L +G N++F+P++D+ P + K FS PA + A+++SR ++K+ Sbjct: 153 MTKILKETGFNLDFAPLVDINVNPNNPVIAKKERSFSSDPAVVIQDARIYSRHFLKH 209 >gi|257093158|ref|YP_003166799.1| beta-hexosaminidase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] gi|257045682|gb|ACV34870.1| glycoside hydrolase family 3 domain protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] Length = 342 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L G++++F+PVLDL +G + I PA E A Sbjct: 114 LAAELRACGVDLSFTPVLDLDWGRSSVIG--DRSLHGDPAVVAELAGALIAGLR 165 >gi|315223367|ref|ZP_07865226.1| B-glycosidase [Capnocytophaga ochracea F0287] gi|314946698|gb|EFS98687.1| B-glycosidase [Capnocytophaga ochracea F0287] Length = 976 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+ NF+P +D+ P I F + F+R Sbjct: 151 IGLHCKQLGMQFNFAPDIDINTNPNNPIIG-NRSFGEDKENVTQKGLAFTRGMQ 203 >gi|240140139|ref|YP_002964616.1| putative beta N-acetyl-glucosaminidase (nagZ-like) [Methylobacterium extorquens AM1] gi|240010113|gb|ACS41339.1| putative beta N-acetyl-glucosaminidase (nagZ-like) [Methylobacterium extorquens AM1] Length = 343 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA +L + GINV+ +P+LD+ I + P + E + + Sbjct: 115 MAHDLASVGINVDCAPMLDVPVAGSDNIIG-DRAYGDTPERVIELGRAVAEGL 166 >gi|256820311|ref|YP_003141590.1| glycoside hydrolase family 3 domain-containing protein [Capnocytophaga ochracea DSM 7271] gi|256581894|gb|ACU93029.1| glycoside hydrolase family 3 domain protein [Capnocytophaga ochracea DSM 7271] Length = 976 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+ NF+P +D+ P I F + F+R Sbjct: 151 IGLHCKQLGMQFNFAPDIDINTNPNNPIIG-NRSFGEDKENVTQKGLAFTRGMQ 203 >gi|220934924|ref|YP_002513823.1| beta-N-acetylhexosaminidase [Thioalkalivibrio sp. HL-EbGR7] gi|254766763|sp|B8GSD2|NAGZ_THISH RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|219996234|gb|ACL72836.1| beta-N-acetylhexosaminidase [Thioalkalivibrio sp. HL-EbGR7] Length = 347 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L G++ +F+PVLDL +G I F R P + A + Sbjct: 108 MAAELRAVGVDFSFAPVLDLAHGVSGVIG--DRAFHRNPEVVADLAHHYMSGMQ 159 >gi|239979548|ref|ZP_04702072.1| putative beta-N-acetylglucosaminidase [Streptomyces albus J1074] gi|291451416|ref|ZP_06590806.1| beta-N-acetylglucosaminidase [Streptomyces albus J1074] gi|291354365|gb|EFE81267.1| beta-N-acetylglucosaminidase [Streptomyces albus J1074] Length = 618 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GI N++P D+ P + FS P + + Y Sbjct: 192 GAELAALGILQNYAPDADVNVNPANPVIGV-RSFSSDPQVVADLVAAQVKGYQ 243 >gi|320008638|gb|ADW03488.1| glycoside hydrolase family 3 domain protein [Streptomyces flavogriseus ATCC 33331] Length = 507 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+N+N++P D+ P + F + Sbjct: 114 LGRRLAECGVNLNWAPSADVNSNPGNPVIGV-RSFGADTGLVARHTAAYVEGLQ 166 >gi|239944182|ref|ZP_04696119.1| putative sugar hydrolase [Streptomyces roseosporus NRRL 15998] gi|239990638|ref|ZP_04711302.1| putative sugar hydrolase [Streptomyces roseosporus NRRL 11379] Length = 509 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+N+N++P D+ P + F A + Sbjct: 114 LGRRLAECGVNLNWAPSADVNSNPGNPVIGV-RSFGADTRLAARHTAAYIEGLQ 166 >gi|83945766|ref|ZP_00958110.1| glycosyl hyrolase, family 3 [Oceanicaulis alexandrii HTCC2633] gi|83850856|gb|EAP88717.1| glycosyl hyrolase, family 3 [Oceanicaulis alexandrii HTCC2633] Length = 359 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 19/52 (36%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ L SG ++N +PV DL + I + F P F Sbjct: 135 AQELAQSGFSMNLAPVADLQHEGNQVIDRWARAFGDDPETVAAYCGAFIDAM 186 >gi|16077234|ref|NP_388047.1| beta-hexosaminidase, lipoprotein [Bacillus subtilis subsp. subtilis str. 168] gi|221307980|ref|ZP_03589827.1| hypothetical protein Bsubs1_00943 [Bacillus subtilis subsp. subtilis str. 168] gi|221312302|ref|ZP_03594107.1| hypothetical protein BsubsN3_00865 [Bacillus subtilis subsp. subtilis str. NCIB 3610] gi|221317236|ref|ZP_03598530.1| hypothetical protein BsubsJ_00948 [Bacillus subtilis subsp. subtilis str. JH642] gi|221321499|ref|ZP_03602793.1| hypothetical protein BsubsS_00946 [Bacillus subtilis subsp. subtilis str. SMY] gi|732403|sp|P40406|YBBD_BACSU RecName: Full=Uncharacterized lipoprotein ybbD; AltName: Full=ORF1; Flags: Precursor gi|218681747|pdb|3BMX|A Chain A, Beta-N-Hexosaminidase (Ybbd) From Bacillus Subtilis gi|218681748|pdb|3BMX|B Chain B, Beta-N-Hexosaminidase (Ybbd) From Bacillus Subtilis gi|226438185|pdb|3CQM|A Chain A, Structure Of Ybbd In Complex With Pugnac gi|226438186|pdb|3CQM|B Chain B, Structure Of Ybbd In Complex With Pugnac gi|302148891|pdb|3NVD|A Chain A, Structure Of Ybbd In Complex With Pugnac gi|302148892|pdb|3NVD|B Chain B, Structure Of Ybbd In Complex With Pugnac gi|438455|gb|AAA64351.1| unknown [Bacillus subtilis] gi|1944006|dbj|BAA19499.1| YbbD [Bacillus subtilis] gi|2632433|emb|CAB11942.1| putative beta-hexosaminidase, putative lipoprotein [Bacillus subtilis subsp. subtilis str. 168] Length = 642 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K L GIN +FSPV+D+ P+ + FS + Sbjct: 160 IGKELSALGINTDFSPVVDINNNPDNPVIGV-RSFSSNRELTSRLGLYTMKGLQ 212 >gi|257069658|ref|YP_003155913.1| beta-glucosidase-like glycosyl hydrolase [Brachybacterium faecium DSM 4810] gi|256560476|gb|ACU86323.1| beta-glucosidase-like glycosyl hydrolase [Brachybacterium faecium DSM 4810] Length = 519 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L ++++ +PVLD+ P + F P + A+ F+ I+ Sbjct: 109 LGDVLAACDVDLDLAPVLDVSTDPANPVIGT-RAFGDDPDRVAAHARAFATGLIE 162 >gi|298491655|ref|YP_003721832.1| family 3 glycoside hydrolase domain-containing protein ['Nostoc azollae' 0708] gi|298233573|gb|ADI64709.1| glycoside hydrolase family 3 domain protein ['Nostoc azollae' 0708] Length = 363 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L + GINV++SPV D+ P+ I F P A + A+ + R + Sbjct: 114 ACELRSLGINVSWSPVADIFSNPQNPIIGP-RAFGTTPETASQRAREYYRGLKQ 166 >gi|167563049|ref|ZP_02355965.1| beta-N-Acetylglucosaminidase [Burkholderia oklahomensis EO147] Length = 687 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G NVNF+PV+D+ P + F PA + ++ Sbjct: 173 LAAEIAAVGFNVNFAPVVDVNSNPLNPVINV-RSFGDDPATISLLGRRMAQGMK 225 >gi|168070903|ref|XP_001786980.1| predicted protein [Physcomitrella patens subsp. patens] gi|162660022|gb|EDQ48206.1| predicted protein [Physcomitrella patens subsp. patens] Length = 376 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEES 45 + L G+ VNF+PVLD+ P+ I FS P Sbjct: 334 GEELKALGLQVNFAPVLDINSNPDNPIIGM-RSFSSDPDLVTRL 376 >gi|148240555|ref|YP_001225942.1| beta-galactosidase [Synechococcus sp. WH 7803] gi|147849094|emb|CAK24645.1| Beta-glycosidase of family GH3; possible N-acetyl b-glucosaminidase [Synechococcus sp. WH 7803] Length = 541 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N +PV D+ P + + + P A A+ F R Sbjct: 116 ADQARRCGLNWVLAPVCDVNSNPANPVINV-RAWGQAPEAAGALAEAFQRGLQ 167 >gi|313147643|ref|ZP_07809836.1| beta-N-acetylglucosaminidase [Bacteroides fragilis 3_1_12] gi|313136410|gb|EFR53770.1| beta-N-acetylglucosaminidase [Bacteroides fragilis 3_1_12] Length = 999 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA+ G+ VNF+PV D+ P+ + F P + + ++ Sbjct: 158 MARQCRELGVQVNFAPVADVNINPDNPVINT-RSFGEGPMQVADKVIAYASGL 209 >gi|255009857|ref|ZP_05281983.1| putative hydrolase/beta lactamase fusion protein [Bacteroides fragilis 3_1_12] Length = 1015 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA+ G+ VNF+PV D+ P+ + F P + + ++ Sbjct: 174 MARQCRELGVQVNFAPVADVNINPDNPVINT-RSFGEGPMQVADKVIAYASGL 225 >gi|239907198|ref|YP_002953939.1| putative beta-N-acetylhexosaminidase [Desulfovibrio magneticus RS-1] gi|239797064|dbj|BAH76053.1| putative beta-N-acetylhexosaminidase [Desulfovibrio magneticus RS-1] Length = 568 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEES 45 A+ L GINVNF+PV D+ P + F PA Sbjct: 151 ARELRAVGINVNFAPVADVNVNPANPVIGI-RSFGSAPADVARF 193 >gi|299530664|ref|ZP_07044079.1| glycoside hydrolase, family 3-like protein [Comamonas testosteroni S44] gi|298721180|gb|EFI62122.1| glycoside hydrolase, family 3-like protein [Comamonas testosteroni S44] Length = 367 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G++ +F+PVLDL YG + I F R P A+ + ++ Sbjct: 124 LGTELRACGVDFSFTPVLDLDYGESSVIG--DRSFHRDPRVVAALARSLMQGLLQ 176 >gi|291447653|ref|ZP_06587043.1| sugar hydrolase [Streptomyces roseosporus NRRL 15998] gi|291350600|gb|EFE77504.1| sugar hydrolase [Streptomyces roseosporus NRRL 15998] Length = 499 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+N+N++P D+ P + F A + Sbjct: 104 LGRRLAECGVNLNWAPSADVNSNPGNPVIGV-RSFGADTRLAARHTAAYIEGLQ 156 >gi|78778263|ref|YP_394578.1| Beta-N-acetylhexosaminidase [Sulfurimonas denitrificans DSM 1251] gi|78498803|gb|ABB45343.1| Beta-N-acetylhexosaminidase [Sulfurimonas denitrificans DSM 1251] Length = 358 Score = 61.3 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIA-QKRSIFSRIPAKAEESAQLFSRTY 53 +AK L +GIN NF+PV+DL P + + ++ + A++F + Sbjct: 135 LAKTLRQNGINCNFAPVVDLALNPNNKVIYGLNRSYGAASSEVIKYAKIFMDSL 188 >gi|254418135|ref|ZP_05031859.1| Glycosyl hydrolase family 3 N terminal domain protein [Brevundimonas sp. BAL3] gi|196184312|gb|EDX79288.1| Glycosyl hydrolase family 3 N terminal domain protein [Brevundimonas sp. BAL3] Length = 349 Score = 61.3 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA +L GINV+ PVLD+ I + + PA + + + Sbjct: 108 MAHDLREVGINVDLLPVLDVPVPGSHDIVG-DRAYGQDPATVALLGRAAAEGLL 160 >gi|115396536|ref|XP_001213907.1| predicted protein [Aspergillus terreus NIH2624] gi|114193476|gb|EAU35176.1| predicted protein [Aspergillus terreus NIH2624] Length = 822 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN+N++PV D+ P + F P+ A +R + Sbjct: 76 GETLNVFGINMNYAPVCDINSEPLNPVIGV-RSFGDDPSLVGRFASASARGLRE 128 >gi|78189925|ref|YP_380263.1| glycosy hydrolase family protein [Chlorobium chlorochromatii CaD3] gi|78172124|gb|ABB29220.1| glycosyl hydrolase, family 3 [Chlorobium chlorochromatii CaD3] Length = 374 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYI 54 +AK L +N+NF+PV DL P + K FS A+A +L + TY Sbjct: 148 IAKTLRAMHVNMNFAPVADLNRNPNNPVIGKVERSFSADAARATTHIRLTADTYR 202 >gi|264677122|ref|YP_003277028.1| glycoside hydrolase, family 3-like protein [Comamonas testosteroni CNB-2] gi|262207634|gb|ACY31732.1| glycoside hydrolase, family 3-like protein [Comamonas testosteroni CNB-2] Length = 364 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G++ +F+PVLDL YG + I F R P A+ + ++ Sbjct: 121 LGTELRACGVDFSFTPVLDLDYGESSVIG--DRSFHRDPRVVATLARSLMQGLLQ 173 >gi|212526346|ref|XP_002143330.1| beta-N-acetylglucosaminidase, putative [Penicillium marneffei ATCC 18224] gi|210072728|gb|EEA26815.1| beta-N-acetylglucosaminidase, putative [Penicillium marneffei ATCC 18224] Length = 877 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN+N++PV D+ P + F P + + +R + Sbjct: 120 GEMLSFFGINMNYAPVCDVNSEPLNPVIGV-RSFGDNPNFVAKMSSATARGLRE 172 >gi|220922164|ref|YP_002497465.1| glycoside hydrolase family 3 domain-containing protein [Methylobacterium nodulans ORS 2060] gi|219946770|gb|ACL57162.1| glycoside hydrolase family 3 domain protein [Methylobacterium nodulans ORS 2060] Length = 339 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA +L + G+NV+ +PVLD+ + + P + + ++ Sbjct: 108 MAHDLASVGVNVDCAPVLDVPVAGANEVIG-DRAYGTEPEAVAAIGRAVAEGLME 161 >gi|158317032|ref|YP_001509540.1| glycoside hydrolase family 3 protein [Frankia sp. EAN1pec] gi|158112437|gb|ABW14634.1| glycoside hydrolase family 3 domain protein [Frankia sp. EAN1pec] Length = 656 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +L GINV+F+P D+ P + F P Y + Sbjct: 251 GADLRALGINVDFAPDADVNSDPANPVIG-ERSFGDDPTAVGRFTAAAVEGYRQ 303 >gi|78485640|ref|YP_391565.1| glycoside hydrolase family protein [Thiomicrospira crunogena XCL-2] gi|97180247|sp|Q31G32|NAGZ_THICR RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|78363926|gb|ABB41891.1| beta-hexosaminidase [Thiomicrospira crunogena XCL-2] Length = 357 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ G++ +F+PV+DL YG I F P + + + Sbjct: 116 MATELLAVGVDFSFAPVVDLDYGDSRVIG--DRAFDSDPVIVGKLGKALVQGMRD 168 >gi|302557773|ref|ZP_07310115.1| sugar hydrolase [Streptomyces griseoflavus Tu4000] gi|302475391|gb|EFL38484.1| sugar hydrolase [Streptomyces griseoflavus Tu4000] Length = 496 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+N N++P D+ P+ + F A + Sbjct: 114 LGRRLAECGVNFNWAPSADVNADPDNPVIGV-RSFGGDTALVARHTAAYVEGLQ 166 >gi|311746000|ref|ZP_07719785.1| glycosyl hydrolase [Algoriphagus sp. PR1] gi|126576214|gb|EAZ80492.1| glycosyl hydrolase [Algoriphagus sp. PR1] Length = 520 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M + T GI++N +P D+ P + + A + Sbjct: 131 MGLEMKTVGIHLNLAPCADVNTNPLNPVIG-YRSYGSDTNHVARLALAAYKGLN 183 >gi|260220756|emb|CBA28639.1| Beta-hexosaminidase [Curvibacter putative symbiont of Hydra magnipapillata] Length = 367 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G++++F+PVLDL YG + I F+R P A+ K Sbjct: 120 LGAELRACGVDMSFTPVLDLDYGESSVIG--DRAFARDPRVVSMLAKSLMHGLQK 172 >gi|183980527|ref|YP_001848818.1| lipoprotein LpqI [Mycobacterium marinum M] gi|183173853|gb|ACC38963.1| conserved lipoprotein LpqI [Mycobacterium marinum M] Length = 397 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI V+ +PV+D+ P+ + F P E A ++R Sbjct: 172 GRKMKELGITVDLAPVVDVTDAPDDTVIG-DRSFGSNPETVTEYAGAYARGLRD 224 >gi|300771637|ref|ZP_07081512.1| B-glycosidase [Sphingobacterium spiritivorum ATCC 33861] gi|300761626|gb|EFK58447.1| B-glycosidase [Sphingobacterium spiritivorum ATCC 33861] Length = 569 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK+ G++ NF+PV+D+ P+ + F + A+ + + Sbjct: 152 AKDFHRIGMHFNFAPVVDINNNPKNPVINF-RSFGDNKYNVVKKAKAYMDGMVD 204 >gi|302337679|ref|YP_003802885.1| glycoside hydrolase [Spirochaeta smaragdinae DSM 11293] gi|301634864|gb|ADK80291.1| glycoside hydrolase family 3 domain protein [Spirochaeta smaragdinae DSM 11293] Length = 500 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + + GI+ N +PV+D+ P FS A F+ K Sbjct: 107 LGQEMKAVGIDWNLAPVVDINSNPLNPAIGI-RSFSENADVVIAYASQFAAGLEK 160 >gi|296269085|ref|YP_003651717.1| family 3 glycoside hydrolase domain-containing protein [Thermobispora bispora DSM 43833] gi|296091872|gb|ADG87824.1| glycoside hydrolase family 3 domain protein [Thermobispora bispora DSM 43833] Length = 492 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L G+N++ PV D+ + + F R Sbjct: 123 IAAELAACGVNLDMGPVADINTADDNPVIGT-RSFGSSADLVARHTVAAVRGLQ 175 >gi|227535930|ref|ZP_03965979.1| glycoside hydrolase [Sphingobacterium spiritivorum ATCC 33300] gi|227244173|gb|EEI94188.1| glycoside hydrolase [Sphingobacterium spiritivorum ATCC 33300] Length = 569 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK+ G++ NF+PV+D+ P+ + F + A+ + + Sbjct: 152 AKDFHRIGMHFNFAPVVDINNNPKNPVINF-RSFGDNKYNVVKKAKAYMDGMVD 204 >gi|319792230|ref|YP_004153870.1| glycoside hydrolase family 3 domain protein [Variovorax paradoxus EPS] gi|315594693|gb|ADU35759.1| glycoside hydrolase family 3 domain protein [Variovorax paradoxus EPS] Length = 370 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+ +F+PVLDL YG + I F R P A+ ++ Sbjct: 115 LAGELRACGIDFSFAPVLDLDYGGSSVIG--DRSFHRDPRVVSLLAKSVMHGMLQ 167 >gi|118616880|ref|YP_905212.1| lipoprotein LpqI [Mycobacterium ulcerans Agy99] gi|118568990|gb|ABL03741.1| conserved lipoprotein LpqI [Mycobacterium ulcerans Agy99] Length = 397 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI V+ +PV+D+ P+ + F P E A ++R Sbjct: 172 GRKMKELGITVDLAPVVDVTDAPDDTVIG-DRSFGSNPETVTEYAGAYARGLRD 224 >gi|321313839|ref|YP_004206126.1| putative beta-hexosaminidase, putative lipoprotein [Bacillus subtilis BSn5] gi|320020113|gb|ADV95099.1| putative beta-hexosaminidase, putative lipoprotein [Bacillus subtilis BSn5] Length = 642 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K L GIN +FSPV+D+ P+ + FS + Sbjct: 160 IGKELSALGINTDFSPVVDINNNPDNPVIGV-RSFSSNRELTSRLGLYTMKGLQ 212 >gi|269468670|gb|EEZ80306.1| beta-glucosidase-related glycosidase [uncultured SUP05 cluster bacterium] Length = 323 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L+ +G++ +F+PVLDL YG + I F P + A + Sbjct: 102 LAAELLETGVDFSFAPVLDLDYGNSSVIG--DRAFHSNPEVVVKLAGSLIDGMHE 154 >gi|154487165|ref|ZP_02028572.1| hypothetical protein BIFADO_01005 [Bifidobacterium adolescentis L2-32] gi|154085028|gb|EDN84073.1| hypothetical protein BIFADO_01005 [Bifidobacterium adolescentis L2-32] Length = 409 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLD---LLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L +GINV+ +PV+ + I F PA + A+ F + Sbjct: 186 GTQLKAAGINVDLAPVVGTVTVDRSSNAPIGALYRDFGLDPAGNADHAKAFIQGMSD 242 >gi|302498708|ref|XP_003011351.1| beta-glucosidase [Arthroderma benhamiae CBS 112371] gi|291174901|gb|EFE30711.1| beta-glucosidase [Arthroderma benhamiae CBS 112371] Length = 885 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN+N++PV D+ P + A F+ + Sbjct: 149 GEMLDALGINMNYAPVCDVNSEPSNPVIGI-RSPGDDGVSVGRIASAFATGLRE 201 >gi|221068683|ref|ZP_03544788.1| Beta-N-acetylhexosaminidase [Comamonas testosteroni KF-1] gi|220713706|gb|EED69074.1| Beta-N-acetylhexosaminidase [Comamonas testosteroni KF-1] Length = 364 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G++ +F+PVLDL YG + I F R P A+ + ++ Sbjct: 121 LGTELRACGVDFSFTPVLDLDYGESSVIG--DRSFHRDPRVVATLARSLMQGLLQ 173 >gi|255009858|ref|ZP_05281984.1| beta-N-acetylglucosaminidase [Bacteroides fragilis 3_1_12] gi|313147644|ref|ZP_07809837.1| beta-N-acetylglucosaminidase [Bacteroides fragilis 3_1_12] gi|313136411|gb|EFR53771.1| beta-N-acetylglucosaminidase [Bacteroides fragilis 3_1_12] Length = 995 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G++VNF+P D+ P+ + F P E + R Sbjct: 151 AREFREMGVHVNFAPDADVNTNPDNPVIHV-RSFGENPEAVAEKVIAYGRGL 201 >gi|317144070|ref|XP_001819886.2| beta-N-acetylglucosaminidase [Aspergillus oryzae RIB40] Length = 867 Score = 60.6 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN+N++PV D+ P + F P A ++ + Sbjct: 117 GETLRLFGINMNYAPVCDINSEPLNPVIGV-RSFGDHPGLVGRLACATAQGLRE 169 >gi|238486698|ref|XP_002374587.1| beta-N-acetylglucosaminidase, putative [Aspergillus flavus NRRL3357] gi|220699466|gb|EED55805.1| beta-N-acetylglucosaminidase, putative [Aspergillus flavus NRRL3357] Length = 835 Score = 60.6 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN+N++PV D+ P + F P A ++ + Sbjct: 85 GETLRLFGINMNYAPVCDINSEPLNPVIGV-RSFGDHPGLVGRLACATAQGLRE 137 >gi|119025658|ref|YP_909503.1| B-hexosaminidase [Bifidobacterium adolescentis ATCC 15703] gi|118765242|dbj|BAF39421.1| possible B-hexosaminidase [Bifidobacterium adolescentis ATCC 15703] Length = 432 Score = 60.6 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLD---LLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L +GINV+ +PV+ + I F PA + A+ F + Sbjct: 209 GTQLKAAGINVDLAPVVGTVTVDRSSNAPIGALYRDFGLDPAGNADHAKAFIQGMSD 265 >gi|34495714|ref|NP_899929.1| glycosyl hydrolase family protein [Chromobacterium violaceum ATCC 12472] gi|34101569|gb|AAQ57938.1| probable glycosyl hyrolase, family 3 [Chromobacterium violaceum ATCC 12472] Length = 505 Score = 60.6 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ L + G+N NF+PVLDL P + F PA+A A+ + ++ Sbjct: 112 ARGLKSLGVNWNFAPVLDLNNNPANPVIG-ERSFGADPARAAALARAWMEGHL 163 >gi|251795490|ref|YP_003010221.1| beta-N-acetylhexosaminidase [Paenibacillus sp. JDR-2] gi|247543116|gb|ACT00135.1| Beta-N-acetylhexosaminidase [Paenibacillus sp. JDR-2] Length = 535 Score = 60.6 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L G+ +N++P LD+ P+ + + E + Y Sbjct: 120 GEELRLLGVTMNYAPCLDVNNNPDNPVINV-RSYGDRAQIVSELGKAALLGYQ 171 >gi|329937896|ref|ZP_08287378.1| beta-N-acetylhexosaminidase [Streptomyces griseoaurantiacus M045] gi|329302853|gb|EGG46742.1| beta-N-acetylhexosaminidase [Streptomyces griseoaurantiacus M045] Length = 623 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GI ++SPV D+ P + F P + Y Sbjct: 197 GTELRALGIRQDYSPVADVNVNPANPVIGV-RSFGADPEAVAGMVAAEVKGYQ 248 >gi|254428590|ref|ZP_05042297.1| Glycosyl hydrolase family 3 N terminal domain protein [Alcanivorax sp. DG881] gi|196194759|gb|EDX89718.1| Glycosyl hydrolase family 3 N terminal domain protein [Alcanivorax sp. DG881] Length = 348 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L I+++F+PVLDL YG + I F A F Sbjct: 118 MASELTELDIDISFAPVLDLDYGNSSVIG--DRSFHGDADAMIALAGAFIDGM 168 >gi|110833879|ref|YP_692738.1| Beta-hexosaminidase [Alcanivorax borkumensis SK2] gi|110646990|emb|CAL16466.1| Beta-hexosaminidase [Alcanivorax borkumensis SK2] Length = 345 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L I+++F+PVLDL YG + I F A F Sbjct: 118 MASELTELDIDISFAPVLDLDYGNSSVIG--DRSFHGDADAMIALAGAFIDGM 168 >gi|265765223|ref|ZP_06093498.1| beta-N-acetylglucosaminidase/beta-lactamase fusion protein [Bacteroides sp. 2_1_16] gi|263254607|gb|EEZ26041.1| beta-N-acetylglucosaminidase/beta-lactamase fusion protein [Bacteroides sp. 2_1_16] Length = 996 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ L G +VNF+P D+ PE + F P E + R Sbjct: 151 ARELREIGAHVNFAPDADVNTNPENPVIHV-RSFGENPKTVAEKVIAYGRGL 201 >gi|253564089|ref|ZP_04841546.1| beta-N-acetylglucosaminidase/beta-lactamase fusion protein [Bacteroides sp. 3_2_5] gi|251947865|gb|EES88147.1| beta-N-acetylglucosaminidase/beta-lactamase fusion protein [Bacteroides sp. 3_2_5] gi|301161613|emb|CBW21153.1| possible beta-N-acetylglucosaminidase/beta-lactamase fusion protein [Bacteroides fragilis 638R] Length = 996 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ L G +VNF+P D+ PE + F P E + R Sbjct: 151 ARELREIGAHVNFAPDADVNTNPENPVIHV-RSFGENPKTVAEKVIAYGRGL 201 >gi|60680085|ref|YP_210229.1| beta-N-acetylglucosaminidase/beta-lactamase fusion protein [Bacteroides fragilis NCTC 9343] gi|60491519|emb|CAH06271.1| possible beta-N-acetylglucosaminidase/beta-lactamase fusion protein [Bacteroides fragilis NCTC 9343] Length = 996 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ L G +VNF+P D+ PE + F P E + R Sbjct: 151 ARELREIGAHVNFAPDADVNTNPENPVIHV-RSFGENPKTVAEKVIAYGRGL 201 >gi|53711857|ref|YP_097849.1| beta-N-acetylglucosaminidase [Bacteroides fragilis YCH46] gi|52214722|dbj|BAD47315.1| beta-N-acetylglucosaminidase [Bacteroides fragilis YCH46] Length = 996 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ L G +VNF+P D+ PE + F P E + R Sbjct: 151 ARELREIGAHVNFAPDADVNTNPENPVIHV-RSFGENPKTVAEKVIAYGRGL 201 >gi|262196364|ref|YP_003267573.1| glycoside hydrolase [Haliangium ochraceum DSM 14365] gi|262079711|gb|ACY15680.1| glycoside hydrolase family 3 domain protein [Haliangium ochraceum DSM 14365] Length = 387 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + L I+V+F+PVLD+ P + K S P + + +R Sbjct: 126 LGHELAALEIDVDFAPVLDVHTNPANPVIGK-RALSSDPEQVAQRGLALARGL 177 >gi|41409786|ref|NP_962622.1| LpqI [Mycobacterium avium subsp. paratuberculosis K-10] gi|41398618|gb|AAS06238.1| LpqI [Mycobacterium avium subsp. paratuberculosis K-10] Length = 388 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K + GI V+F+PV+D+ P+ + F PAK E A +++ Sbjct: 163 GKKMRDLGITVDFAPVVDVSDEPDDAVIG-NRSFGADPAKVTEYAGAYAQGLRD 215 >gi|257458258|ref|ZP_05623408.1| glycosyl hydrolase, family 3 [Treponema vincentii ATCC 35580] gi|257444368|gb|EEV19461.1| glycosyl hydrolase, family 3 [Treponema vincentii ATCC 35580] Length = 520 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + L G+N + +PVLD+ P+ + + PA + R Sbjct: 115 GEILRAHGVNFDLAPVLDVNSNPKNPVIGV-RSYGDNPALVDRYGIQMIRGL 165 >gi|317478618|ref|ZP_07937775.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bacteroides sp. 4_1_36] gi|316905259|gb|EFV27056.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bacteroides sp. 4_1_36] Length = 1004 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G++VNF+P D+ P + F P + E +SR Sbjct: 156 ARQFRELGVHVNFAPDADVNTNPLNPVIHV-RSFGENPQRVAEKVVAYSRGL 206 >gi|290770245|gb|ADD62001.1| carbohydrate-active enzyme [uncultured organism] Length = 962 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G++VNF+P D+ P + F P + E +SR Sbjct: 114 ARQFRELGVHVNFAPDADVNTNPLNPVIHV-RSFGENPQRVAEKVVAYSRGL 164 >gi|270295635|ref|ZP_06201836.1| beta-N-acetylglucosaminidase [Bacteroides sp. D20] gi|270274882|gb|EFA20743.1| beta-N-acetylglucosaminidase [Bacteroides sp. D20] Length = 1003 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G++VNF+P D+ P + F P + E +SR Sbjct: 155 ARQFRELGVHVNFAPDADVNTNPLNPVIHV-RSFGENPQRVAEKVVAYSRGL 205 >gi|160887989|ref|ZP_02068992.1| hypothetical protein BACUNI_00393 [Bacteroides uniformis ATCC 8492] gi|156862488|gb|EDO55919.1| hypothetical protein BACUNI_00393 [Bacteroides uniformis ATCC 8492] Length = 1004 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G++VNF+P D+ P + F P + E +SR Sbjct: 156 ARQFRELGVHVNFAPDADVNTNPLNPVIHV-RSFGENPQRVAEKVVAYSRGL 206 >gi|189499160|ref|YP_001958630.1| glycoside hydrolase family 3 domain-containing protein [Chlorobium phaeobacteroides BS1] gi|189494601|gb|ACE03149.1| glycoside hydrolase family 3 domain protein [Chlorobium phaeobacteroides BS1] Length = 583 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ GI ++ P +DL P + + E + F N Sbjct: 164 IAQEAKALGIYHSYGPSVDLNTNPLNPVINT-RSYGDNIPLTIEMSNAFIDGLQSN 218 >gi|330466850|ref|YP_004404593.1| glycoside hydrolase family 3 protein [Verrucosispora maris AB-18-032] gi|328809821|gb|AEB43993.1| glycoside hydrolase family 3 protein [Verrucosispora maris AB-18-032] Length = 503 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L +G+ +N++P D+ P+ + F A + R Sbjct: 111 LGAELAAAGVTLNYAPDADVNSNPDNPVIGV-RSFGADAALVARHTTAWVRGLQ 163 >gi|163814622|ref|ZP_02206011.1| hypothetical protein COPEUT_00773 [Coprococcus eutactus ATCC 27759] gi|158450257|gb|EDP27252.1| hypothetical protein COPEUT_00773 [Coprococcus eutactus ATCC 27759] Length = 416 Score = 60.6 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A ++ G N++F+PV D+ P+ + +S A+A E + + Sbjct: 198 IASDMSALGFNLDFAPVADVWSNPDNTVIG-DRAYSDDYAQAAELVGSAVKGFQD 251 >gi|239996479|ref|ZP_04717003.1| Beta-hexosaminidase A precursor [Alteromonas macleodii ATCC 27126] Length = 657 Score = 60.6 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L+ GIN NF+P +D+ P+ + FS P + Q F Sbjct: 189 IGQTLLPLGINTNFAPSVDVNSEPKNPVINV-RSFSENPEQVAALGQTFVSAMQ 241 >gi|85711959|ref|ZP_01043013.1| beta-hexosaminidase [Idiomarina baltica OS145] gi|85694145|gb|EAQ32089.1| beta-hexosaminidase [Idiomarina baltica OS145] Length = 334 Score = 60.6 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA+ + GI+++F+PVLD+ G I F+ + AQ F + Sbjct: 103 MAREVRAVGIDISFAPVLDIN-GCSEVIG--DRAFASDVQQVAHIAQAFIEGMHE 154 >gi|333026951|ref|ZP_08455015.1| putative beta-N-Acetylglucosaminidase [Streptomyces sp. Tu6071] gi|332746803|gb|EGJ77244.1| putative beta-N-Acetylglucosaminidase [Streptomyces sp. Tu6071] Length = 626 Score = 60.2 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G+ +++P D+ P + F P R Y + Sbjct: 201 ELAALGVRQDWAPDADVNVNPANPVIGV-RSFGADPDAVARLVVAQVRGYQE 251 >gi|260776254|ref|ZP_05885149.1| beta-hexosaminidase [Vibrio coralliilyticus ATCC BAA-450] gi|260607477|gb|EEX33742.1| beta-hexosaminidase [Vibrio coralliilyticus ATCC BAA-450] Length = 616 Score = 60.2 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +AK + + G NVNF+PV+D+ P + + P ++ Sbjct: 117 LAKEIKSVGFNVNFAPVVDVQSNPLNPVINV-RSYGEDPQLVGLLGGQSAKGMAD 170 >gi|74316745|ref|YP_314485.1| beta-hexosaminidase [Thiobacillus denitrificans ATCC 25259] gi|97180254|sp|Q3SKU2|NAGZ_THIDA RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|74056240|gb|AAZ96680.1| beta-N-acetylhexosaminidase [Thiobacillus denitrificans ATCC 25259] Length = 359 Score = 60.2 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L G++ +F+PVLDL YG + I F P + Q Sbjct: 108 LASELRAHGVDFSFAPVLDLDYGASSVIG--DRAFHADPQAVFQLGQAVMLGMKD 160 >gi|30250247|ref|NP_842317.1| beta-hexosaminidase [Nitrosomonas europaea ATCC 19718] gi|47605859|sp|Q82SJ8|NAGZ_NITEU RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|30181042|emb|CAD86232.1| Glycoside hydrolase family 3, N terminal [Nitrosomonas europaea ATCC 19718] Length = 348 Score = 60.2 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L G++++F+PVLDL YG I F R P + A Sbjct: 108 LAAELKACGVDLSFTPVLDLDYGQSCVIG--DRAFHREPQVVADLACALMNGLQ 159 >gi|295836576|ref|ZP_06823509.1| sugar hydrolase [Streptomyces sp. SPB74] gi|295826099|gb|EDY44224.2| sugar hydrolase [Streptomyces sp. SPB74] Length = 477 Score = 60.2 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G++ N++P D+ P+ + F + Sbjct: 114 LGRRLAACGVHFNWAPSADVNSDPDNPVIGV-RAFGADQDLVARHTVAYVEGLQ 166 >gi|332994610|gb|AEF04665.1| Beta-hexosaminidase A [Alteromonas sp. SN2] Length = 620 Score = 60.2 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +L + GIN NF+P +D+ P+ + F P+ Q F Sbjct: 165 IGSSLSSLGINTNFAPSVDINSEPKNPVINV-RSFGETPSDVAVLGQSFVDGLQ 217 >gi|254384735|ref|ZP_05000073.1| beta-N-acetylglucosaminidase [Streptomyces sp. Mg1] gi|194343618|gb|EDX24584.1| beta-N-acetylglucosaminidase [Streptomyces sp. Mg1] Length = 566 Score = 60.2 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L + GI +++PV D+ P + F P R Y Sbjct: 154 GTELASMGIRQDYAPVADVNVNPANPVIGV-RSFGSDPRAVAGLVAAQVRGYQ 205 >gi|318058522|ref|ZP_07977245.1| sugar hydrolase [Streptomyces sp. SA3_actG] Length = 626 Score = 60.2 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G+ +++P D+ P + F P R Y + Sbjct: 201 ELAALGVRQDWAPDADVNVNPANPVIGV-RSFGADPDAVARLVVAQVRGYQE 251 >gi|281417041|ref|ZP_06248061.1| glycoside hydrolase family 3 domain protein [Clostridium thermocellum JW20] gi|281408443|gb|EFB38701.1| glycoside hydrolase family 3 domain protein [Clostridium thermocellum JW20] Length = 444 Score = 60.2 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G N+NF+PV D+ P+ + F K Q S+ + Sbjct: 190 LGVELSALGFNMNFAPVADVNTNPDNPVIG-DRSFGSDSYKVGLMVQAMSKGMQE 243 >gi|298387861|ref|ZP_06997411.1| glycosyl hydrolase, family 3 [Bacteroides sp. 1_1_14] gi|298259466|gb|EFI02340.1| glycosyl hydrolase, family 3 [Bacteroides sp. 1_1_14] Length = 1001 Score = 60.2 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA+ V G+ VNF+PV D+ P+ + F P + + ++ Sbjct: 157 MARQCVQLGVQVNFAPVADVNINPKNPVINT-RSFGEDPVRVADKVVAYASGL 208 >gi|253572426|ref|ZP_04849828.1| beta-N-acetylglucosaminidase [Bacteroides sp. 1_1_6] gi|251837841|gb|EES65930.1| beta-N-acetylglucosaminidase [Bacteroides sp. 1_1_6] Length = 1001 Score = 60.2 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA+ V G+ VNF+PV D+ P+ + F P + + ++ Sbjct: 157 MARQCVQLGVQVNFAPVADVNINPKNPVINT-RSFGEDPVRVADKVVAYASGL 208 >gi|154174220|ref|YP_001408361.1| glycosyl hydrolase family protein [Campylobacter curvus 525.92] gi|112802602|gb|EAT99946.1| glycosyl hyrolase, family 3 [Campylobacter curvus 525.92] Length = 350 Score = 60.2 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 24/54 (44%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L SGINV+ +PV+DL I K FS +K A F + Sbjct: 132 MADELKQSGINVDLAPVVDLHDEASPIIGAKERAFSENASKVIFYANAFMDAFK 185 >gi|29829561|ref|NP_824195.1| beta-N-acetylhexosaminidase [Streptomyces avermitilis MA-4680] gi|29606669|dbj|BAC70730.1| putative beta-N-acetylhexosaminidase [Streptomyces avermitilis MA-4680] Length = 534 Score = 60.2 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+N+N++P D+ P + F + Sbjct: 114 LGRRLAECGVNLNWAPSADVNSNPGNPVIGV-RSFGADTDLVARHTAAYVTGLQ 166 >gi|29347849|ref|NP_811352.1| beta-N-acetylglucosaminidase [Bacteroides thetaiotaomicron VPI-5482] gi|29339751|gb|AAO77546.1| beta-N-acetylglucosaminidase [Bacteroides thetaiotaomicron VPI-5482] Length = 1001 Score = 60.2 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA+ V G+ VNF+PV D+ P+ + F P + + ++ Sbjct: 157 MARQCVQLGVQVNFAPVADVNINPKNPVINT-RSFGEDPVRVADKVVAYASGL 208 >gi|255534064|ref|YP_003094436.1| glycoside hydrolase family 3 domain-containing protein [Pedobacter heparinus DSM 2366] gi|255347048|gb|ACU06374.1| glycoside hydrolase family 3 domain protein [Pedobacter heparinus DSM 2366] Length = 568 Score = 60.2 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A++ G+++N +P +D+ P+ + F A + + Sbjct: 151 ARDYKRIGMHMNLAPDVDVNNNPKNPVINF-RSFGENKYNVATKAAAYMKGMQD 203 >gi|88799961|ref|ZP_01115532.1| probable beta-hexosamidase A [Reinekea sp. MED297] gi|88777239|gb|EAR08443.1| probable beta-hexosamidase A [Reinekea sp. MED297] Length = 559 Score = 60.2 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA+ G+N +F+PV+D+ + I + Q R + N Sbjct: 131 MAREARQLGLNWSFTPVIDVDDHFRSAIVGT-RSYGSDTDVIAALGQANIRAFQSN 185 >gi|289771502|ref|ZP_06530880.1| beta-N-acetylglucosaminidase [Streptomyces lividans TK24] gi|289701701|gb|EFD69130.1| beta-N-acetylglucosaminidase [Streptomyces lividans TK24] Length = 520 Score = 60.2 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GI ++SPV D+ P + F P E Y Sbjct: 200 GAELHALGIRQDYSPVADVNVNPANPVIGV-RSFGADPDAVAELVAAEVTGYQ 251 >gi|213963112|ref|ZP_03391370.1| family 3 glycosyl hydrolase/beta-lactamase fusion protein [Capnocytophaga sputigena Capno] gi|213954196|gb|EEB65520.1| family 3 glycosyl hydrolase/beta-lactamase fusion protein [Capnocytophaga sputigena Capno] Length = 970 Score = 60.2 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+ NF+P +D+ P+ I F + F+R Sbjct: 149 IGMHCKQLGMQFNFAPDIDINTNPDNPIIG-NRSFGEDKLNVAQKGLAFTRGMQ 201 >gi|118464303|ref|YP_884041.1| glycosyl hydrolase family protein 3 [Mycobacterium avium 104] gi|254777359|ref|ZP_05218875.1| glycosyl hydrolase family protein 3 [Mycobacterium avium subsp. avium ATCC 25291] gi|118165590|gb|ABK66487.1| Glycosyl hydrolase family protein 3 [Mycobacterium avium 104] Length = 388 Score = 60.2 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K + GI ++F+PV+D+ P+ + F PAK E A +++ Sbjct: 163 GKKMRDLGITIDFAPVVDVSDEPDDAVIG-NRSFGADPAKVTEYAGAYAQGLRD 215 >gi|21221210|ref|NP_626989.1| beta-N-acetylglucosaminidase [Streptomyces coelicolor A3(2)] gi|6714805|emb|CAB66297.1| beta-N-acetylglucosaminidase (putative secreted protein) [Streptomyces coelicolor A3(2)] Length = 615 Score = 60.2 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GI ++SPV D+ P + F P E Y Sbjct: 187 GAELHALGIRQDYSPVADVNVNPANPVIGV-RSFGADPDAVAELVAAEVTGYQ 238 >gi|302530829|ref|ZP_07283171.1| beta-N-Acetylglucosaminidase [Streptomyces sp. AA4] gi|302439724|gb|EFL11540.1| beta-N-Acetylglucosaminidase [Streptomyces sp. AA4] Length = 598 Score = 60.2 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN +++P D+ P + FS P A + Y Sbjct: 175 LGHELRAVGINQDYAPDADVNSNPANPVIGV-RSFSGRPDLASSFVTAEVKGYQD 228 >gi|256787609|ref|ZP_05526040.1| beta-N-acetylglucosaminidase (secreted protein) [Streptomyces lividans TK24] Length = 507 Score = 60.2 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GI ++SPV D+ P + F P E Y Sbjct: 187 GAELHALGIRQDYSPVADVNVNPANPVIGV-RSFGADPDAVAELVAAEVTGYQ 238 >gi|221235022|ref|YP_002517458.1| anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Caulobacter crescentus NA1000] gi|220964194|gb|ACL95550.1| anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Caulobacter crescentus NA1000] Length = 345 Score = 60.2 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A +L GINV+ PVLD+ I + P + + + + Sbjct: 115 IAHDLHALGINVDCVPVLDVPDPKGHEIIG-DRAYGDTPEQVATLGRAAAEGLL 167 >gi|92114189|ref|YP_574117.1| glycoside hydrolase family protein [Chromohalobacter salexigens DSM 3043] gi|91797279|gb|ABE59418.1| glycoside hydrolase, family 3-like protein [Chromohalobacter salexigens DSM 3043] Length = 340 Score = 60.2 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + G +V F+PVLD+ I FS P + F + Sbjct: 109 LGMEMAACGFDVTFAPVLDVDDQRSPAIG--DRSFSADPTVVAALGEAFIEGLHE 161 >gi|307324549|ref|ZP_07603756.1| glycoside hydrolase family 3 domain protein [Streptomyces violaceusniger Tu 4113] gi|306889793|gb|EFN20772.1| glycoside hydrolase family 3 domain protein [Streptomyces violaceusniger Tu 4113] Length = 640 Score = 60.2 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 9/51 (17%), Positives = 15/51 (29%), Gaps = 1/51 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GI +++P+ D+ P + F P Y Sbjct: 208 ELAALGIRQDYAPIADVNVNPANPVIGV-RSFGADPKAVARLVAAQVEGYQ 257 >gi|218885938|ref|YP_002435259.1| beta-N-acetylhexosaminidase [Desulfovibrio vulgaris str. 'Miyazaki F'] gi|218756892|gb|ACL07791.1| Beta-N-acetylhexosaminidase [Desulfovibrio vulgaris str. 'Miyazaki F'] Length = 586 Score = 60.2 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETF-IAQKRSIFSRIPAKAEESAQLFSRTY 53 M + L G+N+NF+PV+D+ P++ I + + P A F Sbjct: 316 MGRELADVGVNLNFAPVVDVDVNPDSPAIGRLGRAYGSDPRAVAAHAAAFINGM 369 >gi|152985094|ref|YP_001347526.1| beta-hexosaminidase [Pseudomonas aeruginosa PA7] gi|150960252|gb|ABR82277.1| beta-N-acetyl-D-glucosaminidase [Pseudomonas aeruginosa PA7] Length = 356 Score = 60.2 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + G++++F+PVLDL + + F P +A + A F R Sbjct: 125 MATEVQAVGLDLSFAPVLDLDHQRSAVVGS--RAFEGDPERAAQLAGAFIRGMH 176 >gi|300790612|ref|YP_003770903.1| beta-N-acetylhexosaminidase [Amycolatopsis mediterranei U32] gi|299800126|gb|ADJ50501.1| beta-N-acetylhexosaminidase [Amycolatopsis mediterranei U32] Length = 585 Score = 60.2 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L GIN +F+P D+ P + FS P A + + + Sbjct: 162 LGRELRAVGINQDFAPDSDVNSNPVNPVIGV-RSFSGQPGLASDFVTAEIKGFQD 215 >gi|297199845|ref|ZP_06917242.1| beta-N-acetylhexosaminidase [Streptomyces sviceus ATCC 29083] gi|197710311|gb|EDY54345.1| beta-N-acetylhexosaminidase [Streptomyces sviceus ATCC 29083] Length = 620 Score = 60.2 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L GI N+SPV D+ P + F P + Y Sbjct: 194 GQELKAIGIRQNYSPVADVNVNPANPVIGV-RSFGSEPQEVAGLVAAEVAGYQ 245 >gi|121595564|ref|YP_987460.1| beta-N-acetylhexosaminidase [Acidovorax sp. JS42] gi|222111785|ref|YP_002554049.1| beta-n-acetylhexosaminidase [Acidovorax ebreus TPSY] gi|120607644|gb|ABM43384.1| Beta-N-acetylhexosaminidase [Acidovorax sp. JS42] gi|221731229|gb|ACM34049.1| Beta-N-acetylhexosaminidase [Acidovorax ebreus TPSY] Length = 369 Score = 60.2 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G++ +F+PVLDL YG I F+R P A+ + ++ Sbjct: 123 LGSELRACGVDFSFTPVLDLDYGASGVIG--DRAFARDPRVVAMLARALMQGLLQ 175 >gi|285019294|ref|YP_003377005.1| beta-N-acetylhexosaminidase [Xanthomonas albilineans GPE PC73] gi|283474512|emb|CBA17013.1| probable beta-n-acetylhexosaminidase protein [Xanthomonas albilineans] Length = 335 Score = 60.2 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PVLDL G FS P A + R Sbjct: 104 MASEVRASGVDLSFAPVLDLARGNRAI---GDRAFSDDPQVVAAFAGAYVRGMH 154 >gi|322512570|gb|ADX05689.1| putative carbohydrate-active enzyme [uncultured organism] Length = 213 Score = 60.2 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ + GIN+NF+P +D+ P + F K A L+ + Sbjct: 109 ARQCIADGINLNFAPCIDVNNNPRNPVINS-RSFGENRDKVVTKAALYLKGMQD 161 >gi|257457193|ref|ZP_05622369.1| glycosyl hydrolase, family 3 [Treponema vincentii ATCC 35580] gi|257445452|gb|EEV20519.1| glycosyl hydrolase, family 3 [Treponema vincentii ATCC 35580] Length = 561 Score = 60.2 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L GIN+NF+P +DL E+ I F + P A A+ F + K Sbjct: 168 IGRELSALGINLNFAPTVDLYTNHESSIIGP-RSFGQSPEAAGILARAFMQGSNK 221 >gi|239926948|ref|ZP_04683901.1| secreted hydrolase [Streptomyces ghanaensis ATCC 14672] gi|291435296|ref|ZP_06574686.1| secreted hydrolase [Streptomyces ghanaensis ATCC 14672] gi|291338191|gb|EFE65147.1| secreted hydrolase [Streptomyces ghanaensis ATCC 14672] Length = 608 Score = 60.2 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L GI+ NF+PV D+ P I F + Y + Sbjct: 180 GTELAALGIHQNFAPVADVNVNPANPIINV-RSFGADAREVGRMVAAQVTGYQQ 232 >gi|254510391|ref|ZP_05122458.1| beta-N-acetylhexosaminidase [Rhodobacteraceae bacterium KLH11] gi|221534102|gb|EEE37090.1| beta-N-acetylhexosaminidase [Rhodobacteraceae bacterium KLH11] Length = 335 Score = 60.2 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L+ GI+ N +P++DL K + P + +R ++ Sbjct: 106 IAHELLALGIDSNCAPMVDLARDETHP-FLKNRCYGFDPDTVSRIGRAAARGHLD 159 >gi|319763840|ref|YP_004127777.1| glycoside hydrolase family 3 domain protein [Alicycliphilus denitrificans BC] gi|330823896|ref|YP_004387199.1| glycoside hydrolase family 3 domain-containing protein [Alicycliphilus denitrificans K601] gi|317118401|gb|ADV00890.1| glycoside hydrolase family 3 domain protein [Alicycliphilus denitrificans BC] gi|329309268|gb|AEB83683.1| glycoside hydrolase family 3 domain protein [Alicycliphilus denitrificans K601] Length = 360 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G++ +F+PVLDL +G I F R P A+ + ++ Sbjct: 117 LGSELRACGVDFSFTPVLDLDWGESGVIG--DRAFHRDPRVVAMLARALMQGLLQ 169 >gi|53803933|ref|YP_114416.1| beta-hexosaminidase [Methylococcus capsulatus str. Bath] gi|81681671|sp|Q606N2|NAGZ_METCA RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|53757694|gb|AAU91985.1| beta-N-acetylhexosaminidase [Methylococcus capsulatus str. Bath] Length = 334 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L G++ +F+PVLD+ G T I F+R P + +A+ F+ Sbjct: 98 MAAELRAVGVDFSFAPVLDVDSGISTVIG--DRAFARTPEEVTAAARAFATGMR 149 >gi|16126249|ref|NP_420813.1| glycosyl hydrolase family protein [Caulobacter crescentus CB15] gi|13423477|gb|AAK23981.1| glycosyl hydrolase, family 3 [Caulobacter crescentus CB15] Length = 341 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A +L GINV+ PVLD+ I + P + + + + Sbjct: 111 IAHDLHALGINVDCVPVLDVPDPKGHEIIG-DRAYGDTPEQVATLGRAAAEGLL 163 >gi|328882595|emb|CCA55834.1| Beta-hexosaminidase [Streptomyces venezuelae ATCC 10712] Length = 593 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L GI N++PV D+ P + F PA Y Sbjct: 166 GEELAAVGIRQNYAPVADVNVNPANPVIGV-RSFGSDPAAVAGLVAAQVTGYQ 217 >gi|332284706|ref|YP_004416617.1| beta-hexosaminidase [Pusillimonas sp. T7-7] gi|330428659|gb|AEC19993.1| beta-hexosaminidase [Pusillimonas sp. T7-7] Length = 352 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + L G++++F+PVLDL YG I F R P A+ + Sbjct: 118 LGAELRACGVDLSFTPVLDLDYGVSQVIG--NRSFHRDPRVVAMLARALIQGL 168 >gi|318081608|ref|ZP_07988923.1| sugar hydrolase [Streptomyces sp. SA3_actF] Length = 399 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G+ +++P D+ P + F P R Y + Sbjct: 96 ELAALGVRQDWAPDADVNVNPANPVIGV-RSFGADPDAVARLVVAQVRGYQE 146 >gi|160900688|ref|YP_001566270.1| beta-N-acetylhexosaminidase [Delftia acidovorans SPH-1] gi|160366272|gb|ABX37885.1| Beta-N-acetylhexosaminidase [Delftia acidovorans SPH-1] Length = 363 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G++ +F+PVLDL YG + I F R P A+ ++ Sbjct: 120 LGTELRACGVDFSFTPVLDLDYGASSVIG--DRSFHRDPRVVAALARSLMHGLLQ 172 >gi|160916221|ref|ZP_02078428.1| hypothetical protein EUBDOL_02248 [Eubacterium dolichum DSM 3991] gi|158431945|gb|EDP10234.1| hypothetical protein EUBDOL_02248 [Eubacterium dolichum DSM 3991] Length = 959 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 + L G+N+NF PV D+ P + FS P + A + KN Sbjct: 183 IGSELSAIGVNMNFGPVTDVNNNPNNPVIGL-RSFSSDPQIVSKFANAYIEGVQSKN 238 >gi|317478619|ref|ZP_07937776.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bacteroides sp. 4_1_36] gi|316905260|gb|EFV27057.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bacteroides sp. 4_1_36] Length = 1013 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G+ VNF+PV D+ P+ + F P +S+ Sbjct: 165 ARQCRELGVQVNFAPVADVNINPKNPVINT-RSFGESPFNVANKVVAYSKGLED 217 >gi|290769616|gb|ADD61397.1| putative carbohydrate-active enzyme [uncultured organism] gi|290770246|gb|ADD62002.1| putative carbohydrate-active enzyme [uncultured organism] Length = 958 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G+ VNF+PV D+ P+ + F P +S+ Sbjct: 110 ARQCRELGVQVNFAPVADVNINPKNPVINT-RSFGESPFNVANKVVAYSKGLED 162 >gi|160887988|ref|ZP_02068991.1| hypothetical protein BACUNI_00392 [Bacteroides uniformis ATCC 8492] gi|270295636|ref|ZP_06201837.1| conserved hypothetical protein [Bacteroides sp. D20] gi|156862487|gb|EDO55918.1| hypothetical protein BACUNI_00392 [Bacteroides uniformis ATCC 8492] gi|270274883|gb|EFA20744.1| conserved hypothetical protein [Bacteroides sp. D20] Length = 1014 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G+ VNF+PV D+ P+ + F P +S+ Sbjct: 166 ARQCRELGVQVNFAPVADVNINPKNPVINT-RSFGESPFNVANKVVAYSKGLED 218 >gi|84495176|ref|ZP_00994295.1| beta-N-acetylglucosaminidase (putative secreted protein) [Janibacter sp. HTCC2649] gi|84384669|gb|EAQ00549.1| beta-N-acetylglucosaminidase (putative secreted protein) [Janibacter sp. HTCC2649] Length = 601 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN NF+PV D+ + FS PA E Y + Sbjct: 177 GQELRALGINTNFAPVADVNVNALNPVIGT-RSFSGNPALTAELVAAQVAGYQQ 229 >gi|160942077|ref|ZP_02089392.1| hypothetical protein CLOBOL_06965 [Clostridium bolteae ATCC BAA-613] gi|158434968|gb|EDP12735.1| hypothetical protein CLOBOL_06965 [Clostridium bolteae ATCC BAA-613] Length = 447 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L GIN++F+P D+L P+ + F P + + + + ++ Sbjct: 226 IGGYLEEFGINLDFAPDADVLTNPDNTVV-LDRSFGSDPVLVTQMVKAYMKGLEEH 280 >gi|320537467|ref|ZP_08037414.1| glycosyl hydrolase family 3 protein [Treponema phagedenis F0421] gi|320145696|gb|EFW37365.1| glycosyl hydrolase family 3 protein [Treponema phagedenis F0421] Length = 553 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + + T GI++NF+P +DLL + I F P A F R Sbjct: 162 IGREIATLGIHINFAPAVDLLTNKNSSIIGP-RAFGDDPKSAGILGAAFMRGSRD 215 >gi|51473885|ref|YP_067642.1| beta-glucosidase [Rickettsia typhi str. Wilmington] gi|13235497|emb|CAC33759.1| hypothetical protein [Rickettsia typhi] gi|51460197|gb|AAU04160.1| possible beta-glucosidase [Rickettsia typhi str. Wilmington] Length = 314 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +AK L GIN+NF+PV DL++ I F + P + Sbjct: 111 IAKELREVGINLNFAPVADLIHDGADNII-SDRSFGKEPEIVVPLCLSAIEGLQE 164 >gi|134096977|ref|YP_001102638.1| beta-N-acetylglucosaminidase (putative secreted protein) [Saccharopolyspora erythraea NRRL 2338] gi|291006278|ref|ZP_06564251.1| beta-N-acetylglucosaminidase (putative secreted protein) [Saccharopolyspora erythraea NRRL 2338] gi|133909600|emb|CAL99712.1| beta-N-acetylglucosaminidase (putative secreted protein) [Saccharopolyspora erythraea NRRL 2338] Length = 577 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L G+ NF+P D+ P + FS PA A E R Y Sbjct: 157 GQELRAMGLAQNFAPSGDVNVNPANPVIGV-RSFSSDPALAAELTAAQVRGYQ 208 >gi|157362905|ref|YP_001469672.1| glycoside hydrolase family 3 protein [Thermotoga lettingae TMO] gi|157313509|gb|ABV32608.1| glycoside hydrolase family 3 domain protein [Thermotoga lettingae TMO] Length = 456 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 K + GIN+ F+PVLDL + + + P K E Y Sbjct: 96 GKFMKELGINMIFAPVLDLKFPETNPVIG-YRSYGSDPKKVSEFGLSAINGYK 147 >gi|297582527|ref|YP_003698307.1| glycoside hydrolase family 3 domain-containing protein [Bacillus selenitireducens MLS10] gi|297140984|gb|ADH97741.1| glycoside hydrolase family 3 domain protein [Bacillus selenitireducens MLS10] Length = 535 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L GIN N +PV D+ + FS P +A A K Sbjct: 118 ALELKALGINWNLAPVADVNNNRHNPVIGV-RSFSEDPEQAAAFAAASMNGMQK 170 >gi|305666546|ref|YP_003862833.1| glycosyl hydrolase, family 3 [Maribacter sp. HTCC2170] gi|88708814|gb|EAR01049.1| glycosyl hydrolase, family 3 [Maribacter sp. HTCC2170] Length = 526 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + +GI+ N SPV D+ P+ + F + + + Sbjct: 139 IAHDCKQAGIHYNLSPVSDINNNPDNPVIG-YRSFGENKFNVALKSIQYIKGMQ 191 >gi|119358346|ref|YP_912990.1| glycoside hydrolase family 3 protein [Chlorobium phaeobacteroides DSM 266] gi|119355695|gb|ABL66566.1| glycoside hydrolase, family 3 domain protein [Chlorobium phaeobacteroides DSM 266] Length = 375 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIK 55 A+ L T +++N +PV+DL E + K + FS P +A+ + + Sbjct: 149 AETLKTMHLSMNLAPVVDLNSNKENPVIGKLQRSFSDDPDVVTRNARATCNAFRE 203 >gi|297194285|ref|ZP_06911683.1| beta-N-acetylglucosaminidase [Streptomyces pristinaespiralis ATCC 25486] gi|197720575|gb|EDY64483.1| beta-N-acetylglucosaminidase [Streptomyces pristinaespiralis ATCC 25486] Length = 608 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 12/51 (23%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GI N++PV D+ P + F PA + Y Sbjct: 183 ELAAMGIVQNYAPVADVNINPANPVIGV-RSFGADPAAVARMVAAQVKGYQ 232 >gi|332982104|ref|YP_004463545.1| glycoside hydrolase family 3 domain-containing protein [Mahella australiensis 50-1 BON] gi|332699782|gb|AEE96723.1| glycoside hydrolase family 3 domain protein [Mahella australiensis 50-1 BON] Length = 471 Score = 59.4 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G N++F+PVLD+ P+ + F + P + Sbjct: 220 LGSEMKAYGFNLDFAPVLDIFSNPKNTVIG-DRSFGKDPYTVGRLGIATMKGIK 272 >gi|261407776|ref|YP_003244017.1| glycoside hydrolase family 3 domain-containing protein [Paenibacillus sp. Y412MC10] gi|261284239|gb|ACX66210.1| glycoside hydrolase family 3 domain protein [Paenibacillus sp. Y412MC10] Length = 439 Score = 59.4 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ + G+N+ F+PVLD+ P + F + + + Sbjct: 194 IAQKVAGLGLNMVFAPVLDIHSNPNNPVIG-DRSFGTTAETVTKHGIASMKGIQE 247 >gi|90416643|ref|ZP_01224573.1| beta-hexosaminidase [marine gamma proteobacterium HTCC2207] gi|90331396|gb|EAS46632.1| beta-hexosaminidase [marine gamma proteobacterium HTCC2207] Length = 333 Score = 59.4 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ G++++F+PVLD+ + I FS P + A F + Sbjct: 101 MAAEVIACGLDISFAPVLDVDRDTSSIIG--DRAFSDQPQLVTDVAAAFILGMKE 153 >gi|329927227|ref|ZP_08281525.1| beta-hexosaminidase A family protein [Paenibacillus sp. HGF5] gi|328938627|gb|EGG35010.1| beta-hexosaminidase A family protein [Paenibacillus sp. HGF5] Length = 447 Score = 59.4 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ + G+N+ F+PVLD+ P + F + + + Sbjct: 202 IAQKVAGLGLNMVFAPVLDIHSNPNNPVIG-DRSFGTTAETVTQHGIASMKGIQE 255 >gi|78187897|ref|YP_375940.1| glycosy hydrolase family protein [Chlorobium luteolum DSM 273] gi|78167799|gb|ABB24897.1| glycosyl hydrolase, family 3 [Chlorobium luteolum DSM 273] Length = 378 Score = 59.4 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYI 54 A+ L + G+N+N +PV+DL P+ + + +S P A + + T++ Sbjct: 151 ARTLQSMGVNMNLAPVVDLDTNPQNPVIGRIERSYSPDPDIVSSQAAIVTTTFL 204 >gi|15893009|ref|NP_360723.1| putative beta-glucosidase [Rickettsia conorii str. Malish 7] gi|229587065|ref|YP_002845566.1| Beta-glucosidase [Rickettsia africae ESF-5] gi|15620209|gb|AAL03624.1| beta-glucosidase-like protein [Rickettsia conorii str. Malish 7] gi|228022115|gb|ACP53823.1| Beta-glucosidase [Rickettsia africae ESF-5] Length = 327 Score = 59.4 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +AK L GIN++F+PV DLL+ I F P + Sbjct: 124 IAKELREVGINLDFAPVADLLHEGADKIVG-DRSFGGEPEVVVPLCLAAIDGLQE 177 >gi|269925565|ref|YP_003322188.1| glycoside hydrolase family 3 domain protein [Thermobaculum terrenum ATCC BAA-798] gi|269789225|gb|ACZ41366.1| glycoside hydrolase family 3 domain protein [Thermobaculum terrenum ATCC BAA-798] Length = 596 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 15/53 (28%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 K L GIN N +P D+ P + F R Y Sbjct: 179 GKELRALGINQNLAPDADVNINPFNPVIGV-RSFGDRSWLVARLTAAQVRGYQ 230 >gi|283850244|ref|ZP_06367533.1| glycoside hydrolase family 3 domain protein [Desulfovibrio sp. FW1012B] gi|283574270|gb|EFC22241.1| glycoside hydrolase family 3 domain protein [Desulfovibrio sp. FW1012B] Length = 569 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + L+ GIN +F+PV D+ P + F PA + Y Sbjct: 152 GRELLAVGINTDFAPVADVNVNPANPVIGI-RSFGANPADVARFTAAATAGY 202 >gi|225388449|ref|ZP_03758173.1| hypothetical protein CLOSTASPAR_02185 [Clostridium asparagiforme DSM 15981] gi|225045496|gb|EEG55742.1| hypothetical protein CLOSTASPAR_02185 [Clostridium asparagiforme DSM 15981] Length = 569 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK G N NF+PV+DL Y I Q F+ P + F KN Sbjct: 131 AKESEAVGCNWNFAPVVDLTYNWRNTIVQL-RAFNDSPEDVIRYGKAFFEGMRTKN 185 >gi|118468690|ref|YP_884774.1| glycosyl hydrolase family protein 3 [Mycobacterium smegmatis str. MC2 155] gi|118169977|gb|ABK70873.1| Glycosyl hydrolase family protein 3 [Mycobacterium smegmatis str. MC2 155] Length = 387 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + G+ V+F+PV+D+ + F PA E A ++R Sbjct: 165 GRKMRDLGVTVDFAPVVDVTDAAADTVIG-DRSFGSDPAVVTEYAGAYARGLRD 217 >gi|188582828|ref|YP_001926273.1| beta-N-acetylhexosaminidase [Methylobacterium populi BJ001] gi|179346326|gb|ACB81738.1| Beta-N-acetylhexosaminidase [Methylobacterium populi BJ001] Length = 351 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA +L GINV+ +P+LD+ I + P + E + + Sbjct: 120 MAHDLSEVGINVDCAPMLDVPAAGSDNIIG-DRAYGDTPGRVIELGRAVAEGL 171 >gi|126739453|ref|ZP_01755146.1| beta-N-acetylhexosaminidase, putative [Roseobacter sp. SK209-2-6] gi|126719553|gb|EBA16262.1| beta-N-acetylhexosaminidase, putative [Roseobacter sp. SK209-2-6] Length = 340 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GI+ N +P DL+ K ++ P ++ ++ ++ Sbjct: 112 IAQELRALGIDSNCAPCADLVTPDTHP-FLKNRCYADQPDLVVTLSRAVAQGHLD 165 >gi|160916067|ref|ZP_02078274.1| hypothetical protein EUBDOL_02094 [Eubacterium dolichum DSM 3991] gi|158431791|gb|EDP10080.1| hypothetical protein EUBDOL_02094 [Eubacterium dolichum DSM 3991] Length = 943 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + V GIN NF P LD P + S P + + Sbjct: 171 IGREEVALGINNNFGPDLDTNSNPLNPVINI-RSISSDPNLVADLGVEIVKGIQD 224 >gi|238650371|ref|YP_002916223.1| putative beta-glucosidase [Rickettsia peacockii str. Rustic] gi|238624469|gb|ACR47175.1| putative beta-glucosidase [Rickettsia peacockii str. Rustic] Length = 314 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +AK L GIN++F+PV DLL+ I F P + Sbjct: 111 IAKELREVGINLDFAPVADLLHEGADKIVG-DRSFGGEPEVVVPLCLAAIDGLQE 164 >gi|113477193|ref|YP_723254.1| Beta-N-acetylhexosaminidase [Trichodesmium erythraeum IMS101] gi|110168241|gb|ABG52781.1| Beta-N-acetylhexosaminidase [Trichodesmium erythraeum IMS101] Length = 308 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A++L GINVN SPVLD + +S P++ A+ + + Sbjct: 107 IAQDLQNIGINVNCSPVLDCPIPEADLVIGT-RAYSNSPSEIITMAKAVIEGFQE 160 >gi|157828934|ref|YP_001495176.1| hypothetical protein A1G_06040 [Rickettsia rickettsii str. 'Sheila Smith'] gi|165933658|ref|YP_001650447.1| anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Rickettsia rickettsii str. Iowa] gi|13235506|emb|CAC33710.1| hypothetical protein [Rickettsia rickettsii] gi|157801415|gb|ABV76668.1| hypothetical protein A1G_06040 [Rickettsia rickettsii str. 'Sheila Smith'] gi|165908745|gb|ABY73041.1| anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Rickettsia rickettsii str. Iowa] Length = 314 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +AK L GIN++F+PV DLL+ I F P + Sbjct: 111 IAKELREVGINLDFAPVADLLHEGADKIVG-DRSFGGEPEVVVPLCLAAIDGLQE 164 >gi|297192171|ref|ZP_06909569.1| beta-N-acetylhexosaminidase [Streptomyces pristinaespiralis ATCC 25486] gi|297151242|gb|EDY64092.2| beta-N-acetylhexosaminidase [Streptomyces pristinaespiralis ATCC 25486] Length = 511 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+++N++P D+ P+ + F A A + Sbjct: 115 LGRRLAECGVDLNWAPSADVNSNPDNPVIGV-RSFGADTALAARHTVAYVEGLQ 167 >gi|167647084|ref|YP_001684747.1| beta-N-acetylhexosaminidase [Caulobacter sp. K31] gi|167349514|gb|ABZ72249.1| Beta-N-acetylhexosaminidase [Caulobacter sp. K31] Length = 341 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A +L+ GINV+ PVLD+ I + P + + + + Sbjct: 111 IAHDLLALGINVDCVPVLDVPDPQGHEIIG-DRAYGDTPEQVATLGRAAAEGLL 163 >gi|13235519|emb|CAC33645.1| hypothetical protein [Rickettsia montanensis] Length = 314 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +AK L GIN++F+PV DL++ I F P + Sbjct: 111 IAKELRAVGINLDFAPVADLIHEGADKIVG-DRSFGGEPEVVVPLCLAAIDGLQE 164 >gi|322512596|gb|ADX05704.1| putative carbohydrate-active enzyme [uncultured organism] Length = 471 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A G++ F+PV+DL P I F P K A+ F Sbjct: 100 AIQARALGVDWVFAPVVDLAQEPNNPIVNT-RSFGANPKKVASLAKSFMIGLED 152 >gi|239931144|ref|ZP_04688097.1| beta-N-acetylglucosaminidase (secreted protein) [Streptomyces ghanaensis ATCC 14672] gi|291439509|ref|ZP_06578899.1| beta-N-acetylglucosaminidase [Streptomyces ghanaensis ATCC 14672] gi|291342404|gb|EFE69360.1| beta-N-acetylglucosaminidase [Streptomyces ghanaensis ATCC 14672] Length = 614 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L GI +++PV D+ P + F P Y Sbjct: 188 GRELRAMGIRQDYAPVADVNVDPANPVIGV-RSFGSEPEAVARLVAAEVAGYQ 239 >gi|295085315|emb|CBK66838.1| Beta-glucosidase-related glycosidases [Bacteroides xylanisolvens XB1A] Length = 1003 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+ VNF+PV D+ P+ + F P + + ++ Sbjct: 160 ARQCRQIGVQVNFAPVADVNINPKNPVINT-RSFGEDPIQVADKVIAYASGL 210 >gi|153806098|ref|ZP_01958766.1| hypothetical protein BACCAC_00349 [Bacteroides caccae ATCC 43185] gi|149130775|gb|EDM21981.1| hypothetical protein BACCAC_00349 [Bacteroides caccae ATCC 43185] Length = 1003 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+ VNF+PV D+ P+ + F P + + ++ Sbjct: 160 ARQCRQIGVQVNFAPVADVNINPKNPVINT-RSFGEDPIQVADKVIAYASGL 210 >gi|256784178|ref|ZP_05522609.1| secreted hydrolase [Streptomyces lividans TK24] Length = 615 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L GI+ NF+PV D+ P I F + Y + Sbjct: 183 GTELAAMGIHQNFAPVADVNVNPANPIINV-RSFGADAREVGRMVAAQVTGYQQ 235 >gi|149278323|ref|ZP_01884461.1| b-glycosidase, glycoside hydrolase family 3 protein [Pedobacter sp. BAL39] gi|149231089|gb|EDM36470.1| b-glycosidase, glycoside hydrolase family 3 protein [Pedobacter sp. BAL39] Length = 574 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK+ G+++N +P +D+ P+ + F + + + Sbjct: 156 AKDYQRIGMHMNLAPDVDVNNNPKNPVIN-YRSFGEDKYNVARKSASYMKGMQD 208 >gi|21224618|ref|NP_630397.1| secreted hydrolase [Streptomyces coelicolor A3(2)] gi|13872764|emb|CAC37521.1| putative secreted hydrolase [Streptomyces coelicolor A3(2)] Length = 615 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L GI+ NF+PV D+ P I F + Y + Sbjct: 183 GTELAAMGIHQNFAPVADVNVNPANPIINV-RSFGADAREVGRMVAAQVTGYQQ 235 >gi|34581298|ref|ZP_00142778.1| hypothetical beta-glucosidase [Rickettsia sibirica 246] gi|28262683|gb|EAA26187.1| hypothetical beta-glucosidase [Rickettsia sibirica 246] Length = 314 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +AK L GIN++F+PV DLL+ I F P + Sbjct: 111 IAKELREVGINLDFAPVADLLHEGADKIVG-DRSFGGEPEVVVPLCLAAIDGLQE 164 >gi|114771798|ref|ZP_01449191.1| glycosyl hydrolase, family 3 [alpha proteobacterium HTCC2255] gi|114547614|gb|EAU50505.1| glycosyl hydrolase, family 3 [alpha proteobacterium HTCC2255] Length = 330 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L + GI+VN +P++D+ I + + P E + + + Sbjct: 107 IAHELHSLGIDVNCAPMVDIPNINSHEII-TNRCYGKTPKIVSEMGRACAEGLL 159 >gi|289768063|ref|ZP_06527441.1| secreted hydrolase [Streptomyces lividans TK24] gi|289698262|gb|EFD65691.1| secreted hydrolase [Streptomyces lividans TK24] Length = 610 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L GI+ NF+PV D+ P I F + Y + Sbjct: 178 GTELAAMGIHQNFAPVADVNVNPANPIINV-RSFGADAREVGRMVAAQVTGYQQ 230 >gi|28199267|ref|NP_779581.1| beta-hexosaminidase [Xylella fastidiosa Temecula1] gi|28057373|gb|AAO29230.1| N-acetyl-beta-glucosaminidase [Xylella fastidiosa Temecula1] Length = 347 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P A+ + + Sbjct: 116 MASEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDDPHVVAAFAKAYVQGMH 166 >gi|299147597|ref|ZP_07040661.1| glycosyl hydrolase, family 3 [Bacteroides sp. 3_1_23] gi|298514384|gb|EFI38269.1| glycosyl hydrolase, family 3 [Bacteroides sp. 3_1_23] Length = 1003 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+ VNF+PV D+ PE + F P + + ++ Sbjct: 160 ARQCRQIGVQVNFAPVADVNINPENPVINT-RSFGEDPIQVADKVIAYASGL 210 >gi|293373460|ref|ZP_06619815.1| beta-lactamase [Bacteroides ovatus SD CMC 3f] gi|292631598|gb|EFF50221.1| beta-lactamase [Bacteroides ovatus SD CMC 3f] Length = 953 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+ VNF+PV D+ PE + F P + + ++ Sbjct: 110 ARQCRQIGVQVNFAPVADVNINPENPVINT-RSFGEDPIQVADKVIAYASGL 160 >gi|260175127|ref|ZP_05761539.1| beta-N-acetylglucosaminidase [Bacteroides sp. D2] gi|315923361|ref|ZP_07919601.1| conserved hypothetical protein [Bacteroides sp. D2] gi|313697236|gb|EFS34071.1| conserved hypothetical protein [Bacteroides sp. D2] Length = 1003 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+ VNF+PV D+ PE + F P + + ++ Sbjct: 160 ARQCRQIGVQVNFAPVADVNINPENPVINT-RSFGEDPIQVADKVIAYASGL 210 >gi|237722835|ref|ZP_04553316.1| beta-N-acetylglucosaminidase [Bacteroides sp. 2_2_4] gi|298482287|ref|ZP_07000474.1| glycosyl hydrolase, family 3 [Bacteroides sp. D22] gi|229447357|gb|EEO53148.1| beta-N-acetylglucosaminidase [Bacteroides sp. 2_2_4] gi|298271574|gb|EFI13148.1| glycosyl hydrolase, family 3 [Bacteroides sp. D22] Length = 1003 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+ VNF+PV D+ PE + F P + + ++ Sbjct: 160 ARQCRQIGVQVNFAPVADVNINPENPVINT-RSFGEDPIQVADKVIAYASGL 210 >gi|237713891|ref|ZP_04544372.1| beta-N-acetylglucosaminidase [Bacteroides sp. D1] gi|262409200|ref|ZP_06085744.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] gi|294645776|ref|ZP_06723461.1| beta-lactamase [Bacteroides ovatus SD CC 2a] gi|294810316|ref|ZP_06768978.1| beta-lactamase [Bacteroides xylanisolvens SD CC 1b] gi|229446047|gb|EEO51838.1| beta-N-acetylglucosaminidase [Bacteroides sp. D1] gi|262352947|gb|EEZ02043.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] gi|292638907|gb|EFF57240.1| beta-lactamase [Bacteroides ovatus SD CC 2a] gi|294442515|gb|EFG11320.1| beta-lactamase [Bacteroides xylanisolvens SD CC 1b] Length = 1003 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+ VNF+PV D+ PE + F P + + ++ Sbjct: 160 ARQCRQIGVQVNFAPVADVNINPENPVINT-RSFGEDPIQVADKVIAYASGL 210 >gi|171057495|ref|YP_001789844.1| glycoside hydrolase family 3 protein [Leptothrix cholodnii SP-6] gi|170774940|gb|ACB33079.1| glycoside hydrolase family 3 domain protein [Leptothrix cholodnii SP-6] Length = 554 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 ++ L + G+N FSPVLD+ ++ I + P + A L + + + Sbjct: 127 LSAELASLGVNWTFSPVLDVNQKFQSAIVGT-RSYGSNPDLIAQLAGLHIQVFQDH 181 >gi|160883605|ref|ZP_02064608.1| hypothetical protein BACOVA_01577 [Bacteroides ovatus ATCC 8483] gi|156111018|gb|EDO12763.1| hypothetical protein BACOVA_01577 [Bacteroides ovatus ATCC 8483] Length = 1003 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+ VNF+PV D+ PE + F P + + ++ Sbjct: 160 ARQCRQIGVQVNFAPVADVNINPENPVINT-RSFGEDPIQVADKVIAYASGL 210 >gi|119953401|ref|YP_945610.1| beta-hexosaminidase [Borrelia turicatae 91E135] gi|119862172|gb|AAX17940.1| beta-hexosaminidase [Borrelia turicatae 91E135] Length = 551 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GIN+NF+P+ D+ E F +S P A F + + Sbjct: 149 IANELRQLGINLNFAPITDIYSNEENFTIGP-RTYSNNPQIVSLFALAFYKGQKQ 202 >gi|317124150|ref|YP_004098262.1| glycoside hydrolase [Intrasporangium calvum DSM 43043] gi|315588238|gb|ADU47535.1| glycoside hydrolase family 3 domain protein [Intrasporangium calvum DSM 43043] Length = 435 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYGP----ETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GINVN +PV D + I + FS P F + Sbjct: 208 GEQLRAGGINVNLAPVADTVPDSLGRDNDPIGRWDRQFSSDPDVVARMVGAFVTGMHE 265 >gi|270158059|ref|ZP_06186716.1| beta-hexosaminidase [Legionella longbeachae D-4968] gi|269990084|gb|EEZ96338.1| beta-hexosaminidase [Legionella longbeachae D-4968] Length = 354 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MAK+L+T G++++ +PVLDL + IA F P A F Sbjct: 102 MAKDLLTCGVDLSLAPVLDL-HDMSPIIAHLDRSFHHDPDAVTALANAFIEGMN 154 >gi|254498732|ref|ZP_05111448.1| beta-hexosaminidase [Legionella drancourtii LLAP12] gi|254352060|gb|EET10879.1| beta-hexosaminidase [Legionella drancourtii LLAP12] Length = 358 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MAK L+ G++++ +PVLD+ + IA F + + A F + Sbjct: 107 MAKELLACGVDLSIAPVLDV-HDKSQVIAGLNRAFHKDADAIIDLAGAFIKGMN 159 >gi|187478945|ref|YP_786969.1| beta-hexosaminidase [Bordetella avium 197N] gi|97180108|sp|Q2KXM7|NAGZ_BORA1 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|115423531|emb|CAJ50067.1| beta-hexosaminidase [Bordetella avium 197N] Length = 350 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L G++++F+PVLDL YG I F P A+ + Sbjct: 118 LAAELRACGVDMSFTPVLDLDYGVSKVIG--NRAFHADPRVVAMLARALVQGL 168 >gi|120401282|ref|YP_951111.1| beta-N-acetylhexosaminidase [Mycobacterium vanbaalenii PYR-1] gi|119954100|gb|ABM11105.1| Beta-N-acetylhexosaminidase [Mycobacterium vanbaalenii PYR-1] Length = 400 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI ++F+PV+D+ P+ + F P + A ++R Sbjct: 176 GRKMRGLGITIDFAPVVDVTDAPDGTVIG-DRSFGADPTAVVDYAGAYARGLRD 228 >gi|227015823|gb|ACP17920.1| putative beta-hexosaminidase [Pseudomonas nitroreducens] Length = 332 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ G++++F+PVLDL + + F P +A A F R Sbjct: 101 MATEVLAVGLDLSFAPVLDLDHQRSAVVGS--RAFEGNPERAVALAGAFIRGMHD 153 >gi|219667150|ref|YP_002457585.1| glycoside hydrolase [Desulfitobacterium hafniense DCB-2] gi|219537410|gb|ACL19149.1| glycoside hydrolase family 3 domain protein [Desulfitobacterium hafniense DCB-2] Length = 426 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + + G+NVNF+PVLD+ P+ + F P + R + Sbjct: 177 LGREVKGFGMNVNFAPVLDIFSNPKNKVIG-DRAFGSNPELVSKVGIQTMRGIQE 230 >gi|257875041|ref|ZP_05654694.1| beta-N-acetylglucosaminidase/beta-glucosidase [Enterococcus casseliflavus EC20] gi|257809207|gb|EEV38027.1| beta-N-acetylglucosaminidase/beta-glucosidase [Enterococcus casseliflavus EC20] Length = 561 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N++FSP++D+ I F P + + A + KN Sbjct: 128 GSEASQVGCNMSFSPIVDIDLNFRNPITNT-RTFGSDPKRVIQMASAQIKGLEKN 181 >gi|149926465|ref|ZP_01914726.1| beta-hexosaminidase [Limnobacter sp. MED105] gi|149824828|gb|EDM84042.1| beta-hexosaminidase [Limnobacter sp. MED105] Length = 340 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L GI+++F+PVLDL +G I F + + Sbjct: 107 MAAELRACGIDMSFAPVLDLDWGNSEIIG--DRSFGKDARMVSRLSSALMNGM 157 >gi|328952013|ref|YP_004369347.1| glycoside hydrolase family 3 domain protein [Desulfobacca acetoxidans DSM 11109] gi|328452337|gb|AEB08166.1| glycoside hydrolase family 3 domain protein [Desulfobacca acetoxidans DSM 11109] Length = 339 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ L G+NVN +PVLD+ P+ +S P R Y+ Sbjct: 110 AQELQLMGVNVNLAPVLDVARNPDCP--LWERSYSADPEAVVRCGLAAVRGYL 160 >gi|114331751|ref|YP_747973.1| beta-hexosaminidase [Nitrosomonas eutropha C91] gi|122313498|sp|Q0AF74|NAGZ_NITEC RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|114308765|gb|ABI60008.1| glycoside hydrolase, family 3 domain protein [Nitrosomonas eutropha C91] Length = 348 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L G++V+F+PVLDL + I F R P E A Sbjct: 108 LAAELKACGVDVSFTPVLDLDCEQSSVIG--DRAFYREPQVVAELAHALMSGLQ 159 >gi|311107559|ref|YP_003980412.1| beta-hexosaminidase [Achromobacter xylosoxidans A8] gi|310762248|gb|ADP17697.1| beta-hexosaminidase [Achromobacter xylosoxidans A8] Length = 352 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L G++++F+PVLDL YG I F + P ++ + Sbjct: 118 LAAELRACGVDMSFTPVLDLDYGVSKVIGT--RAFHQDPRVVAMLSRALIQGLQ 169 >gi|29831845|ref|NP_826479.1| beta-N-acetylhexosaminidase [Streptomyces avermitilis MA-4680] gi|29608962|dbj|BAC73014.1| putative beta-N-acetylhexosaminidase [Streptomyces avermitilis MA-4680] Length = 616 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L GI ++SP D+ P + F P + Y + Sbjct: 190 GAELRALGILQDYSPDADVNVNPANPVIGV-RSFGADPDAVAGLVAAEVKGYQQ 242 >gi|15828382|ref|NP_302645.1| glycosyl hydrolase [Mycobacterium leprae TN] gi|221230859|ref|YP_002504275.1| putative secreted glycosyl hydrolase [Mycobacterium leprae Br4923] gi|3063878|emb|CAA18563.1| putative secreted hydrolase [Mycobacterium leprae] gi|13093812|emb|CAC32100.1| putative secreted glycosyl hydrolase [Mycobacterium leprae] gi|219933966|emb|CAR72668.1| putative secreted glycosyl hydrolase [Mycobacterium leprae Br4923] Length = 387 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + GI ++F+PV+D+ P+ + FS PA A ++R Sbjct: 162 GHKMRDLGITIDFAPVVDVTDAPDDSVIG-GRSFSSDPAVVTAYAGAYARGLRD 214 >gi|296167520|ref|ZP_06849872.1| beta-N-acetylhexosaminidase [Mycobacterium parascrofulaceum ATCC BAA-614] gi|295897142|gb|EFG76751.1| beta-N-acetylhexosaminidase [Mycobacterium parascrofulaceum ATCC BAA-614] Length = 383 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K + GI ++F+PV+D+ + I F P A +++ Sbjct: 159 GKKMRDLGITIDFAPVVDVTDATDGVIG--DRSFGGDPNTVTAYAGAYAQGLRD 210 >gi|157804098|ref|YP_001492647.1| ATP-dependent protease ATP-binding subunit [Rickettsia canadensis str. McKiel] gi|157785361|gb|ABV73862.1| ATP-dependent protease ATP-binding subunit [Rickettsia canadensis str. McKiel] Length = 314 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +AK L GIN++F+PV+DL++ I F P + Sbjct: 111 IAKELREVGINLDFAPVVDLIHEGAHNIVG-DRSFGSEPEVVVPLCLAAVDGLQE 164 >gi|332671481|ref|YP_004454489.1| glycoside hydrolase family 3 domain-containing protein [Cellulomonas fimi ATCC 484] gi|75387204|sp|Q7WUL3|NAG3_CELFI RecName: Full=Beta-N-acetylglucosaminidase/beta-glucosidase; AltName: Full=3-beta-N-acetyl-D-glucosaminidase/beta-D- glucosidase; AltName: Full=Nag3 gi|33320077|gb|AAQ05801.1|AF478460_1 N-acetyl-beta-glucosaminidase [Cellulomonas fimi] gi|332340519|gb|AEE47102.1| glycoside hydrolase family 3 domain protein [Cellulomonas fimi ATCC 484] Length = 564 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + GIN F+PV+D+ I F A + Sbjct: 127 IGREARALGINWAFTPVVDIDLNFRNPITNT-RTFGADAATVAAMGAEYVEAIQ 179 >gi|89896980|ref|YP_520467.1| hypothetical protein DSY4234 [Desulfitobacterium hafniense Y51] gi|89336428|dbj|BAE86023.1| hypothetical protein [Desulfitobacterium hafniense Y51] Length = 426 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + + G+NVNF+PVLD+ P+ + F P + R + Sbjct: 177 LGREVKGFGMNVNFAPVLDIFSNPKNKVIG-DRAFGSNPELVSKVGIQTMRGIQE 230 >gi|182681993|ref|YP_001830153.1| beta-hexosaminidase [Xylella fastidiosa M23] gi|32129771|sp|Q87BR5|NAGZ_XYLFT RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724455|sp|B2I6G9|NAGZ_XYLF2 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|182632103|gb|ACB92879.1| glycoside hydrolase family 3 domain protein [Xylella fastidiosa M23] Length = 335 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P A+ + + Sbjct: 104 MASEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDDPHVVAAFAKAYVQGMH 154 >gi|71898363|ref|ZP_00680536.1| Glycoside hydrolase, family 3, N-terminal [Xylella fastidiosa Ann-1] gi|71731886|gb|EAO33944.1| Glycoside hydrolase, family 3, N-terminal [Xylella fastidiosa Ann-1] Length = 335 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P A+ + + Sbjct: 104 MASEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDDPHVVAAFAKAYVQGMH 154 >gi|289163674|ref|YP_003453812.1| beta N-acetyl-glucosaminidase [Legionella longbeachae NSW150] gi|288856847|emb|CBJ10658.1| beta N-acetyl-glucosaminidase [Legionella longbeachae NSW150] Length = 363 Score = 58.6 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MAK+L+T G++++ +PVLDL + IA F P A F Sbjct: 111 MAKDLLTCGVDLSLAPVLDL-HDMSPIIAHLDRSFHHDPDAVTALANAFIEGMN 163 >gi|291557973|emb|CBL35090.1| Beta-glucosidase-related glycosidases [Eubacterium siraeum V10Sc8a] Length = 397 Score = 58.6 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G N +F+PV D+ P+ + + P + K Sbjct: 181 IGFYLKKIGFNYDFAPVADVNTNPDNIVIG-DRSYGNNPVTVGKMVSAQLDGLHK 234 >gi|224825229|ref|ZP_03698335.1| glycoside hydrolase family 3 domain protein [Lutiella nitroferrum 2002] gi|224602900|gb|EEG09077.1| glycoside hydrolase family 3 domain protein [Lutiella nitroferrum 2002] Length = 361 Score = 58.6 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L G++++F+PVLDL +G I FSR P A R Sbjct: 114 LAAELRACGVDLSFTPVLDLDWGRCAVIG--NRSFSRDPEVVSALALALQRGLQ 165 >gi|91204997|ref|YP_537352.1| Beta-glucosidase [Rickettsia bellii RML369-C] gi|157827671|ref|YP_001496735.1| Beta-glucosidase [Rickettsia bellii OSU 85-389] gi|91068541|gb|ABE04263.1| Beta-glucosidase [Rickettsia bellii RML369-C] gi|157802975|gb|ABV79698.1| Beta-glucosidase [Rickettsia bellii OSU 85-389] Length = 324 Score = 58.6 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L GIN++F+PV D+ + + F P + Sbjct: 121 IGKELKALGINLDFAPVGDISHKGAHDVIG-NRSFGTEPEIVVPLCIAALEGLQQ 174 >gi|99080746|ref|YP_612900.1| Beta-N-acetylhexosaminidase [Ruegeria sp. TM1040] gi|99037026|gb|ABF63638.1| Beta-N-acetylhexosaminidase [Ruegeria sp. TM1040] Length = 353 Score = 58.6 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+ N +P+ D+ + + A+ + ++ Sbjct: 105 IAAELRDYGIDSNCAPLADVATAETHP-FLRNRCYGSNVESVAAIARACAEGHLD 158 >gi|170740713|ref|YP_001769368.1| Beta-N-acetylhexosaminidase [Methylobacterium sp. 4-46] gi|168194987|gb|ACA16934.1| Beta-N-acetylhexosaminidase [Methylobacterium sp. 4-46] Length = 341 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA +L GI+V+ +PVLD+ + ++ P + + + Sbjct: 108 MAHDLAGVGISVDCAPVLDVPVAGANAVIG-DRAYADDPREVAAFGRAVAEGL 159 >gi|67458595|ref|YP_246219.1| Beta-glucosidase [Rickettsia felis URRWXCal2] gi|67004128|gb|AAY61054.1| Beta-glucosidase [Rickettsia felis URRWXCal2] Length = 327 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L GIN++F+PV DL++ I F P + Sbjct: 124 IGKELREVGINLDFAPVADLIHEGADKIVG-DRSFGSEPEVVVPLCLAAIDGLQE 177 >gi|260575256|ref|ZP_05843256.1| Beta-N-acetylhexosaminidase [Rhodobacter sp. SW2] gi|259022516|gb|EEW25812.1| Beta-N-acetylhexosaminidase [Rhodobacter sp. SW2] Length = 344 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L + GI+ N +P D+L K +S P ++ + ++ Sbjct: 116 IAAELRSVGIDGNCAPCADVLTPDTHP-FLKNRCYSDDPRIVALLSRAVAEAHL 168 >gi|313108295|ref|ZP_07794327.1| beta-N-acetyl-D-glucosaminidase [Pseudomonas aeruginosa 39016] gi|310880829|gb|EFQ39423.1| beta-N-acetyl-D-glucosaminidase [Pseudomonas aeruginosa 39016] Length = 332 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + G++++F+PVLDL + + F P +A A F R Sbjct: 101 MATEVQAVGLDLSFAPVLDLDHQRSAVVGS--RAFEGDPERAALLAGAFIRGMH 152 >gi|307545299|ref|YP_003897778.1| beta-hexosaminidase [Halomonas elongata DSM 2581] gi|307217323|emb|CBV42593.1| beta-hexosaminidase [Halomonas elongata DSM 2581] Length = 337 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + G++++F+PVLD+ G + I F P E A F + Sbjct: 109 LGMEMAGCGLDLSFAPVLDVDSGVSSVIG--DRSFGGSPEVVSELAGAFVAGLHE 161 >gi|117164543|emb|CAJ88089.1| putative secreted hydrolase [Streptomyces ambofaciens ATCC 23877] Length = 608 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 15/53 (28%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GI+ NF+PV D+ P I F Y Sbjct: 180 GTELAALGIHQNFAPVADVNVNPANPIINV-RSFGADARAVGRMVAAQVTGYQ 231 >gi|157165607|ref|YP_001466722.1| glycoside hydrolase family 3 protein [Campylobacter concisus 13826] gi|112800169|gb|EAT97513.1| beta-hexosaminidase A (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) (Chitobiase) [Campylobacter concisus 13826] Length = 351 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 28/55 (50%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA NL GIN+NF+PV+DL IA K+ FS +K A F + + Sbjct: 133 MAINLKECGINLNFAPVVDLHDENSPIIAAKQRAFSEYASKVVIYADAFMDAFKE 187 >gi|72162885|ref|YP_290542.1| glycosyl hydrolase [Thermobifida fusca YX] gi|71916617|gb|AAZ56519.1| beta-N-acetylhexosaminidase. Glycosyl Hydrolase family 3 [Thermobifida fusca YX] Length = 552 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 23/63 (36%), Gaps = 9/63 (14%) Query: 1 MAKNLVT--------SGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 +A+ L GIN++++PV D+ + + FS P E A Sbjct: 153 LARELAAATAEQLAAVGINLDYAPVADVNVNADNPVIGI-RSFSSDPELVGELAAAEVAA 211 Query: 53 YIK 55 + Sbjct: 212 FQD 214 >gi|293606419|ref|ZP_06688778.1| beta-N-acetylhexosaminidase [Achromobacter piechaudii ATCC 43553] gi|292815177|gb|EFF74299.1| beta-N-acetylhexosaminidase [Achromobacter piechaudii ATCC 43553] Length = 352 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L G++++F+PVLDL YG I F P ++ + Sbjct: 118 LAAELRACGVDMSFTPVLDLDYGVSKVIG--NRAFHSDPRVVTMLSRALIQGL 168 >gi|33239585|ref|NP_874527.1| Beta-glucosidase-related glycosidase [Prochlorococcus marinus subsp. marinus str. CCMP1375] gi|33237110|gb|AAP99179.1| Beta-glucosidase-related glycosidase [Prochlorococcus marinus subsp. marinus str. CCMP1375] Length = 549 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 15/53 (28%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + G+N +PV D+ P + + P F R Sbjct: 126 IGAQARRCGLNWVLAPVCDVNSDPLNPVINM-RAWGCNPNTVSALVCAFHRGL 177 >gi|296876442|ref|ZP_06900493.1| beta-N-acetylhexosaminidase [Streptococcus parasanguinis ATCC 15912] gi|296432435|gb|EFH18231.1| beta-N-acetylhexosaminidase [Streptococcus parasanguinis ATCC 15912] Length = 548 Score = 58.3 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK+ G+N FSPV+DL + I + +A+ +++ + Sbjct: 127 AKDGKAVGVNWGFSPVIDLDFNFRNPITNV-RTYGSDIDTVISNAKAYTKAFHD 179 >gi|71276136|ref|ZP_00652416.1| Glycoside hydrolase, family 3, N-terminal [Xylella fastidiosa Dixon] gi|170730636|ref|YP_001776069.1| beta-hexosaminidase [Xylella fastidiosa M12] gi|226724456|sp|B0U3L0|NAGZ_XYLFM RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|71163054|gb|EAO12776.1| Glycoside hydrolase, family 3, N-terminal [Xylella fastidiosa Dixon] gi|167965429|gb|ACA12439.1| N-acetyl-beta-glucosaminidase [Xylella fastidiosa M12] Length = 335 Score = 58.3 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P AQ + + Sbjct: 104 MASEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDDPHVVAAFAQAYVQGMH 154 >gi|170718554|ref|YP_001783760.1| glycoside hydrolase family 3 protein [Haemophilus somnus 2336] gi|168826683|gb|ACA32054.1| glycoside hydrolase family 3 domain protein [Haemophilus somnus 2336] Length = 586 Score = 58.3 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 G N +F+P++D+ Y I +F P K E + + + + Sbjct: 131 EAAAIGCNWSFAPIVDISYNWRNPII-SNRVFGSNPEKVLEMSLAYMKGIQE 181 >gi|15598201|ref|NP_251695.1| beta-hexosaminidase [Pseudomonas aeruginosa PAO1] gi|116054412|ref|YP_790167.1| beta-hexosaminidase [Pseudomonas aeruginosa UCBPP-PA14] gi|218890796|ref|YP_002439660.1| beta-hexosaminidase [Pseudomonas aeruginosa LESB58] gi|254235979|ref|ZP_04929302.1| beta-N-acetyl-D-glucosaminidase [Pseudomonas aeruginosa C3719] gi|13959409|sp|Q9HZK0|NAGZ_PSEAE RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|122260137|sp|Q02PG9|NAGZ_PSEAB RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724443|sp|B7UYS5|NAGZ_PSEA8 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|9949106|gb|AAG06393.1|AE004725_6 beta-N-acetyl-D-glucosaminidase [Pseudomonas aeruginosa PAO1] gi|115589633|gb|ABJ15648.1| beta-N-acetyl-D-glucosaminidase [Pseudomonas aeruginosa UCBPP-PA14] gi|126167910|gb|EAZ53421.1| beta-N-acetyl-D-glucosaminidase [Pseudomonas aeruginosa C3719] gi|218771019|emb|CAW26784.1| beta-N-acetyl-D-glucosaminidase [Pseudomonas aeruginosa LESB58] Length = 332 Score = 58.3 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + G++++F+PVLDL + + F P +A A F R Sbjct: 101 MATEVQAVGLDLSFAPVLDLDHQRSAVVGS--RAFEGDPERAALLAGAFIRGMH 152 >gi|89095509|ref|ZP_01168416.1| beta-hexosaminidase [Oceanospirillum sp. MED92] gi|89080229|gb|EAR59494.1| beta-hexosaminidase [Oceanospirillum sp. MED92] Length = 342 Score = 58.3 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L I+++F+PV+D+ YG T I F + + + Sbjct: 113 MAAELRQLDIDLSFAPVVDIDYGRNTVIG--NRAFGNDVSTVTVLSSGYIEGMRD 165 >gi|295839561|ref|ZP_06826494.1| glycosyl hydrolase, family 3 [Streptomyces sp. SPB74] gi|295827543|gb|EDY43790.2| glycosyl hydrolase, family 3 [Streptomyces sp. SPB74] Length = 339 Score = 58.3 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G ++ PV D+ P + + P F Sbjct: 113 IAREVRAYGADLVLGPVADVNADPANPVIGV-RSYGADPHLVGRHTAAFVTAAQ 165 >gi|107102555|ref|ZP_01366473.1| hypothetical protein PaerPA_01003619 [Pseudomonas aeruginosa PACS2] gi|296388500|ref|ZP_06877975.1| beta-hexosaminidase [Pseudomonas aeruginosa PAb1] Length = 327 Score = 58.3 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + G++++F+PVLDL + + F P +A A F R Sbjct: 96 MATEVQAVGLDLSFAPVLDLDHQRSAVVGS--RAFEGDPERAALLAGAFIRGMH 147 >gi|167738948|ref|ZP_02411722.1| YbbD [Burkholderia pseudomallei 14] gi|167816167|ref|ZP_02447847.1| YbbD [Burkholderia pseudomallei 91] gi|254188516|ref|ZP_04895027.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei Pasteur 52237] gi|157936195|gb|EDO91865.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei Pasteur 52237] Length = 699 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G NVNF+P +D+ P + F PA + + Sbjct: 186 LAAEIAAVGFNVNFAPDVDVNSNPLNPVINV-RAFGDDPATIGLLGRRMVQGMK 238 >gi|134282850|ref|ZP_01769553.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 305] gi|167719945|ref|ZP_02403181.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei DM98] gi|134245936|gb|EBA46027.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 305] Length = 699 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G NVNF+P +D+ P + F PA + + Sbjct: 186 LAAEIAAVGFNVNFAPDVDVNSNPLNPVINV-RAFGDDPATIGLLGRRMVQGMK 238 >gi|126439019|ref|YP_001058671.1| glycosy hydrolase family protein [Burkholderia pseudomallei 668] gi|126218512|gb|ABN82018.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 668] Length = 699 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G NVNF+P +D+ P + F PA + + Sbjct: 186 LAAEIAAVGFNVNFAPDVDVNSNPLNPVINV-RAFGDDPATIGLLGRRMVQGMK 238 >gi|53719627|ref|YP_108613.1| putative membrane attached glycosyl hydrolase [Burkholderia pseudomallei K96243] gi|254297910|ref|ZP_04965363.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 406e] gi|52210041|emb|CAH36014.1| putative membrane attached glycosyl hydrolase [Burkholderia pseudomallei K96243] gi|157807697|gb|EDO84867.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 406e] Length = 682 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G NVNF+P +D+ P + F PA + + Sbjct: 169 LAAEIAAVGFNVNFAPDVDVNSNPLNPVINV-RAFGDDPATIGLLGRRMVQGMK 221 >gi|170720848|ref|YP_001748536.1| beta-hexosaminidase [Pseudomonas putida W619] gi|169758851|gb|ACA72167.1| glycoside hydrolase family 3 domain protein [Pseudomonas putida W619] Length = 336 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL + + F P +A + A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDHQRSAVVGS--RAFEGDPQRAAQLAGAFIRGMN 156 >gi|167911286|ref|ZP_02498377.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 112] Length = 699 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G NVNF+P +D+ P + F PA + + Sbjct: 186 LAAEIAAVGFNVNFAPDVDVNSNPLNPVINV-RAFGDDPATIGLLGRRMVQGMK 238 >gi|167846074|ref|ZP_02471582.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei B7210] Length = 699 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G NVNF+P +D+ P + F PA + + Sbjct: 186 LAAEIAAVGFNVNFAPDVDVNSNPLNPVINV-RAFGDDPATIGLLGRRMVQGMK 238 >gi|325475336|gb|EGC78521.1| glycosyl hydrolase, family 3 [Treponema denticola F0402] Length = 557 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +++ + GIN+NF+P +DLL ++ I F P F R Sbjct: 165 ISREIRALGINLNFAPTVDLLTDHDSSIIGP-RSFGDSPHAVGILGAAFVRGSRD 218 >gi|237811936|ref|YP_002896387.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei MSHR346] gi|237504199|gb|ACQ96517.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei MSHR346] Length = 699 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G NVNF+P +D+ P + F PA + + Sbjct: 186 LAAEIAAVGFNVNFAPDVDVNSNPLNPVINV-RAFGDDPATIGLLGRRMVQGMK 238 >gi|126452022|ref|YP_001065922.1| glycosy hydrolase family protein [Burkholderia pseudomallei 1106a] gi|242316034|ref|ZP_04815050.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 1106b] gi|126225664|gb|ABN89204.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 1106a] gi|242139273|gb|EES25675.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 1106b] Length = 699 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G NVNF+P +D+ P + F PA + + Sbjct: 186 LAAEIAAVGFNVNFAPDVDVNSNPLNPVINV-RAFGDDPATIGLLGRRMVQGMK 238 >gi|113461736|ref|YP_719805.1| beta-hexosamidase A [Haemophilus somnus 129PT] gi|112823779|gb|ABI25868.1| possible beta-hexosamidase A, glycoside hydrolase family 3 [Haemophilus somnus 129PT] Length = 586 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 G N +F+P++D+ Y I +F P K E + + + + Sbjct: 131 EAAAIGCNWSFAPIVDISYNWRNPII-SNRVFGSNPEKVLEMSLAYMKGIQE 181 >gi|254180075|ref|ZP_04886674.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 1655] gi|184210615|gb|EDU07658.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 1655] Length = 682 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G NVNF+P +D+ P + F PA + + Sbjct: 169 LAAEIAAVGFNVNFAPDVDVNSNPLNPVINV-RAFGDDPATIGLLGRRMVQGMK 221 >gi|167824541|ref|ZP_02456012.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 9] gi|167903054|ref|ZP_02490259.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei NCTC 13177] gi|217423486|ref|ZP_03454987.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 576] gi|226192910|ref|ZP_03788522.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei Pakistan 9] gi|217393344|gb|EEC33365.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 576] gi|225935000|gb|EEH30975.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei Pakistan 9] Length = 699 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G NVNF+P +D+ P + F PA + + Sbjct: 186 LAAEIAAVGFNVNFAPDVDVNSNPLNPVINV-RAFGDDPATIGLLGRRMVQGMK 238 >gi|21674933|ref|NP_662998.1| beta-N-acetylglucosaminidase [Chlorobium tepidum TLS] gi|21648162|gb|AAM73340.1| beta-N-acetylglucosaminidase [Chlorobium tepidum TLS] Length = 564 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ GI+ N++P +DL P + F + N Sbjct: 145 AREARAIGIHQNYAPTVDLNINPANPVINT-RSFGDRIPLVNAMSAAVIDGLQSN 198 >gi|254197665|ref|ZP_04904087.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei S13] gi|169654406|gb|EDS87099.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei S13] Length = 682 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G NVNF+P +D+ P + F PA + + Sbjct: 169 LAAEIAAVGFNVNFAPDVDVNSNPLNPVINV-RAFGDDPATIGLLGRRMVQGMK 221 >gi|81299165|ref|YP_399373.1| Beta-glucosidase-related glycosidase-like [Synechococcus elongatus PCC 7942] gi|81168046|gb|ABB56386.1| Beta-glucosidase-related glycosidases-like [Synechococcus elongatus PCC 7942] Length = 542 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A + +N +P++D+ P + F P + F + P Sbjct: 133 ATEAIAIRLNWVLAPIVDINNNPANPVINV-RAFGEDPETVSQLTTAFIAGAQQFP 187 >gi|56751168|ref|YP_171869.1| putative sugar hydrolase [Synechococcus elongatus PCC 6301] gi|56686127|dbj|BAD79349.1| putative sugar hydrolase [Synechococcus elongatus PCC 6301] Length = 520 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A + +N +P++D+ P + F P + F + P Sbjct: 111 ATEAIAIRLNWVLAPIVDINNNPANPVINV-RAFGEDPETVSQLTTAFIAGAQQFP 165 >gi|157737281|ref|YP_001489964.1| glycosyl hydrolase [Arcobacter butzleri RM4018] gi|157699135|gb|ABV67295.1| glycosyl hydrolase [Arcobacter butzleri RM4018] Length = 364 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +AK+L GIN++F+PV+DL I + F ++ + + +F K Sbjct: 143 LAKDLKDVGINLDFAPVVDLSINKNNKVIVTRGRSFGESSSEVIKYSSIFVDELRK 198 >gi|294812748|ref|ZP_06771391.1| Beta-N-acetylglucosaminidase [Streptomyces clavuligerus ATCC 27064] gi|326441101|ref|ZP_08215835.1| sugar hydrolase [Streptomyces clavuligerus ATCC 27064] gi|294325347|gb|EFG06990.1| Beta-N-acetylglucosaminidase [Streptomyces clavuligerus ATCC 27064] Length = 616 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L GI N++PV D+ P + F P A Y Sbjct: 186 GAELAALGIRQNYAPVADVNVNPANPVINV-RSFGADPRAASRMVTAQIHGYED 238 >gi|42525543|ref|NP_970641.1| glycosy hydrolase family protein [Treponema denticola ATCC 35405] gi|41815554|gb|AAS10522.1| glycosyl hydrolase, family 3 [Treponema denticola ATCC 35405] Length = 557 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +++ + GIN+NF+P +DLL ++ I F P F R Sbjct: 165 ISREIRALGINLNFAPTVDLLTDHDSSIIGP-RSFGDSPHAVGILGAAFVRGSRD 218 >gi|295094525|emb|CBK83616.1| Beta-glucosidase-related glycosidases [Coprococcus sp. ART55/1] Length = 416 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A ++ G N++F+PV D+ P+ + +S A+A E + + Sbjct: 198 IANDMSALGFNLDFAPVADVWSNPDNTVIG-ERAYSDDYAQAAELVGNAVKGFND 251 >gi|315647918|ref|ZP_07901019.1| glycoside hydrolase family 3 domain protein [Paenibacillus vortex V453] gi|315276564|gb|EFU39907.1| glycoside hydrolase family 3 domain protein [Paenibacillus vortex V453] Length = 442 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ + G+N+ F+PVLD+ P + F + + + Sbjct: 197 IARKVSGLGLNMVFAPVLDIDSNPNNPVIG-DRSFGTTAEEVSSQGIASMKGIQE 250 >gi|15838946|ref|NP_299634.1| beta-hexosaminidase [Xylella fastidiosa 9a5c] gi|13959413|sp|Q9PAZ0|NAGZ_XYLFA RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|9107529|gb|AAF85154.1|AE004045_12 N-acetyl-beta-glucosaminidase [Xylella fastidiosa 9a5c] Length = 335 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P A+ + + Sbjct: 104 MASEVRASGVDLSFAPVIDLGRGNRAI---GNRAFSDDPHVVAAFARAYVQGMH 154 >gi|224531627|ref|ZP_03672259.1| putative beta-glucosidase [Borrelia valaisiana VS116] gi|224511092|gb|EEF81498.1| putative beta-glucosidase [Borrelia valaisiana VS116] Length = 531 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GIN+NF+P++D+ F +S P + F + K Sbjct: 125 IAQELSHLGINLNFAPIVDIYSNENNFTIGP-RTYSDNPKIVSLLSLAFYKGQEK 178 >gi|254669978|emb|CBA04657.1| putative beta-hexosaminidase [Neisseria meningitidis alpha153] Length = 248 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L GI+++F+PVLDL +G I F R P A + K Sbjct: 1 MATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHRNPEAVTRLALALQKGLEK 53 >gi|305680525|ref|ZP_07403333.1| glycosyl hydrolase family 3 N-terminal domain protein [Corynebacterium matruchotii ATCC 14266] gi|305660056|gb|EFM49555.1| glycosyl hydrolase family 3 N-terminal domain protein [Corynebacterium matruchotii ATCC 14266] Length = 399 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA +L GI V+F+PV+D+ + FS PA A E A F++ + Sbjct: 180 MATSLARHGITVDFAPVVDIDGAGLEVVG--DRAFSDDPAVAAEYASAFAQGMLD 232 >gi|271963713|ref|YP_003337909.1| beta-N-acetylhexosaminidase [Streptosporangium roseum DSM 43021] gi|270506888|gb|ACZ85166.1| Beta-N-acetylhexosaminidase [Streptosporangium roseum DSM 43021] Length = 504 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +++ +GI +N++PV+D+ + + F P A+ + Sbjct: 118 GRDMADAGITLNYAPVVDVNSDLDNPVVGT-RAFGADPWLVARHARAWVTGLQ 169 >gi|239814414|ref|YP_002943324.1| glycoside hydrolase family 3 domain protein [Variovorax paradoxus S110] gi|239800991|gb|ACS18058.1| glycoside hydrolase family 3 domain protein [Variovorax paradoxus S110] Length = 368 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L G++ +F+PVLDL YG + I F R P A A+ ++ Sbjct: 114 LAAELRACGVDFSFAPVLDLDYGGSSVIG--DRSFHRDPRVAALLAKSLMHGMLQ 166 >gi|295688837|ref|YP_003592530.1| beta-N-acetylhexosaminidase [Caulobacter segnis ATCC 21756] gi|295430740|gb|ADG09912.1| Beta-N-acetylhexosaminidase [Caulobacter segnis ATCC 21756] Length = 341 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A +L + G+NV+ PVLD+ I + P + + + + Sbjct: 111 IAHDLHSLGVNVDCVPVLDVPDPQGHEIIG-DRAYGDTPEQVATLGRAAAEGLL 163 >gi|167894645|ref|ZP_02482047.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 7894] Length = 694 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G NVNF+P +D+ P + F PA + + Sbjct: 186 LAAEIAAVGFNVNFAPDVDVNSNPLNPVINV-RAFGDDPATIGLLGRRMVQGMK 238 >gi|153808374|ref|ZP_01961042.1| hypothetical protein BACCAC_02668 [Bacteroides caccae ATCC 43185] gi|149129277|gb|EDM20493.1| hypothetical protein BACCAC_02668 [Bacteroides caccae ATCC 43185] Length = 586 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A + GIN PV DL P I S P KA + N Sbjct: 160 ALECRSLGINWVLHPVADLNMNPLNPIVNT-RSVSDNPEKAVCLLSEQIKGLQDN 213 >gi|258626037|ref|ZP_05720893.1| beta-N-acetylglucosaminidase [Vibrio mimicus VM603] gi|258581688|gb|EEW06581.1| beta-N-acetylglucosaminidase [Vibrio mimicus VM603] Length = 535 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + +G N P D+ P + I F P K + R + Sbjct: 123 GEEMRGAGFNCILGPCCDVNLNPASPIIDT-RSFGDQPEKVSLHSSAAVRGLHQ 175 >gi|117924929|ref|YP_865546.1| beta-N-acetylhexosaminidase [Magnetococcus sp. MC-1] gi|117608685|gb|ABK44140.1| Beta-N-acetylhexosaminidase [Magnetococcus sp. MC-1] Length = 364 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GI +N +PV+D+ + F P A + + + Sbjct: 112 GRELRAFGIGINCAPVVDIPAPGADPVIG-NRAFGDNPLSISRLAGAWLQGLQE 164 >gi|294673403|ref|YP_003574019.1| family 3 glycosyl hydrolase [Prevotella ruminicola 23] gi|294473687|gb|ADE83076.1| glycosyl hydrolase, family 3 [Prevotella ruminicola 23] Length = 391 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G +++F+PV D+ P+ + K FS PA A + + Sbjct: 170 IGTYLTRYGFDIDFAPVADVNTNPDNVVIGK-RAFSSDPAVAASMVTSYLQGLKD 223 >gi|315498372|ref|YP_004087176.1| glycoside hydrolase family 3 domain protein [Asticcacaulis excentricus CB 48] gi|315416384|gb|ADU13025.1| glycoside hydrolase family 3 domain protein [Asticcacaulis excentricus CB 48] Length = 363 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA +L G+NV+ +PVLD+ + + + + ++ Sbjct: 116 MAHDLRALGVNVDCAPVLDVPQAGTHDVVG-DRAYGLTAETVAIMGRAAAEGFL 168 >gi|225022419|ref|ZP_03711611.1| hypothetical protein CORMATOL_02458 [Corynebacterium matruchotii ATCC 33806] gi|224944850|gb|EEG26059.1| hypothetical protein CORMATOL_02458 [Corynebacterium matruchotii ATCC 33806] Length = 399 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA +L GI V+F+PV+D+ + FS PA A E A F++ + Sbjct: 180 MATSLARHGITVDFAPVVDIDGAGLEVVG--DRAFSDDPAVAAEYASAFAQGMLD 232 >gi|282898585|ref|ZP_06306573.1| Glycoside hydrolase, family 3-like protein [Cylindrospermopsis raciborskii CS-505] gi|281196453|gb|EFA71362.1| Glycoside hydrolase, family 3-like protein [Cylindrospermopsis raciborskii CS-505] Length = 362 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L + GIN++F+PV D+ P+ + F + A E+A+ + R + Sbjct: 114 ELRSLGINLSFAPVADVFSNPQNPVIGL-RAFGQTADLAGENAKEYYRGLKE 164 >gi|261855996|ref|YP_003263279.1| glycoside hydrolase [Halothiobacillus neapolitanus c2] gi|261836465|gb|ACX96232.1| glycoside hydrolase family 3 domain protein [Halothiobacillus neapolitanus c2] Length = 362 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L +G++++F+PVLDL G I FSR PA A + + Sbjct: 110 MAVQLRMAGVDLSFAPVLDLDRGVSGVIG--DRAFSRDPASIIALAVAWISGMKE 162 >gi|153007256|ref|YP_001381581.1| glycoside hydrolase family 3 protein [Anaeromyxobacter sp. Fw109-5] gi|152030829|gb|ABS28597.1| glycoside hydrolase family 3 domain protein [Anaeromyxobacter sp. Fw109-5] Length = 365 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 9/42 (21%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKA 42 + + L G++ +++P++D+ P + FSR P Sbjct: 111 LGRELRAVGVDQDYAPIVDVDTNPANPVIG-DRAFSRDPETV 151 >gi|209964348|ref|YP_002297263.1| beta-glucosidase-like protein [Rhodospirillum centenum SW] gi|209957814|gb|ACI98450.1| beta-glucosidase-like protein [Rhodospirillum centenum SW] Length = 349 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L GI+V+ +PV DL + F P A+ + + Sbjct: 120 LAHMLADVGIDVDCAPVADLPVPGSHDVIG-DRAFGADPGLVARLARAQAEGLL 172 >gi|225389011|ref|ZP_03758735.1| hypothetical protein CLOSTASPAR_02756 [Clostridium asparagiforme DSM 15981] gi|225044924|gb|EEG55170.1| hypothetical protein CLOSTASPAR_02756 [Clostridium asparagiforme DSM 15981] Length = 447 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G N++F+P D+L P+ + F P A ++ Sbjct: 228 IGSYLSGYGFNLDFAPDADVLTNPDNQVIG-NRSFGSDPELVWSMASQVAKGLKD 281 >gi|71280158|ref|YP_271256.1| beta-hexosaminidase [Colwellia psychrerythraea 34H] gi|71145898|gb|AAZ26371.1| beta-hexosaminidase [Colwellia psychrerythraea 34H] Length = 637 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +AK L GIN N++PV+D+ + + F + E Sbjct: 164 IAKELKALGINNNYAPVVDVNTNVDNPVINT-RSFGESAVQVAELGASAVTAIQ 216 >gi|148360469|ref|YP_001251676.1| glycosyl hydrolase [Legionella pneumophila str. Corby] gi|296106464|ref|YP_003618164.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] gi|148282242|gb|ABQ56330.1| glycosyl hydrolase [Legionella pneumophila str. Corby] gi|295648365|gb|ADG24212.1| beta-N-acetylhexosaminidase [Legionella pneumophila 2300/99 Alcoy] Length = 358 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MA L + G N+NF+PV+DL I FS P A+ F + ++ Sbjct: 128 MAMTLQSLGFNLNFAPVVDLNLNAHAGIIGNLGRSFSSNPEVTIRLAKQFVDVFSRH 184 >gi|56460023|ref|YP_155304.1| beta-hexosaminidase [Idiomarina loihiensis L2TR] gi|81362359|sp|Q5QUZ5|NAGZ_IDILO RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|56179033|gb|AAV81755.1| Beta-glucosidase-related glycosidase [Idiomarina loihiensis L2TR] Length = 330 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + GI+++F+PVLD+ I FS +P++ + A F + Sbjct: 104 MAAEVQAVGIDISFAPVLDVD-DCSDVIG--DRAFSAVPSEISKLASSFIEGMHE 155 >gi|114569152|ref|YP_755832.1| Beta-N-acetylhexosaminidase [Maricaulis maris MCS10] gi|114339614|gb|ABI64894.1| Beta-N-acetylhexosaminidase [Maricaulis maris MCS10] Length = 381 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 17/52 (32%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A +G N+N +PV DL I + + A F + Sbjct: 158 AAEFHAAGFNMNLAPVADLHDPDNAVIGRHGRAYGADGETIAAYAGAFIDAF 209 >gi|121605947|ref|YP_983276.1| glycoside hydrolase family 3 protein [Polaromonas naphthalenivorans CJ2] gi|120594916|gb|ABM38355.1| glycoside hydrolase, family 3 domain protein [Polaromonas naphthalenivorans CJ2] Length = 352 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G++ +F+PVLDL YG I F R P A+ ++ Sbjct: 109 LGAELRACGVDFSFTPVLDLDYGESGVIG--DRAFGRDPRVVSLLAKSLMHGLLQ 161 >gi|322517772|gb|ADX05691.1| putative carbohydrate-active enzyme [uncultured organism] Length = 574 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ G N F+PV D++ I F P + ++ + + Sbjct: 128 AEEAAAIGCNWTFAPVCDVVSNWRNTIVNT-RAFGNEPEQIISCSKTYMEEMKNH 181 >gi|262401996|ref|ZP_06078561.1| beta-hexosaminidase [Vibrio sp. RC586] gi|262351968|gb|EEZ01099.1| beta-hexosaminidase [Vibrio sp. RC586] Length = 535 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + +G N P D+ P + I F P K + R + Sbjct: 123 GEEMRGAGFNCILGPCCDVNLNPASPIIDT-RSFGDQPEKVSLHSAAAVRGLHQ 175 >gi|262166719|ref|ZP_06034456.1| beta-hexosaminidase [Vibrio mimicus VM223] gi|262026435|gb|EEY45103.1| beta-hexosaminidase [Vibrio mimicus VM223] Length = 535 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + +G N P D+ P + I F P K + R + Sbjct: 123 GEEMRGAGFNCILGPCCDVNLNPASPIIDT-RSFGDQPEKVSLHSAAAVRGLHQ 175 >gi|262170358|ref|ZP_06038036.1| beta-hexosaminidase [Vibrio mimicus MB-451] gi|261891434|gb|EEY37420.1| beta-hexosaminidase [Vibrio mimicus MB-451] Length = 535 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + +G N P D+ P + I F P K + R + Sbjct: 123 GEEMRGAGFNCILGPCCDVNLNPASPIIDT-RSFGDQPEKVSLHSAAAVRGLHQ 175 >gi|258620418|ref|ZP_05715456.1| beta-N-acetylglucosaminidase [Vibrio mimicus VM573] gi|258587297|gb|EEW12008.1| beta-N-acetylglucosaminidase [Vibrio mimicus VM573] Length = 535 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + +G N P D+ P + I F P K + R + Sbjct: 123 GEEMRGAGFNCILGPCCDVNLNPASPIIDT-RSFGDQPEKVSLHSAAAVRGLHQ 175 >gi|254285905|ref|ZP_04960867.1| beta-N-acetylhexosaminidase [Vibrio cholerae AM-19226] gi|150424087|gb|EDN16026.1| beta-N-acetylhexosaminidase [Vibrio cholerae AM-19226] Length = 535 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + +G N P D+ P + I F P K + R + Sbjct: 123 GEEMRGAGFNCILGPCCDVNLNPASPIIDT-RSFGDQPEKVSLHSAAAVRGLHQ 175 >gi|127512555|ref|YP_001093752.1| beta-hexosaminidase [Shewanella loihica PV-4] gi|126637850|gb|ABO23493.1| glycoside hydrolase, family 3 domain protein [Shewanella loihica PV-4] Length = 333 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++F+PVLDL G I FS P + A+ F + Sbjct: 101 MAVELLACDIDLSFAPVLDLN-GISQVIGT--RAFSDKPDEVIALAEAFIQGMQD 152 >gi|229513637|ref|ZP_04403101.1| beta-hexosaminidase [Vibrio cholerae TMA 21] gi|229521782|ref|ZP_04411200.1| beta-hexosaminidase [Vibrio cholerae TM 11079-80] gi|229341376|gb|EEO06380.1| beta-hexosaminidase [Vibrio cholerae TM 11079-80] gi|229349514|gb|EEO14470.1| beta-hexosaminidase [Vibrio cholerae TMA 21] Length = 535 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + +G N P D+ P + I F P K + R + Sbjct: 123 GEEMRGAGFNCILGPCCDVNLNPASPIIDT-RSFGDQPEKVSLHSAAAVRGLHQ 175 >gi|256824613|ref|YP_003148573.1| beta-glucosidase-like glycosyl hydrolase [Kytococcus sedentarius DSM 20547] gi|256688006|gb|ACV05808.1| beta-glucosidase-like glycosyl hydrolase [Kytococcus sedentarius DSM 20547] Length = 499 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G + F+P D+ GP+ P + E A + Y Sbjct: 115 GEQLRALGFTMVFAPDADVTVGPQDPTIGV-RSPGSDPERVAEVALALAEGYRD 167 >gi|167620358|ref|ZP_02388989.1| beta-N-Acetylglucosaminidase [Burkholderia thailandensis Bt4] Length = 699 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A + G NVNF+P +D+ P + F PA + + Sbjct: 186 LAAEIAAVGFNVNFAPDVDVNSNPLNPVINV-RAFGDDPATIGLLGRRMVQGM 237 >gi|126725248|ref|ZP_01741090.1| Putative Glycoside hydrolase [Rhodobacterales bacterium HTCC2150] gi|126704452|gb|EBA03543.1| Putative Glycoside hydrolase [Rhodobacterales bacterium HTCC2150] Length = 332 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 ++ L GI+VN +P+ DL + + + P A+ + ++ Sbjct: 106 ISDELRDVGIDVNCAPLADLTFPQTHP-FLRNRTYGGDPDTVIRLARATADGHL 158 >gi|315636991|ref|ZP_07892215.1| family 3 glycosyl hydrolase [Arcobacter butzleri JV22] gi|315478821|gb|EFU69530.1| family 3 glycosyl hydrolase [Arcobacter butzleri JV22] Length = 364 Score = 57.5 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +AK+L GIN++F+PV+DL I + F ++ + + +F K Sbjct: 143 LAKDLKDVGINLDFAPVVDLSINKNNKVIVTRGRSFGESSSEVIKYSSIFVDELRK 198 >gi|89900543|ref|YP_523014.1| beta-N-acetylhexosaminidase [Rhodoferax ferrireducens T118] gi|89345280|gb|ABD69483.1| Beta-N-acetylhexosaminidase [Rhodoferax ferrireducens T118] Length = 364 Score = 57.5 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G++ +F+PVLDL +G + I F R P A+ ++ Sbjct: 117 LGSELRACGVDFSFTPVLDLDFGASSVIG--DRAFHRDPRVVSLLAKSLMHGLLQ 169 >gi|256822605|ref|YP_003146568.1| Beta-N-acetylhexosaminidase [Kangiella koreensis DSM 16069] gi|256796144|gb|ACV26800.1| Beta-N-acetylhexosaminidase [Kangiella koreensis DSM 16069] Length = 336 Score = 57.5 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A + GI+ +F+PVLDL I FS E + F R Sbjct: 107 IAIEVQAVGIDFSFAPVLDLNKNISQVIG--DRAFSGKVDDVIELGREFIRGMND 159 >gi|163755898|ref|ZP_02163015.1| b-N-acetylglucosaminidase, glycoside hydrolase family 3 protein [Kordia algicida OT-1] gi|161324069|gb|EDP95401.1| b-N-acetylglucosaminidase, glycoside hydrolase family 3 protein [Kordia algicida OT-1] Length = 366 Score = 57.5 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 27/54 (50%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A NL+ GINVN++PVLD+ I + FS+ P A+ ++ Sbjct: 141 IAHNLLQLGINVNYAPVLDVHNDNNPPIGKNHRAFSKNPQDIINHARQVVLSHR 194 >gi|167836931|ref|ZP_02463814.1| beta-N-Acetylglucosaminidase [Burkholderia thailandensis MSMB43] Length = 699 Score = 57.5 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G NVNF+P +D+ P + F PA + ++ Sbjct: 186 LAAEIAAVGFNVNFAPDVDVNSNPLNPVINV-RAFGDDPATIGLLGRRMAQGMK 238 >gi|331695424|ref|YP_004331663.1| glycoside hydrolase family 3 domain-containing protein [Pseudonocardia dioxanivorans CB1190] gi|326950113|gb|AEA23810.1| glycoside hydrolase family 3 domain protein [Pseudonocardia dioxanivorans CB1190] Length = 409 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A LV G+ ++F+P D+ P + FS PA AQ F+ Sbjct: 187 AAALVARGVTMDFAPDADVSDQPANAVIG-DRSFSNDPAVVTRYAQAFAEGLHD 239 >gi|78186015|ref|YP_374058.1| beta-N-acetylglucosaminidase [Chlorobium luteolum DSM 273] gi|78165917|gb|ABB23015.1| beta-N-acetylglucosaminidase [Chlorobium luteolum DSM 273] Length = 585 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A +G+ NF+P DL P + + A A Sbjct: 164 IALEAKAAGLQWNFAPSADLNSNPLNPVINT-RSYGDTSEGASRMADALIEGMQ 216 >gi|124265848|ref|YP_001019852.1| glycosyl hydrolase family protein [Methylibium petroleiphilum PM1] gi|124258623|gb|ABM93617.1| glycosyl hydrolase, family 3 [Methylibium petroleiphilum PM1] Length = 347 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L G++ +F+PVLDL +GP I F R P A A+ + Sbjct: 108 LAAELRACGVDFSFAPVLDLDHGPSGVIG--DRAFHRDPRVATLLAKSLMHGLL 159 >gi|110598674|ref|ZP_01386939.1| Beta-N-acetylhexosaminidase [Chlorobium ferrooxidans DSM 13031] gi|110339727|gb|EAT58237.1| Beta-N-acetylhexosaminidase [Chlorobium ferrooxidans DSM 13031] Length = 592 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A + G++ N++P +DL P + F A A N Sbjct: 164 IALEAKSVGLHQNYAPTVDLNINPLNPVINT-RSFGDNVPLAITMANAIIEGMQSN 218 >gi|218767652|ref|YP_002342164.1| beta-hexosaminidase [Neisseria meningitidis Z2491] gi|13959410|sp|Q9JVT3|NAGZ_NEIMA RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|121051660|emb|CAM07963.1| putative hexosaminidase [Neisseria meningitidis Z2491] gi|308388713|gb|ADO31033.1| putative hexosaminidase [Neisseria meningitidis alpha710] Length = 361 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCAVIG--NRSFHRNPEAVARLALALQKGLEK 166 >gi|307609676|emb|CBW99184.1| hypothetical protein LPW_09671 [Legionella pneumophila 130b] Length = 358 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L + G N+NF+PV+DL I FS P A+ F + Sbjct: 128 MAMTLQSLGFNLNFAPVVDLNLNAHAGIIGNLGRSFSSNPEVTIRLAKQFVDVF 181 >gi|46201880|ref|ZP_00054142.2| COG1472: Beta-glucosidase-related glycosidases [Magnetospirillum magnetotacticum MS-1] Length = 215 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GI+V+ +PVLD+ + F R A + Sbjct: 111 IGAELADLGIDVDCAPVLDVPIPGAHDVIG-DRAFGRTAQSVISLAGEVIDGLLD 164 >gi|300789939|ref|YP_003770230.1| beta-glucosidase [Amycolatopsis mediterranei U32] gi|299799453|gb|ADJ49828.1| beta-glucosidase [Amycolatopsis mediterranei U32] Length = 382 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+ V+F+P D+ P+ + FS PA+ + A+ F+ Sbjct: 167 GRRLRARGVTVDFAPDTDVTGAPDDDVIG-DRSFSPDPARVKTYAKAFAEGLRD 219 >gi|242780637|ref|XP_002479638.1| beta-N-acetylglucosaminidase, putative [Talaromyces stipitatus ATCC 10500] gi|218719785|gb|EED19204.1| beta-N-acetylglucosaminidase, putative [Talaromyces stipitatus ATCC 10500] Length = 2237 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN+N++P D+ P + P + ++ + Sbjct: 1482 GELLSFFGINMNYAPDCDINSEPLNPVIGV-RSAGDDPNFVARFSCATAKGLRE 1534 >gi|261493858|ref|ZP_05990370.1| putative beta-hexosamidase A, glycoside hydrolase family 3 [Mannheimia haemolytica serotype A2 str. BOVINE] gi|261310460|gb|EEY11651.1| putative beta-hexosamidase A, glycoside hydrolase family 3 [Mannheimia haemolytica serotype A2 str. BOVINE] Length = 586 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 G N +F+P++D+ Y I +F P K E + + + + Sbjct: 131 EAAAIGCNWSFAPIVDISYNWRNPII-SNRVFGSNPDKVLEMSLAYMKGIQE 181 >gi|167582201|ref|ZP_02375075.1| beta-N-Acetylglucosaminidase [Burkholderia thailandensis TXDOH] Length = 699 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A + G NVNF+P +D+ P + F PA + + Sbjct: 186 LAAEIAAVGFNVNFAPDVDVNSNPLNPVINV-RAFGDDPATIGLLGRRMVQGM 237 >gi|83719878|ref|YP_443183.1| beta-N-acetylglucosaminidase [Burkholderia thailandensis E264] gi|257139416|ref|ZP_05587678.1| beta-N-acetylglucosaminidase [Burkholderia thailandensis E264] gi|83653703|gb|ABC37766.1| beta-N-Acetylglucosaminidase [Burkholderia thailandensis E264] Length = 699 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A + G NVNF+P +D+ P + F PA + + Sbjct: 186 LAAEIAAVGFNVNFAPDVDVNSNPLNPVINV-RAFGDDPATIGLLGRRMVQGM 237 >gi|52841120|ref|YP_094919.1| glycosyl hydrolase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|54296905|ref|YP_123274.1| hypothetical protein lpp0946 [Legionella pneumophila str. Paris] gi|52628231|gb|AAU26972.1| glycosyl hydrolase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|53750690|emb|CAH12097.1| hypothetical protein lpp0946 [Legionella pneumophila str. Paris] Length = 358 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L + G N+NF+PV+DL I FS P A+ F + Sbjct: 128 MAMTLQSLGFNLNFAPVVDLNLNAHAGIIGNLGRSFSSNPEVTIRLAKQFVDVF 181 >gi|163857569|ref|YP_001631867.1| beta-hexosaminidase [Bordetella petrii DSM 12804] gi|163261297|emb|CAP43599.1| Beta-hexosaminidase [Bordetella petrii] Length = 351 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L G++++F+PVLDL YG I F R P A+ ++ Sbjct: 117 LAAELRACGVDLSFTPVLDLDYGVSKVIG--NRAFHRDPRVVAMLARALAQGL 167 >gi|104782727|ref|YP_609225.1| beta-hexosaminidase [Pseudomonas entomophila L48] gi|95111714|emb|CAK16438.1| putative beta-N-acetyl-D-glucosaminidase NagZ [Pseudomonas entomophila L48] Length = 336 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL + + F P +A + A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDHQRSAVVGS--RAFEGDPERATQLAGAFIRGMN 156 >gi|163839004|ref|YP_001623409.1| O-glycosyl hydrolase family 3 protein [Renibacterium salmoninarum ATCC 33209] gi|162952480|gb|ABY21995.1| predicted O-Glycosyl hydrolase, family 3 [Renibacterium salmoninarum ATCC 33209] Length = 486 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + SGIN+ +PV D+ P + F R K Sbjct: 109 IGRLCRQSGINLAIAPVADVNTNPANPVIGV-RSFGADTGLVARHTAAMVRGIQK 162 >gi|193214278|ref|YP_001995477.1| glycoside hydrolase family 3 domain-containing protein [Chloroherpeton thalassium ATCC 35110] gi|193087755|gb|ACF13030.1| glycoside hydrolase family 3 domain protein [Chloroherpeton thalassium ATCC 35110] Length = 639 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ GI+ N++P +DL PE + FS A+ F Sbjct: 182 IAEEARALGIHQNYAPAVDLNNNPENPVINT-RAFSENVQLTNAMAKAFVMGSQ 234 >gi|268607950|ref|ZP_06141681.1| glycoside hydrolase family 3 domain protein [Ruminococcus flavefaciens FD-1] Length = 419 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A ++ G N+NF+PV D P + +S + + + Sbjct: 201 IAGDIKGLGFNLNFAPVADTWSNPNNTVIGT-RAYSDDFKETARLVSAAVKGFSD 254 >gi|226943572|ref|YP_002798645.1| beta-hexosaminidase [Azotobacter vinelandii DJ] gi|226718499|gb|ACO77670.1| beta-N-acetyl-D-glucosaminidase [Azotobacter vinelandii DJ] Length = 327 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ +G++ +F+PVLDL +G I F+ P A F R Sbjct: 96 MATEVLAAGLDFSFAPVLDLDHGRSAVIGS--RGFAGEPEAVVRLAGAFVRGMH 147 >gi|225548968|ref|ZP_03769945.1| putative beta-glucosidase [Borrelia burgdorferi 94a] gi|225370571|gb|EEH00008.1| putative beta-glucosidase [Borrelia burgdorferi 94a] Length = 531 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GIN+NF+P++D+ F +S P + F + + Sbjct: 125 IAQELRQLGINLNFAPIVDIYSHENNFAIGP-RTYSDNPKIVSLLSLAFYKGQKQ 178 >gi|51893636|ref|YP_076327.1| putative beta-N-acetylglucosaminidase [Symbiobacterium thermophilum IAM 14863] gi|51857325|dbj|BAD41483.1| putative beta-N-acetylglucosaminidase [Symbiobacterium thermophilum IAM 14863] Length = 637 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPA 40 MA+ L+ G+N+N +PV D+ P + F P Sbjct: 207 MARELLAVGVNMNLAPVADVNNNPANPVIGT-RSFGEQPE 245 >gi|312147816|gb|ADQ30475.1| beta-glucosidase, putative [Borrelia burgdorferi JD1] Length = 531 Score = 57.5 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GIN+NF+P++D+ F +S P + F + + Sbjct: 125 IAQELRQLGINLNFAPIVDIYSHENNFAIGP-RTYSDNPKIVSLLSLAFYKGQKQ 178 >gi|221217980|ref|ZP_03589447.1| putative beta-glucosidase [Borrelia burgdorferi 72a] gi|224532973|ref|ZP_03673581.1| putative beta-glucosidase [Borrelia burgdorferi WI91-23] gi|224533487|ref|ZP_03674077.1| putative beta-glucosidase [Borrelia burgdorferi CA-11.2a] gi|225550022|ref|ZP_03770983.1| putative beta-glucosidase [Borrelia burgdorferi 118a] gi|221192286|gb|EEE18506.1| putative beta-glucosidase [Borrelia burgdorferi 72a] gi|224512090|gb|EEF82483.1| putative beta-glucosidase [Borrelia burgdorferi WI91-23] gi|224513367|gb|EEF83728.1| putative beta-glucosidase [Borrelia burgdorferi CA-11.2a] gi|225369481|gb|EEG98933.1| putative beta-glucosidase [Borrelia burgdorferi 118a] Length = 531 Score = 57.5 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GIN+NF+P++D+ F +S P + F + + Sbjct: 125 IAQELRQLGINLNFAPIVDIYSHENNFAIGP-RTYSDNPKIVSLLSLAFYKGQKQ 178 >gi|216264549|ref|ZP_03436541.1| putative beta-glucosidase [Borrelia burgdorferi 156a] gi|226320382|ref|ZP_03795951.1| putative beta-glucosidase [Borrelia burgdorferi 29805] gi|215981022|gb|EEC21829.1| putative beta-glucosidase [Borrelia burgdorferi 156a] gi|226234245|gb|EEH32957.1| putative beta-glucosidase [Borrelia burgdorferi 29805] Length = 531 Score = 57.5 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GIN+NF+P++D+ F +S P + F + + Sbjct: 125 IAQELRQLGINLNFAPIVDIYSHENNFAIGP-RTYSDNPKIVSLLSLAFYKGQKQ 178 >gi|154314465|ref|XP_001556557.1| hypothetical protein BC1G_05326 [Botryotinia fuckeliana B05.10] gi|150848971|gb|EDN24164.1| hypothetical protein BC1G_05326 [Botryotinia fuckeliana B05.10] Length = 948 Score = 57.5 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK L G+N+ P LD+L P + + Y Sbjct: 114 AKELSAVGVNMIMGPCLDVLTNARYQPLGV-RATGDDPQEVSQYGIAAMNGYKD 166 >gi|163793126|ref|ZP_02187102.1| putative sugar hydrolase [alpha proteobacterium BAL199] gi|159181772|gb|EDP66284.1| putative sugar hydrolase [alpha proteobacterium BAL199] Length = 342 Score = 57.5 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA +LV GI+V+ P+LD+ + F PA A++ Sbjct: 108 MAADLVELGIDVDCLPLLDVRQAGAHDVIG-DRAFGGDPATVARLAKIQVEAL 159 >gi|312149347|gb|ADQ29418.1| beta-glucosidase, putative [Borrelia burgdorferi N40] Length = 531 Score = 57.5 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GIN+NF+P++D+ F +S P + F + + Sbjct: 125 IAQELRQLGINLNFAPIVDIYSHENNFAIGP-RTYSDNPKIVSLLSLAFYKGQKQ 178 >gi|195941440|ref|ZP_03086822.1| beta-glucosidase, putative [Borrelia burgdorferi 80a] gi|218249408|ref|YP_002375123.1| putative beta-glucosidase [Borrelia burgdorferi ZS7] gi|223889489|ref|ZP_03624075.1| putative beta-glucosidase [Borrelia burgdorferi 64b] gi|226321319|ref|ZP_03796846.1| putative beta-glucosidase [Borrelia burgdorferi Bol26] gi|218164596|gb|ACK74657.1| putative beta-glucosidase [Borrelia burgdorferi ZS7] gi|223885175|gb|EEF56279.1| putative beta-glucosidase [Borrelia burgdorferi 64b] gi|226233115|gb|EEH31867.1| putative beta-glucosidase [Borrelia burgdorferi Bol26] Length = 531 Score = 57.5 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GIN+NF+P++D+ F +S P + F + + Sbjct: 125 IAQELRQLGINLNFAPIVDIYSHENNFAIGP-RTYSDNPKIVSLLSLAFYKGQKQ 178 >gi|161869456|ref|YP_001598623.1| beta-hexosaminidase [Neisseria meningitidis 053442] gi|189030783|sp|A9M1Z4|NAGZ_NEIM0 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|161595009|gb|ABX72669.1| hexosaminidase [Neisseria meningitidis 053442] Length = 361 Score = 57.5 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHRNPEAVARLALALQKGLEK 166 >gi|15594965|ref|NP_212754.1| beta-glucosidase, putative [Borrelia burgdorferi B31] gi|2688545|gb|AAC66976.1| beta-glucosidase, putative [Borrelia burgdorferi B31] Length = 555 Score = 57.5 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GIN+NF+P++D+ F +S P + F + + Sbjct: 149 IAQELRQLGINLNFAPIVDIYSHENNFAIGP-RTYSDNPKIVSLLSLAFYKGQKQ 202 >gi|156036296|ref|XP_001586259.1| hypothetical protein SS1G_12837 [Sclerotinia sclerotiorum 1980] gi|154698242|gb|EDN97980.1| hypothetical protein SS1G_12837 [Sclerotinia sclerotiorum 1980 UF-70] Length = 942 Score = 57.1 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK L G+N+ P LD+L P + + Y Sbjct: 96 AKELSAVGVNMIMGPCLDVLTNARYQPLGV-RATGDDPQEVSQYGIAAMNGYKD 148 >gi|329946098|ref|ZP_08293734.1| glycosyl hydrolase family 3 protein [Actinomyces sp. oral taxon 170 str. F0386] gi|328527880|gb|EGF54868.1| glycosyl hydrolase family 3 protein [Actinomyces sp. oral taxon 170 str. F0386] Length = 408 Score = 57.1 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Query: 2 AKNLVTSGINVNFSPV---LDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYI 54 K L G+N+N +PV +D+ I + + A A F+ Sbjct: 182 GKELADVGVNMNLAPVADLVDIDRPSTNEPIGRWGREYGHDAATVSSKAGAFAEGMQ 238 >gi|225377226|ref|ZP_03754447.1| hypothetical protein ROSEINA2194_02872 [Roseburia inulinivorans DSM 16841] gi|225210930|gb|EEG93284.1| hypothetical protein ROSEINA2194_02872 [Roseburia inulinivorans DSM 16841] Length = 425 Score = 57.1 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L T G N++F+PV D+L P+ + K F + + ++ Sbjct: 209 IGTYLNTLGFNMDFAPVADVLTNPDNTVI-KDRSFGSDSQLVADMVCAEMQGLNEH 263 >gi|194097765|ref|YP_002000806.1| beta-hexosaminidase [Neisseria gonorrhoeae NCCP11945] gi|239998267|ref|ZP_04718191.1| beta-hexosaminidase [Neisseria gonorrhoeae 35/02] gi|240013451|ref|ZP_04720364.1| beta-hexosaminidase [Neisseria gonorrhoeae DGI18] gi|240120522|ref|ZP_04733484.1| beta-hexosaminidase [Neisseria gonorrhoeae PID24-1] gi|240125016|ref|ZP_04737902.1| beta-hexosaminidase [Neisseria gonorrhoeae SK-92-679] gi|268594122|ref|ZP_06128289.1| beta-hexosaminidase [Neisseria gonorrhoeae 35/02] gi|268683602|ref|ZP_06150464.1| beta-hexosaminidase [Neisseria gonorrhoeae SK-92-679] gi|226724441|sp|B4RQ67|NAGZ_NEIG2 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|193933055|gb|ACF28879.1| beta-hexosaminidase [Neisseria gonorrhoeae NCCP11945] gi|268547511|gb|EEZ42929.1| beta-hexosaminidase [Neisseria gonorrhoeae 35/02] gi|268623886|gb|EEZ56286.1| beta-hexosaminidase [Neisseria gonorrhoeae SK-92-679] gi|317163548|gb|ADV07089.1| beta-hexosaminidase [Neisseria gonorrhoeae TCDC-NG08107] Length = 361 Score = 57.1 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCAVIG--NRSFHRNPEAVARLALALQKGLAK 166 >gi|316985385|gb|EFV64333.1| beta-hexosaminidase [Neisseria meningitidis H44/76] Length = 366 Score = 57.1 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 119 LATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHRNPEAVARLALALQKGLTK 171 >gi|225551810|ref|ZP_03772753.1| putative beta-glucosidase [Borrelia sp. SV1] gi|225371605|gb|EEH01032.1| putative beta-glucosidase [Borrelia sp. SV1] Length = 531 Score = 57.1 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GIN+NF+P++D+ F +S P + F + + Sbjct: 125 IAQELRQLGINLNFAPIVDIYSHENNFAIGP-RTYSDNPKIVSLLSLAFYKGQKQ 178 >gi|15676437|ref|NP_273575.1| beta-hexosaminidase [Neisseria meningitidis MC58] gi|13959411|sp|Q9K0Q4|NAGZ_NEIMB RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|7225755|gb|AAF40960.1| glycosyl hydrolase, family 3 [Neisseria meningitidis MC58] gi|325139735|gb|EGC62269.1| beta-N-acetylhexosaminidase [Neisseria meningitidis CU385] gi|325200782|gb|ADY96237.1| beta-N-acetylhexosaminidase [Neisseria meningitidis H44/76] Length = 361 Score = 57.1 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHRNPEAVARLALALQKGLTK 166 >gi|328958378|ref|YP_004375764.1| beta-N-acetylhexosaminidase [Carnobacterium sp. 17-4] gi|328674702|gb|AEB30748.1| beta-N-acetylhexosaminidase [Carnobacterium sp. 17-4] Length = 586 Score = 57.1 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 8/52 (15%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 G N +F+P++D+ I +S + E + + + + Sbjct: 131 EAAAIGCNWSFAPIVDINRNWRNPIIST-RTWSGDVDQTIELSLAYMKGIQE 181 >gi|301063029|ref|ZP_07203594.1| glycosyl hydrolase family 3 N-terminal domain protein [delta proteobacterium NaphS2] gi|300442910|gb|EFK07110.1| glycosyl hydrolase family 3 N-terminal domain protein [delta proteobacterium NaphS2] Length = 357 Score = 57.1 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A + G+N+N +PVLD+ GP + + +F P + Q + +N Sbjct: 120 AAEMRLLGLNMNMAPVLDVSSGPVDKV-LQGRMFGDDPERVGHLGQTVIKALQEN 173 >gi|312143419|ref|YP_003994865.1| glycoside hydrolase family 3 domain protein [Halanaerobium sp. 'sapolanicus'] gi|311904070|gb|ADQ14511.1| glycoside hydrolase family 3 domain protein [Halanaerobium sp. 'sapolanicus'] Length = 568 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + G+N N+ P +D+LY I + P K + + Sbjct: 129 GREEAALGVNWNYDPCVDILYNWRNTIVNT-RAYGNTPEKVIKYTSAYLNGLKD 181 >gi|226940765|ref|YP_002795839.1| beta-hexosaminidase [Laribacter hongkongensis HLHK9] gi|226715692|gb|ACO74830.1| NagZ [Laribacter hongkongensis HLHK9] Length = 362 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L SG++++F+PVLD+ +G I F P A+ +R Sbjct: 112 LATELRASGVDLSFTPVLDIDHGRCAVIG--NRSFHADPNIVATLAEALTRGL 162 >gi|54293860|ref|YP_126275.1| hypothetical protein lpl0916 [Legionella pneumophila str. Lens] gi|53753692|emb|CAH15150.1| hypothetical protein lpl0916 [Legionella pneumophila str. Lens] Length = 358 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L + G N+NF+PV+DL I FS P A+ F + Sbjct: 128 MAMTLQSLGFNLNFAPVVDLNLNAHAGIIGNLGRSFSSNPEATIRLAKQFVDVF 181 >gi|307353677|ref|YP_003894728.1| glycoside hydrolase family 3 domain-containing protein [Methanoplanus petrolearius DSM 11571] gi|307156910|gb|ADN36290.1| glycoside hydrolase family 3 domain protein [Methanoplanus petrolearius DSM 11571] Length = 399 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETF-IAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A + +G N+NF+PV+DL+ P++ I + FS P +A + + Sbjct: 173 LADTVKDAGFNMNFAPVVDLMVNPDSPAIGKLNRSFSEDPVVVVRNAGWIIDEHQE 228 >gi|296315127|ref|ZP_06865068.1| beta-N-acetylhexosaminidase [Neisseria polysaccharea ATCC 43768] gi|296838046|gb|EFH21984.1| beta-N-acetylhexosaminidase [Neisseria polysaccharea ATCC 43768] Length = 361 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHRNPEAVARLALALQKGLEK 166 >gi|288960184|ref|YP_003450524.1| beta-N-acetylhexosaminidase [Azospirillum sp. B510] gi|288912492|dbj|BAI73980.1| beta-N-acetylhexosaminidase [Azospirillum sp. B510] Length = 358 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L GI V+ +PV D+ I FSR PA A+ + + Sbjct: 128 LAHMLTEVGITVDCAPVCDVPVEGAHDIIG-DRAFSRDPALVIALARATADGLL 180 >gi|118602352|ref|YP_903567.1| Beta-N-acetylhexosaminidase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] gi|118567291|gb|ABL02096.1| Beta-N-acetylhexosaminidase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] Length = 327 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L+ G++ +F+PVLD+ Y I F P + A K Sbjct: 106 LAYELLDIGVDFSFAPVLDINYDTSQVIG--DRAFHSNPDVIVKLAGSLISGMHK 158 >gi|114778690|ref|ZP_01453502.1| Glycoside hydrolase, family 3-like protein [Mariprofundus ferrooxydans PV-1] gi|114551052|gb|EAU53614.1| Glycoside hydrolase, family 3-like protein [Mariprofundus ferrooxydans PV-1] Length = 294 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G N +PVLDL + I K + A+ A R Sbjct: 110 GEALKELGFTHNCAPVLDLFHADGHDIIGK-RAYGADVAQVAALATACMRGLHD 162 >gi|308050226|ref|YP_003913792.1| beta-N-acetylhexosaminidase [Ferrimonas balearica DSM 9799] gi|307632416|gb|ADN76718.1| Beta-N-acetylhexosaminidase [Ferrimonas balearica DSM 9799] Length = 335 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 20/55 (36%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L I+ +F+PVLDL G I F+ P A + Sbjct: 105 MASELRAFDIDFSFAPVLDLN-GISEVIG--ERAFASRPDAVIALAGAYIDGMHD 156 >gi|260441202|ref|ZP_05795018.1| beta-hexosaminidase [Neisseria gonorrhoeae DGI2] gi|291044536|ref|ZP_06570245.1| beta-hexosaminidase [Neisseria gonorrhoeae DGI2] gi|291011430|gb|EFE03426.1| beta-hexosaminidase [Neisseria gonorrhoeae DGI2] Length = 361 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCAVIG--NRSFHRNPEAVARLALALQKGLAK 166 >gi|226199948|ref|ZP_03795498.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei Pakistan 9] gi|225928004|gb|EEH24041.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei Pakistan 9] Length = 335 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L GI+++F+PVLDL YG I F R P A+ + Sbjct: 103 LASELRACGIDMSFTPVLDLDYGRSKVIG--DRAFHRDPRVVALLAKSVNHGL 153 >gi|254184215|ref|ZP_04890805.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 1655] gi|184214746|gb|EDU11789.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 1655] Length = 342 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L GI+++F+PVLDL YG I F R P A+ + Sbjct: 110 LASELRACGIDMSFTPVLDLDYGRSKVIG--DRAFHRDPRVVALLAKSVNHGL 160 >gi|167837342|ref|ZP_02464225.1| beta-hexosaminidase [Burkholderia thailandensis MSMB43] Length = 342 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L GI+++F+PVLDL YG I F R P A+ + Sbjct: 110 LASELRACGIDMSFTPVLDLDYGRSKVIG--DRAFHRDPRVVALLAKSVNHGL 160 >gi|167825154|ref|ZP_02456625.1| beta-hexosaminidase [Burkholderia pseudomallei 9] gi|254195771|ref|ZP_04902197.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei S13] gi|169652516|gb|EDS85209.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei S13] Length = 342 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L GI+++F+PVLDL YG I F R P A+ + Sbjct: 110 LASELRACGIDMSFTPVLDLDYGRSKVIG--DRAFHRDPRVVALLAKSVNHGL 160 >gi|254357711|ref|ZP_04973984.1| glycosyl hydrolase, family 3 [Burkholderia mallei 2002721280] gi|148026838|gb|EDK84859.1| glycosyl hydrolase, family 3 [Burkholderia mallei 2002721280] Length = 391 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L GI+++F+PVLDL YG I F R P A+ + Sbjct: 110 LASELRACGIDMSFTPVLDLDYGRSKVIG--DRAFHRDPRVVALLAKSVNHGL 160 >gi|126441665|ref|YP_001059795.1| beta-hexosaminidase [Burkholderia pseudomallei 668] gi|134277067|ref|ZP_01763782.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 305] gi|167720553|ref|ZP_02403789.1| beta-hexosaminidase [Burkholderia pseudomallei DM98] gi|167903622|ref|ZP_02490827.1| beta-hexosaminidase [Burkholderia pseudomallei NCTC 13177] gi|237813190|ref|YP_002897641.1| beta-hexosaminidase [Burkholderia pseudomallei MSHR346] gi|126221158|gb|ABN84664.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 668] gi|134250717|gb|EBA50796.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 305] gi|237505767|gb|ACQ98085.1| beta-hexosaminidase [Burkholderia pseudomallei MSHR346] Length = 342 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L GI+++F+PVLDL YG I F R P A+ + Sbjct: 110 LASELRACGIDMSFTPVLDLDYGRSKVIG--DRAFHRDPRVVALLAKSVNHGL 160 >gi|76809596|ref|YP_334270.1| beta-hexosaminidase [Burkholderia pseudomallei 1710b] gi|126452419|ref|YP_001067082.1| beta-hexosaminidase [Burkholderia pseudomallei 1106a] gi|167739546|ref|ZP_02412320.1| beta-hexosaminidase [Burkholderia pseudomallei 14] gi|167846651|ref|ZP_02472159.1| beta-hexosaminidase [Burkholderia pseudomallei B7210] gi|167911871|ref|ZP_02498962.1| beta-hexosaminidase [Burkholderia pseudomallei 112] gi|242317157|ref|ZP_04816173.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 1106b] gi|254191250|ref|ZP_04897754.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei Pasteur 52237] gi|254260991|ref|ZP_04952045.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 1710a] gi|254296876|ref|ZP_04964329.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 406e] gi|76579049|gb|ABA48524.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 1710b] gi|126226061|gb|ABN89601.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 1106a] gi|157807779|gb|EDO84949.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 406e] gi|157938922|gb|EDO94592.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei Pasteur 52237] gi|242140396|gb|EES26798.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 1106b] gi|254219680|gb|EET09064.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 1710a] Length = 342 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L GI+++F+PVLDL YG I F R P A+ + Sbjct: 110 LASELRACGIDMSFTPVLDLDYGRSKVIG--DRAFHRDPRVVALLAKSVNHGL 160 >gi|53720030|ref|YP_109016.1| beta-hexosaminidase [Burkholderia pseudomallei K96243] gi|167816747|ref|ZP_02448427.1| beta-hexosaminidase [Burkholderia pseudomallei 91] gi|167895238|ref|ZP_02482640.1| beta-hexosaminidase [Burkholderia pseudomallei 7894] gi|167919868|ref|ZP_02506959.1| beta-hexosaminidase [Burkholderia pseudomallei BCC215] gi|217420384|ref|ZP_03451889.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 576] gi|52210444|emb|CAH36427.1| putative beta-hexosaminidase [Burkholderia pseudomallei K96243] gi|217395796|gb|EEC35813.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 576] Length = 342 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L GI+++F+PVLDL YG I F R P A+ + Sbjct: 110 LASELRACGIDMSFTPVLDLDYGRSKVIG--DRAFHRDPRVVALLAKSVNHGL 160 >gi|53725346|ref|YP_102344.1| beta-hexosaminidase [Burkholderia mallei ATCC 23344] gi|121599333|ref|YP_993765.1| beta-hexosaminidase [Burkholderia mallei SAVP1] gi|124384975|ref|YP_001028769.1| beta-hexosaminidase [Burkholderia mallei NCTC 10229] gi|126449904|ref|YP_001081323.1| beta-hexosaminidase [Burkholderia mallei NCTC 10247] gi|167000784|ref|ZP_02266591.1| glycosyl hydrolase, family 3 [Burkholderia mallei PRL-20] gi|238562762|ref|ZP_00439926.2| beta-hexosaminidase [Burkholderia mallei GB8 horse 4] gi|254178470|ref|ZP_04885125.1| glycosyl hydrolase, family 3 [Burkholderia mallei ATCC 10399] gi|254199237|ref|ZP_04905603.1| glycosyl hydrolase, family 3 [Burkholderia mallei FMH] gi|254205544|ref|ZP_04911896.1| glycosyl hydrolase, family 3 [Burkholderia mallei JHU] gi|52428769|gb|AAU49362.1| glycosyl hydrolase, family 3 [Burkholderia mallei ATCC 23344] gi|121228143|gb|ABM50661.1| glycosyl hydrolase, family 3 [Burkholderia mallei SAVP1] gi|124292995|gb|ABN02264.1| glycosyl hydrolase, family 3 [Burkholderia mallei NCTC 10229] gi|126242774|gb|ABO05867.1| glycosyl hydrolase, family 3 [Burkholderia mallei NCTC 10247] gi|147748833|gb|EDK55907.1| glycosyl hydrolase, family 3 [Burkholderia mallei FMH] gi|147752987|gb|EDK60052.1| glycosyl hydrolase, family 3 [Burkholderia mallei JHU] gi|160699509|gb|EDP89479.1| glycosyl hydrolase, family 3 [Burkholderia mallei ATCC 10399] gi|238522006|gb|EEP85453.1| beta-hexosaminidase [Burkholderia mallei GB8 horse 4] gi|243063333|gb|EES45519.1| glycosyl hydrolase, family 3 [Burkholderia mallei PRL-20] Length = 342 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L GI+++F+PVLDL YG I F R P A+ + Sbjct: 110 LASELRACGIDMSFTPVLDLDYGRSKVIG--DRAFHRDPRVVALLAKSVNHGL 160 >gi|240127529|ref|ZP_04740190.1| beta-hexosaminidase [Neisseria gonorrhoeae SK-93-1035] gi|268685905|ref|ZP_06152767.1| beta-hexosaminidase [Neisseria gonorrhoeae SK-93-1035] gi|268626189|gb|EEZ58589.1| beta-hexosaminidase [Neisseria gonorrhoeae SK-93-1035] Length = 361 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCAVIG--NRSFHRNPEAVARLALALQKGLAK 166 >gi|330721410|gb|EGG99472.1| Beta N-acetyl-glucosaminidase [gamma proteobacterium IMCC2047] Length = 339 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+++F+PVLD+ G I F++ P + F K Sbjct: 107 MAAEVLAEGIDLSFAPVLDVDCGLSDVIG--DRAFAQCPQVLTTLSGAFIEGMHK 159 >gi|240080030|ref|ZP_04724573.1| beta-hexosaminidase [Neisseria gonorrhoeae FA19] gi|240112240|ref|ZP_04726730.1| beta-hexosaminidase [Neisseria gonorrhoeae MS11] gi|240122821|ref|ZP_04735777.1| beta-hexosaminidase [Neisseria gonorrhoeae PID332] gi|268596174|ref|ZP_06130341.1| beta-hexosaminidase [Neisseria gonorrhoeae FA19] gi|268598298|ref|ZP_06132465.1| beta-hexosaminidase [Neisseria gonorrhoeae MS11] gi|268681435|ref|ZP_06148297.1| beta-hexosaminidase [Neisseria gonorrhoeae PID332] gi|268549962|gb|EEZ44981.1| beta-hexosaminidase [Neisseria gonorrhoeae FA19] gi|268582429|gb|EEZ47105.1| beta-hexosaminidase [Neisseria gonorrhoeae MS11] gi|268621719|gb|EEZ54119.1| beta-hexosaminidase [Neisseria gonorrhoeae PID332] Length = 361 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCAVIG--NRSFHRNPEAVARLAVALQKGLAK 166 >gi|254448324|ref|ZP_05061786.1| beta-hexosaminidase [gamma proteobacterium HTCC5015] gi|198262191|gb|EDY86474.1| beta-hexosaminidase [gamma proteobacterium HTCC5015] Length = 334 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + + G++ +F+PVLD+ YG I F + E F R Sbjct: 101 MAAEVQSVGVDFSFAPVLDVDYGGSEVIG--DRAFHSATEQIVELGGAFIRGMK 152 >gi|271966978|ref|YP_003341174.1| beta-glucosidase [Streptosporangium roseum DSM 43021] gi|270510153|gb|ACZ88431.1| Beta-glucosidase-related glycosidase-like protein [Streptosporangium roseum DSM 43021] Length = 520 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L ++ I ++++PV+D+ P + F P + Sbjct: 111 IGRLLASADITLDYAPVVDVNANPANPVIGI-RSFGPDPELVSRQTTAWITGLQ 163 >gi|240114983|ref|ZP_04729045.1| beta-hexosaminidase [Neisseria gonorrhoeae PID18] gi|240117268|ref|ZP_04731330.1| beta-hexosaminidase [Neisseria gonorrhoeae PID1] gi|268600651|ref|ZP_06134818.1| beta-hexosaminidase [Neisseria gonorrhoeae PID18] gi|268602963|ref|ZP_06137130.1| beta-hexosaminidase [Neisseria gonorrhoeae PID1] gi|268584782|gb|EEZ49458.1| beta-hexosaminidase [Neisseria gonorrhoeae PID18] gi|268587094|gb|EEZ51770.1| beta-hexosaminidase [Neisseria gonorrhoeae PID1] Length = 361 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCAVIG--NRSFHRNPEAVARLALALQKGLAK 166 >gi|302536815|ref|ZP_07289157.1| beta-N-acetylhexosaminidase [Streptomyces sp. C] gi|302445710|gb|EFL17526.1| beta-N-acetylhexosaminidase [Streptomyces sp. C] Length = 162 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 10/50 (20%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 + + L G+N+N++P D+ P+ + F A A + Sbjct: 114 LGRRLAECGVNLNWAPSADVNSNPDNPVIGV-RSFGADTALAARHTAAYV 162 >gi|297559633|ref|YP_003678607.1| glycoside hydrolase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] gi|296844081|gb|ADH66101.1| glycoside hydrolase family 3 domain protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] Length = 490 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G N++ +P +D+ + + F P A + Sbjct: 110 LGGRLAELGFNLDLAPSVDVNVADDNPVIGT-RSFGSDPELVARHAAAAVLGLQE 163 >gi|186475611|ref|YP_001857081.1| beta-hexosaminidase [Burkholderia phymatum STM815] gi|184192070|gb|ACC70035.1| Beta-N-acetylhexosaminidase [Burkholderia phymatum STM815] Length = 343 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LASELRACGIDMSFTPVLDLNYGHSQVIG--DRAFHRDPRVVTMLAKS 155 >gi|302519205|ref|ZP_07271547.1| beta-N-acetylhexosaminidase [Streptomyces sp. SPB78] gi|302428100|gb|EFK99915.1| beta-N-acetylhexosaminidase [Streptomyces sp. SPB78] Length = 414 Score = 57.1 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G+ +++P D+ P + F P R Y + Sbjct: 201 ELAALGVRQDWAPDADVNVNPANPVIGV-RSFGAAPDAVARLVVAQVRGYQE 251 >gi|144899907|emb|CAM76771.1| Beta-N-acetylhexosaminidase [Magnetospirillum gryphiswaldense MSR-1] Length = 340 Score = 57.1 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L GI+V+ +PVLD+ + F + + + Sbjct: 115 IGQELAELGIDVDCAPVLDVPIPGAHDVIG-DRAFGLTADMVADLGRAVCDGLLD 168 >gi|59800593|ref|YP_207305.1| beta-hexosaminidase [Neisseria gonorrhoeae FA 1090] gi|293397669|ref|ZP_06641875.1| beta-hexosaminidase [Neisseria gonorrhoeae F62] gi|75356422|sp|Q5FA94|NAGZ_NEIG1 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|59717488|gb|AAW88893.1| putative glycosidase [Neisseria gonorrhoeae FA 1090] gi|291611615|gb|EFF40684.1| beta-hexosaminidase [Neisseria gonorrhoeae F62] Length = 361 Score = 57.1 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCAVIG--NRSFHRNPEAVARLALALQKGLAK 166 >gi|225859881|ref|YP_002741391.1| beta-N-acetylglucosaminidase/beta-glucosidase (3-beta-N-acetyl-D-glucosaminidase/beta-D- glucosidase)(Nag3) [Streptococcus pneumoniae 70585] gi|225721849|gb|ACO17703.1| beta-N-acetylglucosaminidase/beta-glucosidase (3-beta-N-acetyl-D-glucosaminidase/beta-D- glucosidase)(Nag3) [Streptococcus pneumoniae 70585] Length = 596 Score = 56.7 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N +F+P++DL I + + E ++ + R +++ Sbjct: 133 EAAAVGCNASFAPIMDLSRNWRNPII-ANRTWGADVDQVIELSKEYMRGIMEH 184 >gi|288940239|ref|YP_003442479.1| glycoside hydrolase family 3 domain-containing protein [Allochromatium vinosum DSM 180] gi|288895611|gb|ADC61447.1| glycoside hydrolase family 3 domain protein [Allochromatium vinosum DSM 180] Length = 360 Score = 56.7 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 MA L G++ +F+PVLDL G I FS E A + R Sbjct: 108 MAAELRAVGVDFSFAPVLDLDRGISRVIG--DRGFSPDAQAVGELASSWMRG 157 >gi|262204275|ref|YP_003275483.1| glycoside hydrolase family 3 domain-containing protein [Gordonia bronchialis DSM 43247] gi|262087622|gb|ACY23590.1| glycoside hydrolase family 3 domain protein [Gordonia bronchialis DSM 43247] Length = 388 Score = 56.7 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 L G+ V+F+PV D+ + + FS PA + A ++ Sbjct: 165 GTKLKRLGVTVDFAPVADVSDESDDEVIG-DRSFSNDPAVVTKYASAYAEGL 215 >gi|254493045|ref|ZP_05106216.1| beta-hexosaminidase [Neisseria gonorrhoeae 1291] gi|226512085|gb|EEH61430.1| beta-hexosaminidase [Neisseria gonorrhoeae 1291] Length = 361 Score = 56.7 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCAVIG--NRSFHRNPEAVARLALALQKGLAK 166 >gi|282898442|ref|ZP_06306432.1| Glycoside hydrolase, family 3-like protein [Raphidiopsis brookii D9] gi|281196608|gb|EFA71514.1| Glycoside hydrolase, family 3-like protein [Raphidiopsis brookii D9] Length = 362 Score = 56.7 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L + GIN++F+PV D+ P+ + F A ++A+ + R + Sbjct: 114 ELRSLGINLSFAPVADIFSNPQNPVIGL-RAFGETAKLAGQNAREYYRGLKE 164 >gi|256393652|ref|YP_003115216.1| glycoside hydrolase family 3 domain-containing protein [Catenulispora acidiphila DSM 44928] gi|256359878|gb|ACU73375.1| glycoside hydrolase family 3 domain protein [Catenulispora acidiphila DSM 44928] Length = 482 Score = 56.7 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + ++GI++ ++PV D+ P + F PA R Sbjct: 107 IGALVHSAGIDLTYAPVADVNTEPRNPVIGA-RSFGADPALVARHVAATVRGLH 159 >gi|240015890|ref|ZP_04722430.1| beta-hexosaminidase [Neisseria gonorrhoeae FA6140] Length = 361 Score = 56.7 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCAVIG--NRSFHRNPEAVARLALALQKGLAK 166 >gi|91789480|ref|YP_550432.1| glycoside hydrolase family protein [Polaromonas sp. JS666] gi|91698705|gb|ABE45534.1| glycoside hydrolase, family 3-like protein [Polaromonas sp. JS666] Length = 352 Score = 56.7 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G++ +F+PVLDL +G I F R P A+ ++ Sbjct: 109 LGAELRACGVDFSFTPVLDLDWGESGVIG--DRAFGRDPRVVSLLAKSLMHGLLQ 161 >gi|295677171|ref|YP_003605695.1| glycoside hydrolase family 3 domain protein [Burkholderia sp. CCGE1002] gi|295437014|gb|ADG16184.1| glycoside hydrolase family 3 domain protein [Burkholderia sp. CCGE1002] Length = 342 Score = 56.7 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDMSFTPVLDLDYGHSQVIG--DRAFHRDPRVVALLAKS 155 >gi|209517217|ref|ZP_03266062.1| Beta-N-acetylhexosaminidase [Burkholderia sp. H160] gi|209502353|gb|EEA02364.1| Beta-N-acetylhexosaminidase [Burkholderia sp. H160] Length = 342 Score = 56.7 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDMSFTPVLDLDYGHSQVIG--DRAFHRDPRVVALLAKS 155 >gi|121609303|ref|YP_997110.1| beta-N-acetylhexosaminidase [Verminephrobacter eiseniae EF01-2] gi|121553943|gb|ABM58092.1| Beta-N-acetylhexosaminidase [Verminephrobacter eiseniae EF01-2] Length = 361 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G++++F+PVLDL +G + I R P A+ ++ Sbjct: 117 LGAELRACGVDLSFTPVLDLAWGRSSVIG--DRALHRDPRVVALLAKSLMHGLLQ 169 >gi|76808692|ref|YP_333209.1| YbbD [Burkholderia pseudomallei 1710b] gi|254260248|ref|ZP_04951302.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 1710a] gi|76578145|gb|ABA47620.1| YbbD [Burkholderia pseudomallei 1710b] gi|254218937|gb|EET08321.1| glycosyl hydrolase, family 3 [Burkholderia pseudomallei 1710a] Length = 699 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G NVNF+P +D+ + F PA + + Sbjct: 186 LAAEIAAVGFNVNFAPDVDVNSNSLNPVINV-RAFGDDPATIGLLGRRMVQGMK 238 >gi|303257008|ref|ZP_07343022.1| beta-N-acetylhexosaminidase [Burkholderiales bacterium 1_1_47] gi|330999954|ref|ZP_08323652.1| beta-L-N-acetylhexosaminidase [Parasutterella excrementihominis YIT 11859] gi|302860499|gb|EFL83576.1| beta-N-acetylhexosaminidase [Burkholderiales bacterium 1_1_47] gi|329573361|gb|EGG54973.1| beta-L-N-acetylhexosaminidase [Parasutterella excrementihominis YIT 11859] Length = 357 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L G++ F+P LDL YG I F R P A Sbjct: 113 MASELRACGVDFTFAPCLDLDYGQSAVIG--NRAFHRNPRVVSILATAMVSGM 163 >gi|187924870|ref|YP_001896512.1| beta-hexosaminidase [Burkholderia phytofirmans PsJN] gi|187716064|gb|ACD17288.1| Beta-N-acetylhexosaminidase [Burkholderia phytofirmans PsJN] Length = 342 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LATELRACGIDMSFTPVLDLNYGQSQVIG--DRSFHRDPRVVALLAKS 155 >gi|183220365|ref|YP_001838361.1| putative beta-N-acetylhexosaminidase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] gi|189910480|ref|YP_001962035.1| beta-glucosidase-like glycosidase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] gi|167775156|gb|ABZ93457.1| Beta-glucosidase-related glycosidase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] gi|167778787|gb|ABZ97085.1| Putative beta-N-acetylhexosaminidase; putative signal peptide [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] Length = 588 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 12/51 (23%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 + L + G+N F+PVLD+ P + F + + A + R Sbjct: 163 SYELRSLGLNFLFAPVLDINNNPLNPVINT-RSFGSDVHRVSDVAVAYERG 212 >gi|221639359|ref|YP_002525621.1| beta-N-acetylhexosaminidase [Rhodobacter sphaeroides KD131] gi|221160140|gb|ACM01120.1| Beta-N-acetylhexosaminidase [Rhodobacter sphaeroides KD131] Length = 337 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A++L GI+ N +PV D+ + A+ E A+ + ++ Sbjct: 109 IAEDLRAVGIDGNCAPVADIRTAATHP-FLANRCLADEAARVAELARAVAEAHL 161 >gi|326328609|ref|ZP_08194949.1| glycosyl hyrolase, family 3 [Nocardioidaceae bacterium Broad-1] gi|325953570|gb|EGD45570.1| glycosyl hyrolase, family 3 [Nocardioidaceae bacterium Broad-1] Length = 377 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + L +GIN++ +PV D+ P+ + FSR A + + + Sbjct: 115 IGVRLARAGINLDLAPVADVNSNPDNPVIAT-RSFSRDAGVAAKHVAAWVKGL 166 >gi|83858687|ref|ZP_00952209.1| putative sugar hydrolase [Oceanicaulis alexandrii HTCC2633] gi|83853510|gb|EAP91362.1| putative sugar hydrolase [Oceanicaulis alexandrii HTCC2633] Length = 342 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L+ GI+V+F+P DL + F P + + + Sbjct: 109 LAHELIELGIDVDFAPCADLSVPGAHDVIG-DRAFHTEPEPVAQMSTAALEGLLD 162 >gi|266622066|ref|ZP_06115001.1| glycosyl hydrolase, family 3 [Clostridium hathewayi DSM 13479] gi|288866257|gb|EFC98555.1| glycosyl hydrolase, family 3 [Clostridium hathewayi DSM 13479] Length = 210 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 ++ G N+ F+P+ D+ Y E F P + + + P Sbjct: 128 SEEAAAIGCNMAFAPICDIPYNWENTEIIT-RSFGSDPELVAKMSAAYMEGAHSTP 182 >gi|50123081|ref|YP_052248.1| putative beta-hexosaminidase [Pectobacterium atrosepticum SCRI1043] gi|49613607|emb|CAG77058.1| putative beta-hexosaminidase [Pectobacterium atrosepticum SCRI1043] Length = 598 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA++++ IN NF+PV+D+ P + FS A+ + + Sbjct: 135 MAQDMIFMHINTNFAPVVDVNTNPFNPVINV-RAFSDDADTVYRLAEKMTAGMKQ 188 >gi|325926984|ref|ZP_08188259.1| beta-glucosidase-like glycosyl hydrolase [Xanthomonas perforans 91-118] gi|325542643|gb|EGD14110.1| beta-glucosidase-like glycosyl hydrolase [Xanthomonas perforans 91-118] Length = 334 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + + + Sbjct: 104 MASEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDDPQIVATFTRAYVQALH 154 >gi|294626954|ref|ZP_06705545.1| beta-hexosaminidase [Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122] gi|294667315|ref|ZP_06732534.1| beta-hexosaminidase [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535] gi|292598814|gb|EFF42960.1| beta-hexosaminidase [Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122] gi|292602867|gb|EFF46299.1| beta-hexosaminidase [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535] Length = 334 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + + + Sbjct: 104 MASEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDDPQIVATFTRAYVQALH 154 >gi|289670311|ref|ZP_06491386.1| beta-hexosaminidase [Xanthomonas campestris pv. musacearum NCPPB4381] Length = 334 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + + + Sbjct: 104 MASEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDDPQIVATFTRAYVQALH 154 >gi|97180260|sp|Q5H1Q0|NAGZ_XANOR RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase Length = 334 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + + + Sbjct: 104 MASEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDDPQIVATFTRAYVQALH 154 >gi|97180258|sp|Q3BVU6|NAGZ_XANC5 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase Length = 334 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + + + Sbjct: 104 MASEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDDPQIVATFTRAYVQALH 154 >gi|58581490|ref|YP_200506.1| beta-hexosaminidase [Xanthomonas oryzae pv. oryzae KACC10331] gi|58426084|gb|AAW75121.1| N-acetyl-beta-glucosaminidase [Xanthomonas oryzae pv. oryzae KACC10331] Length = 361 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + + + Sbjct: 131 MASEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDDPQIVATFTRAYVQALH 181 >gi|84623419|ref|YP_450791.1| beta-hexosaminidase [Xanthomonas oryzae pv. oryzae MAFF 311018] gi|166712824|ref|ZP_02244031.1| beta-hexosaminidase [Xanthomonas oryzae pv. oryzicola BLS256] gi|97180259|sp|Q2P4L0|NAGZ_XANOM RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|84367359|dbj|BAE68517.1| N-acetyl-beta-glucosaminidase [Xanthomonas oryzae pv. oryzae MAFF 311018] Length = 334 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + + + Sbjct: 104 MASEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDDPQIVATFTRAYVQALH 154 >gi|78046942|ref|YP_363117.1| beta-hexosaminidase [Xanthomonas campestris pv. vesicatoria str. 85-10] gi|78035372|emb|CAJ23017.1| putative beta glucosaminidase [Xanthomonas campestris pv. vesicatoria str. 85-10] Length = 361 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + + + Sbjct: 131 MASEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDDPQIVATFTRAYVQALH 181 >gi|326385231|ref|ZP_08206896.1| glycoside hydrolase family 3 domain-containing protein [Gordonia neofelifaecis NRRL B-59395] gi|326196050|gb|EGD53259.1| glycoside hydrolase family 3 domain-containing protein [Gordonia neofelifaecis NRRL B-59395] Length = 405 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI V+F+P D+ P+ + FS P E A ++ Sbjct: 180 GQQMAKLGITVDFAPSADVSDEPDDEVIG-DRSFSNDPKVVTEYAGAYAAGLED 232 >gi|299133066|ref|ZP_07026261.1| glycoside hydrolase family 3 domain protein [Afipia sp. 1NLS2] gi|298593203|gb|EFI53403.1| glycoside hydrolase family 3 domain protein [Afipia sp. 1NLS2] Length = 322 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 22/53 (41%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +G N+N +PV+D+ IA+ FS P A+ F + Sbjct: 102 SAEFAATGFNINLAPVIDIYAPGNPAIAKFGRAFSSDPNIIATYARAFIDGFH 154 >gi|188577271|ref|YP_001914200.1| beta-hexosaminidase [Xanthomonas oryzae pv. oryzae PXO99A] gi|188521723|gb|ACD59668.1| beta-hexosaminidase [Xanthomonas oryzae pv. oryzae PXO99A] Length = 361 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + + + Sbjct: 131 MASEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDDPQIVATFTRAYVQALH 181 >gi|157964857|ref|YP_001499681.1| Beta-glucosidase [Rickettsia massiliae MTU5] gi|157844633|gb|ABV85134.1| Beta-glucosidase [Rickettsia massiliae MTU5] Length = 327 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +AK L GIN++F+PV DL++ I F P + Sbjct: 124 IAKALREVGINLDFAPVADLIHEGADKIVG-DRSFGGEPEVVVPLCLAAIDGLQE 177 >gi|260433440|ref|ZP_05787411.1| beta-N-acetylhexosaminidase [Silicibacter lacuscaerulensis ITI-1157] gi|260417268|gb|EEX10527.1| beta-N-acetylhexosaminidase [Silicibacter lacuscaerulensis ITI-1157] Length = 335 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L + G++ N +P++DL + + A + ++ ++ Sbjct: 106 IAHELFSLGVDSNCAPMVDLARPETHD-FLRNRCYGSDAATVARLGRAVAQGHLD 159 >gi|239946664|ref|ZP_04698417.1| beta-glucosidase [Rickettsia endosymbiont of Ixodes scapularis] gi|239920940|gb|EER20964.1| beta-glucosidase [Rickettsia endosymbiont of Ixodes scapularis] Length = 306 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L GIN++F+PV DL++ I F P + Sbjct: 111 IGKELREVGINLDFAPVADLIHEGADKIVG-DRSFGSEPEVVVPLCLAAVDGLQE 164 >gi|118580772|ref|YP_902022.1| glycoside hydrolase family 3 protein [Pelobacter propionicus DSM 2379] gi|118503482|gb|ABK99964.1| glycoside hydrolase, family 3 domain protein [Pelobacter propionicus DSM 2379] Length = 393 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIA-QKRSIFSRIPAKAEESAQLFSRTYI-KN 56 LV G N+N +PV+DL P + K+ FS PA A ++ KN Sbjct: 171 TLVEYGFNLNLAPVVDLSINPANPVIALKQRSFSADPALVSAHAAEVIASHHRKN 225 >gi|239626105|ref|ZP_04669136.1| glycoside hydrolase [Clostridiales bacterium 1_7_47_FAA] gi|239520335|gb|EEQ60201.1| glycoside hydrolase [Clostridiales bacterium 1_7_47FAA] Length = 569 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK G N NF+P++DL Y I Q F+ P A+ F + Sbjct: 131 AKESAAVGCNWNFAPIVDLTYNWRNTIVQL-RAFNDKPEDVIRYAKSFFKGMK 182 >gi|189345707|ref|YP_001942236.1| glycoside hydrolase family 3 [Chlorobium limicola DSM 245] gi|189339854|gb|ACD89257.1| glycoside hydrolase family 3 domain protein [Chlorobium limicola DSM 245] Length = 582 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A T GI+ ++SP +DL P + F A + + N Sbjct: 166 IAGEARTIGIHQSYSPNVDLNINPANPVINT-RSFGDNVPLAITMSNAMIEGFQTN 220 >gi|126729735|ref|ZP_01745548.1| beta-N-acetylhexosaminidase, putative [Sagittula stellata E-37] gi|126709854|gb|EBA08907.1| beta-N-acetylhexosaminidase, putative [Sagittula stellata E-37] Length = 326 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L + GI+ N P LD+ I + + A + + Sbjct: 103 IAHELRSMGIDGNCIPTLDVARDETHPI-LRNRCYGTDVATVVRHGRAVADGL 154 >gi|189347885|ref|YP_001944414.1| Beta-N-acetylhexosaminidase [Chlorobium limicola DSM 245] gi|189342032|gb|ACD91435.1| Beta-N-acetylhexosaminidase [Chlorobium limicola DSM 245] Length = 373 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 5 LVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIK 55 L +N+N +PVLDL E + K +S PA A L +R + + Sbjct: 150 LKKMHLNMNLAPVLDLNTNSENPVIGKLGRSYSADPAVVTRHAGLTARVFRE 201 >gi|224534572|ref|ZP_03675148.1| putative beta-glucosidase [Borrelia spielmanii A14S] gi|224514249|gb|EEF84567.1| putative beta-glucosidase [Borrelia spielmanii A14S] Length = 531 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GIN+NF+P++D+ F +S P + F + + Sbjct: 125 IAQELSRLGINLNFAPIVDIYSDENNFAIGP-RTYSDNPKIVSLLSLAFYKGQKQ 178 >gi|58197417|dbj|BAD88639.1| hypothetical protein [Streptococcus suis] Length = 596 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N +F+P++DL I + + E ++ + R +++ Sbjct: 133 EAAAVGCNASFAPIMDLSRNWRNPII-ANRTWGANVDQVIELSKEYMRGIMEH 184 >gi|330875594|gb|EGH09743.1| beta-hexosaminidase [Pseudomonas syringae pv. glycinea str. race 4] Length = 70 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 11 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPERAALLAGAFIRGMN 62 >gi|255693126|ref|ZP_05416801.1| glycosyl hydrolase [Bacteroides finegoldii DSM 17565] gi|260621168|gb|EEX44039.1| glycosyl hydrolase [Bacteroides finegoldii DSM 17565] Length = 1003 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G VNF+PV D+ P+ + F P + + ++ + Sbjct: 160 ARQCKQIGAQVNFAPVADVNINPKNPVINT-RSFGENPIQVADKVIAYASGLEE 212 >gi|25029226|ref|NP_739280.1| putative beta-N-acetylglucosaminidase [Corynebacterium efficiens YS-314] gi|259505774|ref|ZP_05748676.1| lipoprotein [Corynebacterium efficiens YS-314] gi|23494514|dbj|BAC19480.1| putative beta-N-acetylglucosaminidase [Corynebacterium efficiens YS-314] gi|259166633|gb|EEW51187.1| lipoprotein [Corynebacterium efficiens YS-314] Length = 396 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + L GINVNF+PV+D+ + FS P A A F+R Sbjct: 174 LGTGLAAHGINVNFAPVVDVDAWGLPVVG--DRSFSDNPEIAATYATAFARGL 224 >gi|170726160|ref|YP_001760186.1| beta-hexosaminidase [Shewanella woodyi ATCC 51908] gi|169811507|gb|ACA86091.1| glycoside hydrolase family 3 domain protein [Shewanella woodyi ATCC 51908] Length = 337 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++F+PVLDL I + FS P + E A F + Sbjct: 105 MAVELLACDIDLSFAPVLDLNR-VSEVIGK--RAFSSEPNEVIELAGSFIEGMHQ 156 >gi|28211770|ref|NP_782714.1| putative anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Clostridium tetani E88] gi|28204212|gb|AAO36651.1| putative anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Clostridium tetani E88] Length = 405 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++K L G N+NF+P+LD+ + + F P + Sbjct: 164 ISKELTCLGFNMNFAPILDINSNLQNPVIG-DRSFGNNPNLVTRLGIKTMEGLRE 217 >gi|223933625|ref|ZP_03625604.1| glycoside hydrolase family 3 domain protein [Streptococcus suis 89/1591] gi|223897699|gb|EEF64081.1| glycoside hydrolase family 3 domain protein [Streptococcus suis 89/1591] Length = 402 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N +F+P++DL I + + E ++ + R +++ Sbjct: 133 EAAAVGCNASFAPIMDLSRNWRNPII-ANRTWGANVDQVIELSKEYMRGIMEH 184 >gi|255020467|ref|ZP_05292532.1| Beta-hexosaminidase [Acidithiobacillus caldus ATCC 51756] gi|254970077|gb|EET27574.1| Beta-hexosaminidase [Acidithiobacillus caldus ATCC 51756] Length = 328 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+P +D+ +G I S P + A + Sbjct: 103 LAAELRDLGIDLDFTPCVDIDWGVSEVIG--DRALSDRPEWVAQLAGALWSGLQE 155 >gi|330960373|gb|EGH60633.1| beta-hexosaminidase [Pseudomonas syringae pv. maculicola str. ES4326] Length = 336 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPERAALLAGAFIRGMN 156 >gi|332522437|ref|ZP_08398689.1| putative beta-N-acetylglucosaminidase/beta-glucosidase [Streptococcus porcinus str. Jelinkova 176] gi|332313701|gb|EGJ26686.1| putative beta-N-acetylglucosaminidase/beta-glucosidase [Streptococcus porcinus str. Jelinkova 176] Length = 596 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N +F+P++DL I + + ++ + R +++ Sbjct: 133 EASAVGCNASFAPIMDLSRNWRNPII-ANRTWGSDVDQVITLSKEYMRGIMEH 184 >gi|325920667|ref|ZP_08182577.1| beta-glucosidase-like glycosyl hydrolase [Xanthomonas gardneri ATCC 19865] gi|325548857|gb|EGD19801.1| beta-glucosidase-like glycosyl hydrolase [Xanthomonas gardneri ATCC 19865] Length = 334 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + + + Sbjct: 104 MASEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDDPQIVASFTRAYVQALH 154 >gi|117927338|ref|YP_871889.1| glycoside hydrolase family 3 protein [Acidothermus cellulolyticus 11B] gi|117647801|gb|ABK51903.1| glycoside hydrolase, family 3 domain protein [Acidothermus cellulolyticus 11B] Length = 475 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 10/46 (21%), Positives = 15/46 (32%), Gaps = 1/46 (2%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 G+N N +P +D+ P + F P K F Sbjct: 115 GVNYNLAPAVDVNSDPRNPVIGV-RSFGADPDKVAAHGATFITAMQ 159 >gi|330966101|gb|EGH66361.1| beta-hexosaminidase [Pseudomonas syringae pv. actinidiae str. M302091] Length = 336 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPERAALLAGAFIRGMN 156 >gi|317470761|ref|ZP_07930145.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Anaerostipes sp. 3_2_56FAA] gi|316901750|gb|EFV23680.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Anaerostipes sp. 3_2_56FAA] Length = 416 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++ L GIN+N +PV D+L F + + ++ K Sbjct: 188 SRQLKALGINMNLAPVADVLSNENNTEVG-NRAFGSDAKEVASIVKTLVKSMQK 240 >gi|253998681|ref|YP_003050744.1| beta-hexosaminidase [Methylovorus sp. SIP3-4] gi|253985360|gb|ACT50217.1| glycoside hydrolase family 3 domain protein [Methylovorus sp. SIP3-4] Length = 351 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L GI+ +F+PVLD+ YG I F P E A + Sbjct: 108 MAVELRAHGIDFSFTPVLDMDYGVSQVIG--DRAFHMQPQAIAELAYALMQGLK 159 >gi|288905789|ref|YP_003431011.1| beta-hexosamidase (glycosyl hydrolase, family 3) [Streptococcus gallolyticus UCN34] gi|325978824|ref|YP_004288540.1| beta-N-acetylhexosaminidase [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069] gi|288732515|emb|CBI14087.1| Putative beta-hexosamidase (glycosyl hydrolase, family 3) [Streptococcus gallolyticus UCN34] gi|325178752|emb|CBZ48796.1| beta-N-acetylhexosaminidase [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069] Length = 546 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A +G N NF+PV D+ + + I + ++ + + +T +N Sbjct: 128 AVEGKAAGCNWNFAPVSDIDFNTQNPITNV-RTYGSDVQTVVDNVKCYVQTLQQN 181 >gi|257484690|ref|ZP_05638731.1| beta-hexosaminidase [Pseudomonas syringae pv. tabaci ATCC 11528] Length = 80 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 30 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPERAALLAGAFIRGM 80 >gi|330976186|gb|EGH76248.1| beta-hexosaminidase [Pseudomonas syringae pv. aptata str. DSM 50252] Length = 336 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPQRAALLAGAFIRGMN 156 >gi|330943662|gb|EGH45972.1| beta-hexosaminidase [Pseudomonas syringae pv. pisi str. 1704B] Length = 183 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPQRAALLAGAFIRGMN 156 >gi|259419054|ref|ZP_05742971.1| beta-N-acetylhexosaminidase [Silicibacter sp. TrichCH4B] gi|259345276|gb|EEW57130.1| beta-N-acetylhexosaminidase [Silicibacter sp. TrichCH4B] Length = 364 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+ N +P+ D+ + + A A+ + ++ Sbjct: 105 IAAELHDLGIDSNCAPLADVTGAGTHP-FLRNRCYGTDVANVAAIARACAEGHLD 158 >gi|116251803|ref|YP_767641.1| beta-hexosaminidase/N-acetyl-beta-glucosaminidase [Rhizobium leguminosarum bv. viciae 3841] gi|115256451|emb|CAK07535.1| putative beta-hexosaminidase/N-acetyl-beta-glucosaminidase [Rhizobium leguminosarum bv. viciae 3841] Length = 337 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L + GI+V+ PVLD+ + + + P + + Sbjct: 111 AFDLSSLGIDVDCLPVLDVPVEGSSNVIG-DRAYGGDPETVIAMGRAAAEGLK 162 >gi|302186659|ref|ZP_07263332.1| beta-hexosaminidase [Pseudomonas syringae pv. syringae 642] Length = 336 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPQRAALLAGAFIRGMN 156 >gi|71083664|ref|YP_266384.1| glycosyl hydrolase [Candidatus Pelagibacter ubique HTCC1062] gi|71062777|gb|AAZ21780.1| glycosyl hydrolase [Candidatus Pelagibacter ubique HTCC1062] Length = 316 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 5 LVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 L GIN+N PVLD+ + I FS E + + + N Sbjct: 116 LKNVGININTLPVLDVRSKGSSAIIG-DRAFSDNAKIVSEIGDICIKEFHNN 166 >gi|213969033|ref|ZP_03397173.1| beta-hexosaminidase [Pseudomonas syringae pv. tomato T1] gi|301385405|ref|ZP_07233823.1| beta-hexosaminidase [Pseudomonas syringae pv. tomato Max13] gi|302060616|ref|ZP_07252157.1| beta-hexosaminidase [Pseudomonas syringae pv. tomato K40] gi|302129988|ref|ZP_07255978.1| beta-hexosaminidase [Pseudomonas syringae pv. tomato NCPPB 1108] gi|213926332|gb|EEB59887.1| beta-hexosaminidase [Pseudomonas syringae pv. tomato T1] gi|331015779|gb|EGH95835.1| beta-hexosaminidase [Pseudomonas syringae pv. lachrymans str. M302278PT] Length = 336 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RAFEGDPERAALLAGAFIRGMN 156 >gi|167586638|ref|ZP_02379026.1| beta-hexosaminidase [Burkholderia ubonensis Bu] Length = 342 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L GI+++F+PVLDL YG I F R P A+ + Sbjct: 110 LAAELRACGIDMSFTPVLDLDYGHSKVIG--DRAFHRDPRVVTMLAKSVNHGL 160 >gi|28870668|ref|NP_793287.1| beta-hexosaminidase [Pseudomonas syringae pv. tomato str. DC3000] gi|28853916|gb|AAO56982.1| beta-hexosaminidase [Pseudomonas syringae pv. tomato str. DC3000] Length = 336 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RAFEGDPERAALLAGAFIRGMN 156 >gi|330898296|gb|EGH29715.1| beta-hexosaminidase [Pseudomonas syringae pv. japonica str. M301072PT] Length = 336 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPQRAALLAGAFIRGMN 156 >gi|51246733|ref|YP_066617.1| glycosyl hydrolase [Desulfotalea psychrophila LSv54] gi|50877770|emb|CAG37610.1| related to glycosyl hydrolase [Desulfotalea psychrophila LSv54] Length = 377 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIK 55 ++ L +G+N N +PV+DL I K + F E A + + K Sbjct: 152 SQMLKDAGVNFNLAPVVDLDLTALNPIIGKYQRSFGDNAQTVIECALSWMSAHRK 206 >gi|331011239|gb|EGH91295.1| beta-hexosaminidase [Pseudomonas syringae pv. tabaci ATCC 11528] Length = 336 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPERAALLAGAFIRGMN 156 >gi|21230740|ref|NP_636657.1| beta-hexosaminidase [Xanthomonas campestris pv. campestris str. ATCC 33913] gi|66769264|ref|YP_244026.1| beta-hexosaminidase [Xanthomonas campestris pv. campestris str. 8004] gi|188992415|ref|YP_001904425.1| beta-hexosaminidase [Xanthomonas campestris pv. campestris str. B100] gi|23821874|sp|Q8PB42|NAGZ_XANCP RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|81304777|sp|Q4USG7|NAGZ_XANC8 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724454|sp|B0RX17|NAGZ_XANCB RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|21112334|gb|AAM40581.1| N-acetyl-beta-glucosaminidase [Xanthomonas campestris pv. campestris str. ATCC 33913] gi|66574596|gb|AAY50006.1| N-acetyl-beta-glucosaminidase [Xanthomonas campestris pv. campestris str. 8004] gi|167734175|emb|CAP52383.1| Putative beta glucosaminidase [Xanthomonas campestris pv. campestris] Length = 331 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + + + Sbjct: 104 MASEVRASGVDLSFAPVVDLARGNRAI---GDRAFSDDPQVVASFTRAYVQALH 154 >gi|313200756|ref|YP_004039414.1| glycoside hydrolase family 3 domain-containing protein [Methylovorus sp. MP688] gi|312440072|gb|ADQ84178.1| glycoside hydrolase family 3 domain protein [Methylovorus sp. MP688] Length = 351 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L GI+ +F+PVLD+ YG I F P E A + Sbjct: 108 MAVELRAHGIDFSFTPVLDMDYGVSQVIG--DRAFHMQPQAIAELAYALMQGLK 159 >gi|119177155|ref|XP_001240395.1| hypothetical protein CIMG_07558 [Coccidioides immitis RS] Length = 882 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L GIN+N++P+ D+ P + ++ KN Sbjct: 150 GEILDALGINMNYAPLCDVNSEPANPVIGV-RSPGDDGTFVGRITSNIAKGLRKN 203 >gi|46205546|ref|ZP_00048398.2| COG1472: Beta-glucosidase-related glycosidases [Magnetospirillum magnetotacticum MS-1] Length = 172 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 MA +L GI V+ +P+LD+ I + P + + Sbjct: 110 MAHDLAEVGITVDCAPMLDVPVAGSDNIVG-DRAYGATPEAVTALGRAVAEG 160 >gi|289678682|ref|ZP_06499572.1| beta-hexosaminidase [Pseudomonas syringae pv. syringae FF5] Length = 155 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPQRAALLAGAFIRGM 155 >gi|289625357|ref|ZP_06458311.1| beta-hexosaminidase [Pseudomonas syringae pv. aesculi str. NCPPB3681] gi|289647506|ref|ZP_06478849.1| beta-hexosaminidase [Pseudomonas syringae pv. aesculi str. 2250] gi|298487637|ref|ZP_07005678.1| beta-glucosidase-related glycosidase [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] gi|298157729|gb|EFH98808.1| beta-glucosidase-related glycosidase [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] gi|330867765|gb|EGH02474.1| beta-hexosaminidase [Pseudomonas syringae pv. aesculi str. 0893_23] gi|330986338|gb|EGH84441.1| beta-hexosaminidase [Pseudomonas syringae pv. lachrymans str. M301315] Length = 336 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPERAALLAGAFIRGMN 156 >gi|225351839|ref|ZP_03742862.1| hypothetical protein BIFPSEUDO_03440 [Bifidobacterium pseudocatenulatum DSM 20438] gi|225157086|gb|EEG70425.1| hypothetical protein BIFPSEUDO_03440 [Bifidobacterium pseudocatenulatum DSM 20438] Length = 333 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLD---LLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L ++GINV+ +PV+ + I F + A+ F + Sbjct: 110 GSQLKSAGINVDLAPVVGTVTVDRASNGPIGALYRDFGLDADGNADHAKAFIQGMAD 166 >gi|91763295|ref|ZP_01265259.1| glycosyl hydrolase [Candidatus Pelagibacter ubique HTCC1002] gi|91717708|gb|EAS84359.1| glycosyl hydrolase [Candidatus Pelagibacter ubique HTCC1002] Length = 316 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 5 LVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 L GIN+N PVLD+ + I FS E + + + N Sbjct: 116 LKNVGININTLPVLDVRSKGSSAIIG-DRAFSDNAKIVSEIGDICIKEFHNN 166 >gi|317154368|ref|YP_004122416.1| glycoside hydrolase family 3 domain-containing protein [Desulfovibrio aespoeensis Aspo-2] gi|316944619|gb|ADU63670.1| glycoside hydrolase family 3 domain protein [Desulfovibrio aespoeensis Aspo-2] Length = 379 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETF-IAQKRSIFSRIPAKAEESAQLFSRTY 53 L +G N++F+PV D+ P++ I + FS PA+ A LF Sbjct: 158 GATLRQAGFNLDFAPVADVDVNPDSPAIGRLGRSFSADPARVGRCAGLFLAGL 210 >gi|307730522|ref|YP_003907746.1| glycoside hydrolase family 3 domain-containing protein [Burkholderia sp. CCGE1003] gi|307585057|gb|ADN58455.1| glycoside hydrolase family 3 domain protein [Burkholderia sp. CCGE1003] Length = 342 Score = 56.3 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F P A+ Sbjct: 110 LASELRACGIDMSFTPVLDLNYGQSQVIG--DRAFHSDPRVVTLLAKS 155 >gi|323526854|ref|YP_004229007.1| glycoside hydrolase family 3 domain-containing protein [Burkholderia sp. CCGE1001] gi|323383856|gb|ADX55947.1| glycoside hydrolase family 3 domain protein [Burkholderia sp. CCGE1001] Length = 342 Score = 56.3 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F P A+ Sbjct: 110 LASELRACGIDMSFTPVLDLNYGQSQVIG--DRAFHSDPRVVTLLAKS 155 >gi|254293759|ref|YP_003059782.1| glycoside hydrolase [Hirschia baltica ATCC 49814] gi|254042290|gb|ACT59085.1| glycoside hydrolase family 3 domain protein [Hirschia baltica ATCC 49814] Length = 358 Score = 56.3 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L GI + +P+LDLL+ I F P + E + + Sbjct: 110 MAAELQPLGIFADCAPILDLLHHDAHDIVG-DRAFGSSPQQVAEIGSAAIKGLMD 163 >gi|297202292|ref|ZP_06919689.1| sugar hydrolase [Streptomyces sviceus ATCC 29083] gi|197710188|gb|EDY54222.1| sugar hydrolase [Streptomyces sviceus ATCC 29083] Length = 494 Score = 56.3 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G+N+N++P D+ P + F A + Sbjct: 114 LGRRLAVCGVNLNWAPSADVNSNPSNPVIGV-RSFGAASELAARHTAAYVAGLQ 166 >gi|170695427|ref|ZP_02886572.1| Beta-N-acetylhexosaminidase [Burkholderia graminis C4D1M] gi|170139618|gb|EDT07801.1| Beta-N-acetylhexosaminidase [Burkholderia graminis C4D1M] Length = 342 Score = 56.3 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F P A+ Sbjct: 110 LASELRACGIDMSFTPVLDLNYGQSQVIG--DRAFHSDPRVVTLLAKS 155 >gi|21426068|gb|AAM52310.1|AF502251_3 beta-N-acetylglucosaminidase-like protein [Pseudomonas chlororaphis] Length = 332 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL + + F P +A A F R Sbjct: 101 MATEVLAVGLDLSFAPVLDLDHQRSAVVGT--RSFEGDPERAALLAGAFIRGMN 152 >gi|330876691|gb|EGH10840.1| beta-hexosaminidase [Pseudomonas syringae pv. morsprunorum str. M302280PT] Length = 336 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RAFEGDPERAALLAGAFIRGMN 156 >gi|70729333|ref|YP_259070.1| beta-hexosaminidase [Pseudomonas fluorescens Pf-5] gi|68343632|gb|AAY91238.1| beta-hexosaminidase [Pseudomonas fluorescens Pf-5] Length = 336 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL + + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDHQRSAVVGS--RAFEGDPEQAALLAGAFIRGMN 156 >gi|327207061|gb|AEA39181.1| beta-hexosaminidase [Pseudomonas fluorescens] Length = 336 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGS--RSFEGDPERAALLAGAFIRGM 155 >gi|289662809|ref|ZP_06484390.1| beta-hexosaminidase [Xanthomonas campestris pv. vasculorum NCPPB702] Length = 334 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + + Sbjct: 104 MASEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDDPQIVATFTGAYVQALH 154 >gi|303316141|ref|XP_003068075.1| acetyltransferase, GNAT family protein [Coccidioides posadasii C735 delta SOWgp] gi|240107751|gb|EER25930.1| acetyltransferase, GNAT family protein [Coccidioides posadasii C735 delta SOWgp] gi|320032444|gb|EFW14397.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] Length = 850 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L GIN+N++P+ D+ P + ++ KN Sbjct: 118 GEILDALGINMNYAPLCDVNSEPANPVIGV-RSPGDDGTFVGRITSNIAKGLRKN 171 >gi|149202733|ref|ZP_01879705.1| beta-N-acetylhexosaminidase, putative [Roseovarius sp. TM1035] gi|149144015|gb|EDM32049.1| beta-N-acetylhexosaminidase, putative [Roseovarius sp. TM1035] Length = 335 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+ N +P++D+ GP T + + P + + + Sbjct: 107 IAAELHALGIDSNCAPLVDVA-GPATHPFLRNRCYGVDPHTVAHLGRAVANGLLD 160 >gi|119502754|ref|ZP_01624839.1| glycosyl hydrolase [marine gamma proteobacterium HTCC2080] gi|119461100|gb|EAW42190.1| glycosyl hydrolase [marine gamma proteobacterium HTCC2080] Length = 339 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A +LV GI+VN +PVLD+ I F P E + Sbjct: 108 LALDLVALGISVNCAPVLDVPAVGAHDIIG-NRAFGAEPEVVAELGAALLEGF 159 >gi|66046510|ref|YP_236351.1| beta-hexosaminidase [Pseudomonas syringae pv. syringae B728a] gi|63257217|gb|AAY38313.1| Glycoside hydrolase, family 3, N-terminal [Pseudomonas syringae pv. syringae B728a] Length = 336 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPQRAALLAGAFIRGMN 156 >gi|167619241|ref|ZP_02387872.1| beta-hexosaminidase [Burkholderia thailandensis Bt4] Length = 342 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I R P A+ Sbjct: 110 LASELRACGIDMSFTPVLDLDYGRSKVIG--DRALHRDPRVVALLAKS 155 >gi|167581156|ref|ZP_02374030.1| beta-hexosaminidase [Burkholderia thailandensis TXDOH] Length = 342 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I R P A+ Sbjct: 110 LASELRACGIDMSFTPVLDLDYGRSKVIG--DRALHRDPRVVALLAKS 155 >gi|83721329|ref|YP_442270.1| beta-hexosaminidase [Burkholderia thailandensis E264] gi|257138463|ref|ZP_05586725.1| beta-hexosaminidase [Burkholderia thailandensis E264] gi|83655154|gb|ABC39217.1| glycosyl hydrolase, family 3 [Burkholderia thailandensis E264] Length = 342 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I R P A+ Sbjct: 110 LASELRACGIDMSFTPVLDLDYGRSKVIG--DRALHRDPRVVALLAKS 155 >gi|86138651|ref|ZP_01057224.1| beta-N-acetylhexosaminidase, putative [Roseobacter sp. MED193] gi|85824711|gb|EAQ44913.1| beta-N-acetylhexosaminidase, putative [Roseobacter sp. MED193] Length = 334 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GI+ N +PV DL+ K + + A+ ++ ++ Sbjct: 106 IAQELFELGIDSNCAPVGDLITPDTHP-FLKNRCYGTDLHQVAILARAVAQAHLD 159 >gi|71735426|ref|YP_275361.1| beta-hexosaminidase [Pseudomonas syringae pv. phaseolicola 1448A] gi|71555979|gb|AAZ35190.1| beta-hexosaminidase [Pseudomonas syringae pv. phaseolicola 1448A] Length = 336 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPERAALLAGAFIRGMN 156 >gi|269213765|ref|ZP_05982809.2| beta-N-acetylhexosaminidase [Neisseria cinerea ATCC 14685] gi|269145314|gb|EEZ71732.1| beta-N-acetylhexosaminidase [Neisseria cinerea ATCC 14685] Length = 350 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 103 LATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHRNPESVTRLALALQKGLEK 155 >gi|320323875|gb|EFW79959.1| beta-hexosaminidase [Pseudomonas syringae pv. glycinea str. B076] gi|320328012|gb|EFW84017.1| beta-hexosaminidase [Pseudomonas syringae pv. glycinea str. race 4] Length = 336 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPERAALLAGAFIRGMN 156 >gi|296158229|ref|ZP_06841061.1| Beta-N-acetylhexosaminidase [Burkholderia sp. Ch1-1] gi|295891565|gb|EFG71351.1| Beta-N-acetylhexosaminidase [Burkholderia sp. Ch1-1] Length = 342 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDMSFTPVLDLNYGQSQVIG--DRSFHRDPRVVTLLAKS 155 >gi|91784702|ref|YP_559908.1| beta-hexosaminidase [Burkholderia xenovorans LB400] gi|91688656|gb|ABE31856.1| Beta-N-acetylhexosaminidase [Burkholderia xenovorans LB400] Length = 342 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDMSFTPVLDLNYGQSQVIG--DRSFHRDPRVVTLLAKS 155 >gi|157826132|ref|YP_001493852.1| Beta-glucosidase [Rickettsia akari str. Hartford] gi|157800090|gb|ABV75344.1| Beta-glucosidase [Rickettsia akari str. Hartford] Length = 329 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L GIN++F+PV+DL++ I F + Sbjct: 111 IGKELREVGINLDFAPVVDLIHEGADKIVG-DRSFGSDLEVVVPLCLAAIDGLQE 164 >gi|330832962|ref|YP_004401787.1| glycosyl hydrolase family protein [Streptococcus suis ST3] gi|329307185|gb|AEB81601.1| glycosyl hydrolase family protein [Streptococcus suis ST3] Length = 596 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N +F+P++DL I + + E ++ + R +++ Sbjct: 133 EAAAVGCNASFAPIMDLSRNWRNPII-ANRTWGANVDQVIELSKEYMRGIMEH 184 >gi|329964727|ref|ZP_08301781.1| beta-lactamase [Bacteroides fluxus YIT 12057] gi|328525127|gb|EGF52179.1| beta-lactamase [Bacteroides fluxus YIT 12057] Length = 935 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ T G+++NF+P D P + P + E A ++R Sbjct: 154 ARQFRTLGVHINFAPDADAYTNPLNPVIPVS-SLGEDPKRVAEKAVAYARGL 204 >gi|294791438|ref|ZP_06756595.1| putative beta-N-acetylhexosaminidase [Scardovia inopinata F0304] gi|294457909|gb|EFG26263.1| putative beta-N-acetylhexosaminidase [Scardovia inopinata F0304] Length = 427 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPV---LDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L +GINV+ +PV + + I F PA F + Sbjct: 223 GSQLKAAGINVDLAPVLGTVQVQRSANAPIGALNRDFGLGPAGTASHGSAFVQGMK 278 >gi|325127636|gb|EGC50552.1| beta-N-acetylhexosaminidase [Neisseria meningitidis N1568] Length = 361 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGQCAVIG--NRSFHRNPEAVARLALALQKGLAK 166 >gi|330808508|ref|YP_004352970.1| beta-N-acetylhexosaminidase (beta-hexosaminidase); glycoside Hydrolase, GH3 family [Pseudomonas brassicacearum subsp. brassicacearum NFM421] gi|327376616|gb|AEA67966.1| Beta-N-acetylhexosaminidase (beta-hexosaminidase); Glycoside Hydrolase, GH3 family [Pseudomonas brassicacearum subsp. brassicacearum NFM421] Length = 336 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGS--RSFEGDPERAALLAGAFIRGMN 156 >gi|325915838|ref|ZP_08178137.1| beta-glucosidase-like glycosyl hydrolase [Xanthomonas vesicatoria ATCC 35937] gi|325537959|gb|EGD09656.1| beta-glucosidase-like glycosyl hydrolase [Xanthomonas vesicatoria ATCC 35937] Length = 333 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + + + Sbjct: 104 MATEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDDPQVVATFTRAYVQALH 154 >gi|111115450|ref|YP_710068.1| hypothetical protein BAPKO_0658 [Borrelia afzelii PKo] gi|216263524|ref|ZP_03435519.1| putative beta-glucosidase [Borrelia afzelii ACA-1] gi|110890724|gb|ABH01892.1| hypothetical protein BAPKO_0658 [Borrelia afzelii PKo] gi|215980368|gb|EEC21189.1| putative beta-glucosidase [Borrelia afzelii ACA-1] Length = 531 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GIN+NF+P++D+ F +S P + F + + Sbjct: 125 IAQELSRLGINLNFAPIVDIYSDENNFTIGP-RTYSDNPKIVSLLSLAFYKGQKQ 178 >gi|296444426|ref|ZP_06886391.1| Beta-N-acetylhexosaminidase [Methylosinus trichosporium OB3b] gi|296258073|gb|EFH05135.1| Beta-N-acetylhexosaminidase [Methylosinus trichosporium OB3b] Length = 330 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETF-IAQKRSIFSRIPAKAEESAQLFSRT 52 L G++VN +PV+DL P++ I + FS PA EE A+ + Sbjct: 116 HELRELGLDVNLAPVVDLDINPDSPDIGSAQRSFSADPAIVEECARTLAEA 166 >gi|254520935|ref|ZP_05132990.1| beta-hexosaminidase [Stenotrophomonas sp. SKA14] gi|219718526|gb|EED37051.1| beta-hexosaminidase [Stenotrophomonas sp. SKA14] Length = 335 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + R Sbjct: 104 MASEVRASGVDLSFAPVVDLGRGNRAI---GNRAFSEDPQVVAAFTAAYVRGMH 154 >gi|302023914|ref|ZP_07249125.1| glycosyl hydrolase family protein [Streptococcus suis 05HAS68] Length = 596 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N +F+P++DL I + + E ++ + R +++ Sbjct: 133 EAAAVGCNASFAPIMDLSRNWRNPII-ANRTWGANVDQVIELSKEYMRGIMEH 184 >gi|326791919|ref|YP_004309740.1| glycoside hydrolase [Clostridium lentocellum DSM 5427] gi|326542683|gb|ADZ84542.1| glycoside hydrolase family 3 domain protein [Clostridium lentocellum DSM 5427] Length = 425 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M K L + G N+NF+PV D+ P + K F F+ I+ Sbjct: 204 MGKLLKSLGFNMNFAPVADIYNEPGNTVIGK-RSFGETAETVTPMVIRFAEGLIQ 257 >gi|253755401|ref|YP_003028541.1| glycosyl hydrolase family protein [Streptococcus suis BM407] gi|251817865|emb|CAZ55619.1| glycosyl hydrolase family protein [Streptococcus suis BM407] Length = 596 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N +F+P++DL I + + E ++ + R +++ Sbjct: 133 EAAAVGCNASFAPIMDLSRNWRNPII-ANRTWGANVDQVIELSKEYMRGIMEH 184 >gi|302545238|ref|ZP_07297580.1| putative beta-N-Acetylglucosaminidase [Streptomyces hygroscopicus ATCC 53653] gi|302462856|gb|EFL25949.1| putative beta-N-Acetylglucosaminidase [Streptomyces himastatinicus ATCC 53653] Length = 535 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 9/51 (17%), Positives = 14/51 (27%), Gaps = 1/51 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GI +++P D+ P + F P Y Sbjct: 222 ELAALGIRQDYAPDADVNVDPANPVIGI-RSFGANPKAVARLVAAQVEGYQ 271 >gi|253751897|ref|YP_003025038.1| glycosyl hydrolase family protein [Streptococcus suis SC84] gi|253753720|ref|YP_003026861.1| glycosyl hydrolase family protein [Streptococcus suis P1/7] gi|251816186|emb|CAZ51813.1| glycosyl hydrolase family protein [Streptococcus suis SC84] gi|251819966|emb|CAR46094.1| glycosyl hydrolase family protein [Streptococcus suis P1/7] gi|319758258|gb|ADV70200.1| hypothetical protein SSUJS14_1126 [Streptococcus suis JS14] Length = 596 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N +F+P++DL I + + E ++ + R +++ Sbjct: 133 EAAAVGCNASFAPIMDLSRNWRNPII-ANRTWGANVDQVIELSKEYMRGIMEH 184 >gi|153212539|ref|ZP_01948286.1| beta-N-Acetylglucosaminidase [Vibrio cholerae 1587] gi|124116410|gb|EAY35230.1| beta-N-Acetylglucosaminidase [Vibrio cholerae 1587] Length = 535 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + +G N P D+ P + I F P K + R Sbjct: 123 GEEMRGAGFNCILGPCCDVNLNPASPIIDT-RSFGDQPEKVSLHSAAAVRGL 173 >gi|218680143|ref|ZP_03528040.1| Beta-N-acetylhexosaminidase [Rhizobium etli CIAT 894] Length = 267 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L GI+V+ PVLD+ + + + P + + Sbjct: 87 AFDLSRLGIDVDCLPVLDVPVEGSSNVIG-DRAYGGDPETVIAMGRAAAEGLK 138 >gi|146318808|ref|YP_001198520.1| hypothetical protein SSU05_1154 [Streptococcus suis 05ZYH33] gi|146321017|ref|YP_001200728.1| hypothetical protein SSU98_1170 [Streptococcus suis 98HAH33] gi|145689614|gb|ABP90120.1| hypothetical protein SSU05_1154 [Streptococcus suis 05ZYH33] gi|145691823|gb|ABP92328.1| hypothetical protein SSU98_1170 [Streptococcus suis 98HAH33] gi|292558472|gb|ADE31473.1| glycosyl hydrolase, family 3 [Streptococcus suis GZ1] Length = 600 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N +F+P++DL I + + E ++ + R +++ Sbjct: 137 EAAAVGCNASFAPIMDLSRNWRNPII-ANRTWGANVDQVIELSKEYMRGIMEH 188 >gi|319943509|ref|ZP_08017791.1| beta-N-acetylhexosaminidase [Lautropia mirabilis ATCC 51599] gi|319743324|gb|EFV95729.1| beta-N-acetylhexosaminidase [Lautropia mirabilis ATCC 51599] Length = 322 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M + L +G++ F+PVLDL +G + I F P A+ + + Sbjct: 114 MGEELRAAGVDFTFAPVLDLDWGRSSVIG--NRAFHHDPRVVAMLARCVAHGLL 165 >gi|291613754|ref|YP_003523911.1| glycoside hydrolase family 3 domain protein [Sideroxydans lithotrophicus ES-1] gi|291583866|gb|ADE11524.1| glycoside hydrolase family 3 domain protein [Sideroxydans lithotrophicus ES-1] Length = 349 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESA 46 +A L G++ +F+PVLD+ YG I F P E A Sbjct: 108 LASELRACGVDFSFTPVLDVDYGASGVIG--DRAFHSDPQAIAELA 151 >gi|319941430|ref|ZP_08015758.1| N-acetylhexosaminidase [Sutterella wadsworthensis 3_1_45B] gi|319805050|gb|EFW01880.1| N-acetylhexosaminidase [Sutterella wadsworthensis 3_1_45B] Length = 350 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L +G+++ F+PVLD+ YG I + E +A+ Sbjct: 113 LASELRAAGVDMTFAPVLDIDYGRSAVIG--NRSLGSDRDEVERNARALMSGLR 164 >gi|332525368|ref|ZP_08401531.1| glycosyl hydrolase family protein [Rubrivivax benzoatilyticus JA2] gi|332108640|gb|EGJ09864.1| glycosyl hydrolase family protein [Rubrivivax benzoatilyticus JA2] Length = 349 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L G++ +F+PVLDL +GP I F R A A+ ++ Sbjct: 109 LASELRACGVDFSFTPVLDLDHGPSQVIG--DRAFHRDARVAALLAKSLMHGLLQ 161 >gi|241204412|ref|YP_002975508.1| beta-N-acetylhexosaminidase [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240858302|gb|ACS55969.1| Beta-N-acetylhexosaminidase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 337 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L + GI+V+ PVLD+ + + + P + + Sbjct: 111 AFDLSSLGIDVDCLPVLDVPVEGSSNVIG-DRAYGADPETVIAMGRAAAEGLK 162 >gi|70727653|ref|YP_254569.1| hypothetical protein SH2654 [Staphylococcus haemolyticus JCSC1435] gi|68448379|dbj|BAE05963.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] Length = 574 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + G+N+NF P +D+L I + + F + + Sbjct: 137 GRESQALGVNINFDPCVDILKNWRNTIVNT-RAYGTTAETVIKYTNAFINGFNE 189 >gi|332558378|ref|ZP_08412700.1| putative glycoside hydrolase [Rhodobacter sphaeroides WS8N] gi|332276090|gb|EGJ21405.1| putative glycoside hydrolase [Rhodobacter sphaeroides WS8N] Length = 337 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A++L GI+ N +PV D+ + A+ E A+ + ++ Sbjct: 109 IAEDLRAVGIDGNCAPVADIRTAATHP-FLANRCLADRAARVAELARAVAEAHL 161 >gi|189219759|ref|YP_001940400.1| Beta-glucosidase-related glycosidase [Methylacidiphilum infernorum V4] gi|189186617|gb|ACD83802.1| Beta-glucosidase-related glycosidase [Methylacidiphilum infernorum V4] Length = 373 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 20/53 (37%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 K L G+N + +PVLD+ + K F+ P A+ F Sbjct: 115 GKLLRLFGLNFDLAPVLDMDTSEREHNSLKGRSFAPDPQDVSRFAKAFIEGLK 167 >gi|209549085|ref|YP_002281002.1| beta-N-acetylhexosaminidase [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209534841|gb|ACI54776.1| Beta-N-acetylhexosaminidase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 337 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L + GI+V+ PVLD+ + + + P + + Sbjct: 111 AFDLSSLGIDVDCLPVLDVPVEGSSSVIG-DRAYGGDPQTVIAMGRAAAEGLK 162 >gi|310814945|ref|YP_003962909.1| putative glycosyl hydrolase [Ketogulonicigenium vulgare Y25] gi|308753680|gb|ADO41609.1| putative glycosyl hydrolase [Ketogulonicigenium vulgare Y25] Length = 558 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA+ G+N +F+PV+D+ + + I F A+ + A + Sbjct: 132 MAREAAALGMNWSFTPVIDINHAFRSSIVAT-RSFGADVARVQRHALAAIDAFQ 184 >gi|298242410|ref|ZP_06966217.1| Beta-N-acetylhexosaminidase [Ktedonobacter racemifer DSM 44963] gi|297555464|gb|EFH89328.1| Beta-N-acetylhexosaminidase [Ktedonobacter racemifer DSM 44963] Length = 489 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 27/53 (50%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A++L++ GIN+N +PV+D+ P + + + F P + + A + Sbjct: 261 AQDLLSYGINMNLAPVVDVDTLPYSEMHIDQRTFGTTPEQVTQMAGAYLDGLQ 313 >gi|313499736|gb|ADR61102.1| NagZ [Pseudomonas putida BIRD-1] Length = 336 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL + + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDHQRSAVVGS--RAFEGDPLRATRLAGAFIRGMN 156 >gi|332298826|ref|YP_004440748.1| glycoside hydrolase family 3 domain protein [Treponema brennaborense DSM 12168] gi|332181929|gb|AEE17617.1| glycoside hydrolase family 3 domain protein [Treponema brennaborense DSM 12168] Length = 592 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 11/49 (22%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLF 49 +++ L GIN+NF+P +DL ++ + F F Sbjct: 189 ISRELRALGINMNFAPTVDLYTNHDSSVIGP-RSFGEDGDSVGVLGAAF 236 >gi|238026622|ref|YP_002910853.1| beta-hexosaminidase [Burkholderia glumae BGR1] gi|237875816|gb|ACR28149.1| Beta-glucosidase-related glycosidase [Burkholderia glumae BGR1] Length = 342 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L GI+++F+PVLDL YG I F R P A+ S Sbjct: 110 LAAELRACGIDLSFTPVLDLDYGRSKVIG--DRAFHRDPRVVTLLAKSLSHGL 160 >gi|229589085|ref|YP_002871204.1| beta-hexosaminidase [Pseudomonas fluorescens SBW25] gi|229360951|emb|CAY47811.1| beta-hexosaminidase [Pseudomonas fluorescens SBW25] Length = 336 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPERAAVLAGAFIRGMN 156 >gi|317499174|ref|ZP_07957451.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Lachnospiraceae bacterium 5_1_63FAA] gi|316893587|gb|EFV15792.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Lachnospiraceae bacterium 5_1_63FAA] Length = 399 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K L G N+N +PV D+L F K + + K Sbjct: 170 GKELKELGFNMNLAPVADVLTNKNNTEIG-DRSFGADSKKVADIITTLVKNMQK 222 >gi|167563521|ref|ZP_02356437.1| beta-hexosaminidase [Burkholderia oklahomensis EO147] gi|167570682|ref|ZP_02363556.1| beta-hexosaminidase [Burkholderia oklahomensis C6786] Length = 342 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L G++++F+PVLDL YG I F R P A+ Sbjct: 110 LASELRACGVDMSFTPVLDLDYGRSKVIG--DRAFHRDPRVVALLAKS 155 >gi|330448235|ref|ZP_08311883.1| beta-hexosaminidase [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] gi|328492426|dbj|GAA06380.1| beta-hexosaminidase [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] Length = 334 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L+ I+++F+PVLDL Y + FS P + A F + Sbjct: 101 MAAELLAMDIDISFAPVLDLGYDCKAI---GDRAFSDNPQEIIRHASQFIQGM 150 >gi|187918479|ref|YP_001884042.1| beta-hexosaminidase [Borrelia hermsii DAH] gi|119861327|gb|AAX17122.1| beta-hexosaminidase [Borrelia hermsii DAH] Length = 551 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GIN+NF+P+ D+ E F +S A F + + Sbjct: 149 IANELRQLGINLNFAPITDIYSNEENFTIGP-RAYSNNSQIVSLFALAFYKGQKQ 202 >gi|319788699|ref|YP_004090014.1| glycoside hydrolase family 3 domain protein [Ruminococcus albus 7] gi|315450566|gb|ADU24128.1| glycoside hydrolase family 3 domain protein [Ruminococcus albus 7] Length = 453 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A ++ G N++F+PV D P+ + +S +A E + + Sbjct: 235 IASDIAGLGFNLDFAPVADTWSNPDNTVIGT-RAYSDDFQQAAELVAGAVKGFKD 288 >gi|296448733|ref|ZP_06890590.1| Beta-N-acetylhexosaminidase [Methylosinus trichosporium OB3b] gi|296253755|gb|EFH00925.1| Beta-N-acetylhexosaminidase [Methylosinus trichosporium OB3b] Length = 335 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A +L G++V+ PVLD + + R PA+ + + + Sbjct: 107 IAHDLHEVGVDVDCLPVLDTPCDGAHDVIG-DRAYCRDPAEIARLGRAAAEGLL 159 >gi|294669859|ref|ZP_06734918.1| hypothetical protein NEIELOOT_01752 [Neisseria elongata subsp. glycolytica ATCC 29315] gi|291308252|gb|EFE49495.1| hypothetical protein NEIELOOT_01752 [Neisseria elongata subsp. glycolytica ATCC 29315] Length = 274 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L GI+++F+PVLDL +G I F + E A R Sbjct: 27 LAAELAACGIDLSFTPVLDLDWGNCAVIG--NRSFHKDADVVIELALALQRGLK 78 >gi|114570462|ref|YP_757142.1| Beta-N-acetylhexosaminidase [Maricaulis maris MCS10] gi|114340924|gb|ABI66204.1| Beta-N-acetylhexosaminidase [Maricaulis maris MCS10] Length = 338 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L T G++V+ +PV DL I F P + Sbjct: 109 LAHELRTIGVDVDCAPVADLRIEGADDIIG-DRAFGTTPEPVIHLGRAAMDGL 160 >gi|319406061|emb|CBI79691.1| Glycoside hydrolase, family 3-like [Bartonella sp. AR 15-3] Length = 343 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A +L+ GIN N PVLD+ + +S+ P + ++ + Sbjct: 112 AFDLMRYGINANCLPVLDVPVAGAHDVIGT-RAYSQDPQTVAALGRAAAQGLLD 164 >gi|319786938|ref|YP_004146413.1| glycoside hydrolase [Pseudoxanthomonas suwonensis 11-1] gi|317465450|gb|ADV27182.1| glycoside hydrolase family 3 domain protein [Pseudoxanthomonas suwonensis 11-1] Length = 332 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G F+ P E + + R Sbjct: 104 MASEIRASGVDLSFAPVVDLGRGNRAI---GDRAFAAEPQVVAELTRAYVRGMH 154 >gi|148241379|ref|YP_001226536.1| beta-galactosidase [Synechococcus sp. RCC307] gi|147849689|emb|CAK27183.1| Beta-glycosidase of family GH3; possible N-acetyl b-glucosaminidase [Synechococcus sp. RCC307] Length = 519 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 15/53 (28%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + G+N PV D+ P + + A + F Sbjct: 121 ALEARSLGLNWVLGPVCDVNNNPANPVINV-RAWGETAEAASALSCCFLVGLQ 172 >gi|94972246|ref|YP_594286.1| glycoside hydrolase family protein [Deinococcus geothermalis DSM 11300] gi|94554297|gb|ABF44212.1| glycoside hydrolase, family 3-like protein [Deinococcus geothermalis DSM 11300] Length = 562 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G N FSPV DL P I F + + R + Sbjct: 131 LGREGRAVGFNCTFSPVTDLDLNPLNPIVNT-RSFGSDVGRVTAFCEAAIRGFQ 183 >gi|84497895|ref|ZP_00996692.1| possible B-hexosaminidase [Janibacter sp. HTCC2649] gi|84381395|gb|EAP97278.1| possible B-hexosaminidase [Janibacter sp. HTCC2649] Length = 329 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L GINVN +PV D + I + + PA +++ F + I+ Sbjct: 102 AGELKAVGINVNLAPVTDTVPADIGTANEPIGKYGRQYGSTPATVTKASTAFLKGMIE 159 >gi|312959635|ref|ZP_07774152.1| beta-N-acetylhexosaminidase [Pseudomonas fluorescens WH6] gi|311286352|gb|EFQ64916.1| beta-N-acetylhexosaminidase [Pseudomonas fluorescens WH6] Length = 336 Score = 55.6 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPERAAVLAGAFIRGMN 156 >gi|51598873|ref|YP_073061.1| beta-glucosidase, putative [Borrelia garinii PBi] gi|51573444|gb|AAU07469.1| beta-glucosidase, putative [Borrelia garinii PBi] Length = 531 Score = 55.6 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GIN+NF+P++D+ F +S P + F + + Sbjct: 125 IAQELSQLGINLNFAPIVDIYSDENNFTIGP-RTYSDNPKIVSLFSLAFYKGQKQ 178 >gi|254804414|ref|YP_003082635.1| putative beta-hexosaminidase [Neisseria meningitidis alpha14] gi|254667956|emb|CBA04207.1| putative beta-hexosaminidase [Neisseria meningitidis alpha14] Length = 361 Score = 55.6 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHSNPEAVTRLALALQKGLAK 166 >gi|221201356|ref|ZP_03574395.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Burkholderia multivorans CGD2M] gi|221208836|ref|ZP_03581834.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Burkholderia multivorans CGD2] gi|221171292|gb|EEE03741.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Burkholderia multivorans CGD2] gi|221178624|gb|EEE11032.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Burkholderia multivorans CGD2M] Length = 342 Score = 55.6 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDMSFTPVLDLDYGQSQVIG--DRAFHRDPRVVTLLAKS 155 >gi|221214083|ref|ZP_03587056.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Burkholderia multivorans CGD1] gi|221166260|gb|EED98733.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Burkholderia multivorans CGD1] Length = 342 Score = 55.6 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDMSFTPVLDLDYGQSQVIG--DRAFHRDPRVVTLLAKS 155 >gi|34497528|ref|NP_901743.1| beta-hexosaminidase [Chromobacterium violaceum ATCC 12472] gi|47605822|sp|Q7NWB7|NAGZ_CHRVO RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|34331001|gb|AAQ59745.2| probable beta-N-acetylhexosaminidase [Chromobacterium violaceum ATCC 12472] Length = 357 Score = 55.6 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L GI+++F+PVLDL + I F R P A+ + Sbjct: 110 LAAELSACGIDLSFTPVLDLDWERCAVIG--NRAFHRDPEAVSALAEALQQGL 160 >gi|82702884|ref|YP_412450.1| beta-hexosaminidase [Nitrosospira multiformis ATCC 25196] gi|97180190|sp|Q2Y863|NAGZ_NITMU RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|82410949|gb|ABB75058.1| Beta-N-acetylhexosaminidase [Nitrosospira multiformis ATCC 25196] Length = 349 Score = 55.6 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L +G++ +F+PVLD+ YG + I + F R P E A Sbjct: 108 LAAELRAAGVDFSFTPVLDMDYGQSSVI--RDRAFHRDPQAIAELAHSLMSGLK 159 >gi|325523757|gb|EGD02011.1| beta-hexosaminidase [Burkholderia sp. TJI49] Length = 334 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 102 LAAELRACGIDMSFTPVLDLDYGHSKVIG--DRAFHRDPRVVTLLAKS 147 >gi|254674027|emb|CBA09811.1| putative beta-hexosaminidase [Neisseria meningitidis alpha275] Length = 361 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHSNPEAVTRLALALQKGLAK 166 >gi|206559403|ref|YP_002230164.1| beta-hexosaminidase [Burkholderia cenocepacia J2315] gi|206561195|ref|YP_002231960.1| beta-hexosaminidase [Burkholderia cenocepacia J2315] gi|198035441|emb|CAR51317.1| beta-hexosaminidase 2 [Burkholderia cenocepacia J2315] gi|198037237|emb|CAR53159.1| beta-hexosaminidase 1 [Burkholderia cenocepacia J2315] Length = 342 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDMSFTPVLDLDYGHSKVIG--DRAFHRDPRVVTLLAKS 155 >gi|171322518|ref|ZP_02911311.1| Beta-N-acetylhexosaminidase [Burkholderia ambifaria MEX-5] gi|171092145|gb|EDT37553.1| Beta-N-acetylhexosaminidase [Burkholderia ambifaria MEX-5] Length = 342 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDMSFTPVLDLDYGHSKVIG--DRAFHRDPRVVTLLAKS 155 >gi|170699582|ref|ZP_02890622.1| Beta-N-acetylhexosaminidase [Burkholderia ambifaria IOP40-10] gi|170135533|gb|EDT03821.1| Beta-N-acetylhexosaminidase [Burkholderia ambifaria IOP40-10] Length = 342 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDMSFTPVLDLDYGHSKVIG--DRAFHRDPRVVTLLAKS 155 >gi|167767602|ref|ZP_02439655.1| hypothetical protein CLOSS21_02135 [Clostridium sp. SS2/1] gi|167710619|gb|EDS21198.1| hypothetical protein CLOSS21_02135 [Clostridium sp. SS2/1] Length = 421 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K L G N+N +PV D+L F K + + K Sbjct: 192 GKELKELGFNMNLAPVADVLTNKNNTEIG-DRSFGADSKKVADIITTLVKNMQK 244 >gi|170732449|ref|YP_001764396.1| beta-hexosaminidase [Burkholderia cenocepacia MC0-3] gi|254245906|ref|ZP_04939227.1| Beta-N-acetylhexosaminidase [Burkholderia cenocepacia PC184] gi|124870682|gb|EAY62398.1| Beta-N-acetylhexosaminidase [Burkholderia cenocepacia PC184] gi|169815691|gb|ACA90274.1| Beta-N-acetylhexosaminidase [Burkholderia cenocepacia MC0-3] Length = 342 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDMSFTPVLDLDYGHSKVIG--DRAFHRDPRVVTLLAKS 155 >gi|172060074|ref|YP_001807726.1| beta-hexosaminidase [Burkholderia ambifaria MC40-6] gi|171992591|gb|ACB63510.1| Beta-N-acetylhexosaminidase [Burkholderia ambifaria MC40-6] Length = 342 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDMSFTPVLDLDYGHSKVIG--DRAFHRDPRVVTLLAKS 155 >gi|78065723|ref|YP_368492.1| beta-hexosaminidase [Burkholderia sp. 383] gi|77966468|gb|ABB07848.1| Beta-N-acetylhexosaminidase [Burkholderia sp. 383] Length = 342 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDMSFTPVLDLDYGHSKVIG--DRAFHRDPRVVTLLAKS 155 >gi|115351069|ref|YP_772908.1| beta-hexosaminidase [Burkholderia ambifaria AMMD] gi|115281057|gb|ABI86574.1| Beta-N-acetylhexosaminidase [Burkholderia ambifaria AMMD] Length = 342 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDMSFTPVLDLDYGHSKVIG--DRAFHRDPRVVTLLAKS 155 >gi|134295169|ref|YP_001118904.1| beta-hexosaminidase [Burkholderia vietnamiensis G4] gi|134138326|gb|ABO54069.1| Beta-N-acetylhexosaminidase [Burkholderia vietnamiensis G4] Length = 342 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDMSFTPVLDLDYGHSKVIG--DRAFHRDPRVVTLLAKS 155 >gi|107022215|ref|YP_620542.1| beta-hexosaminidase [Burkholderia cenocepacia AU 1054] gi|116689161|ref|YP_834784.1| beta-hexosaminidase [Burkholderia cenocepacia HI2424] gi|105892404|gb|ABF75569.1| Beta-N-acetylhexosaminidase [Burkholderia cenocepacia AU 1054] gi|116647250|gb|ABK07891.1| Beta-N-acetylhexosaminidase [Burkholderia cenocepacia HI2424] Length = 342 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDMSFTPVLDLDYGHSKVIG--DRAFHRDPRVVTLLAKS 155 >gi|145588598|ref|YP_001155195.1| glycoside hydrolase family 3 protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1] gi|145047004|gb|ABP33631.1| glycoside hydrolase, family 3 domain protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1] Length = 357 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L G++ +F+PVLDL +G I FSR P A+ + Sbjct: 122 LAAELRACGVDFSFTPVLDLDFGRSGVIG--DRSFSRDPQIVFVLAKSLNEGLR 173 >gi|77460091|ref|YP_349598.1| beta-hexosaminidase [Pseudomonas fluorescens Pf0-1] gi|77384094|gb|ABA75607.1| beta-hexosaminidase [Pseudomonas fluorescens Pf0-1] Length = 336 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ G++++F+PVLDL Y + F P +A A F + Sbjct: 105 MATEVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPERAALLAGAFIKGMNN 157 >gi|167032694|ref|YP_001667925.1| beta-hexosaminidase [Pseudomonas putida GB-1] gi|166859182|gb|ABY97589.1| glycoside hydrolase family 3 domain protein [Pseudomonas putida GB-1] Length = 336 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL + + F P +A + A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDHQRSAVVGS--RAFEGDPLRATQLAGAFIRGMN 156 >gi|330685353|gb|EGG97012.1| putative beta-N-acetylglucosaminidase/beta-glucosidase [Staphylococcus epidermidis VCU121] Length = 574 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + G+N+NF P +D+L I + + F + + Sbjct: 137 GRESQALGVNINFDPCVDILQNWRNTIVNT-RAYGTTADTVIKYTNAFIEGFNE 189 >gi|309379629|emb|CBX21800.1| unnamed protein product [Neisseria lactamica Y92-1009] Length = 361 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHRNPEAVTRLALALQKGLAK 166 >gi|226226343|ref|YP_002760449.1| glycosidase [Gemmatimonas aurantiaca T-27] gi|226089534|dbj|BAH37979.1| glycosidase [Gemmatimonas aurantiaca T-27] Length = 493 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ T G+N N PV DL E + K + + Sbjct: 111 AREARTMGVNWNLGPVCDLDMLSENPLIGA-RALGNDARKVGQLVAAWIEACQ 162 >gi|258564412|ref|XP_002582951.1| predicted protein [Uncinocarpus reesii 1704] gi|237908458|gb|EEP82859.1| predicted protein [Uncinocarpus reesii 1704] Length = 852 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L G+N+N++P+ D+ P + +R +N Sbjct: 118 GELLRGLGVNMNYAPLCDVNSEPANPVIGV-RSPGDDGTFVGRITSRIARGLREN 171 >gi|161525335|ref|YP_001580347.1| beta-hexosaminidase [Burkholderia multivorans ATCC 17616] gi|189349928|ref|YP_001945556.1| beta-hexosaminidase [Burkholderia multivorans ATCC 17616] gi|160342764|gb|ABX15850.1| Beta-N-acetylhexosaminidase [Burkholderia multivorans ATCC 17616] gi|189333950|dbj|BAG43020.1| beta-N-acetylhexosaminidase [Burkholderia multivorans ATCC 17616] Length = 342 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDMSFTPVLDLDYGQSQVIG--DRAFHRDPRVVTLLAKS 155 >gi|71907662|ref|YP_285249.1| beta-hexosaminidase [Dechloromonas aromatica RCB] gi|71847283|gb|AAZ46779.1| Glycoside hydrolase, family 3, N-terminal [Dechloromonas aromatica RCB] Length = 339 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L G++ +F+PVLDL YGP I F R P A + Sbjct: 111 LAAELRARGVDYSFTPVLDLDYGPSRVIG--DRAFHRQPDAVIALAAALGEGLRQ 163 >gi|319409908|emb|CBY90233.1| beta-hexosaminidase(N-acetyl-beta-glucosaminidase;beta-N- acetylhexosaminidase) [Neisseria meningitidis WUE 2594] Length = 361 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHSNPEAVTRLALALQKGLAK 166 >gi|114320483|ref|YP_742166.1| Beta-N-acetylhexosaminidase [Alkalilimnicola ehrlichii MLHE-1] gi|122311797|sp|Q0A911|NAGZ_ALHEH RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|114226877|gb|ABI56676.1| Beta-N-acetylhexosaminidase [Alkalilimnicola ehrlichii MLHE-1] Length = 348 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ G++ +F+PVLDL G I F P A+ + Sbjct: 108 MASELLACGVDFSFAPVLDLGRGVSRVIG--DRAFHSRPEAVVHLARGWVAGMRD 160 >gi|329118632|ref|ZP_08247336.1| beta-N-acetylhexosaminidase [Neisseria bacilliformis ATCC BAA-1200] gi|327465367|gb|EGF11648.1| beta-N-acetylhexosaminidase [Neisseria bacilliformis ATCC BAA-1200] Length = 359 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L GI+++F+PVLDL +G I F P A R Sbjct: 113 LATELAACGIDLSFTPVLDLDWGKCPVIG--NRSFHHNPDTVAALALALQRGL 163 >gi|26988869|ref|NP_744294.1| beta-hexosaminidase [Pseudomonas putida KT2440] gi|24983676|gb|AAN67758.1|AE016407_2 beta-hexosaminidase [Pseudomonas putida KT2440] Length = 336 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL + + F P A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDHQRSAVVGS--RAFEGDPLLATRLAGAFIRGMN 156 >gi|119512695|ref|ZP_01631768.1| hypothetical protein N9414_14538 [Nodularia spumigena CCY9414] gi|119462662|gb|EAW43626.1| hypothetical protein N9414_14538 [Nodularia spumigena CCY9414] Length = 361 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L + GINV++SPV D+ P+ I F R P E + + + Sbjct: 114 ALELKSLGINVSWSPVTDIFSHPQNPIIGL-RAFGRTPETTAEGVLEYYKGLRE 166 >gi|326773817|ref|ZP_08233099.1| beta-N-acetylhexosaminidase [Actinomyces viscosus C505] gi|326635956|gb|EGE36860.1| beta-N-acetylhexosaminidase [Actinomyces viscosus C505] Length = 444 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Query: 2 AKNLVTSGINVNFSPV---LDLLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYI 54 K L G+N+N +PV +D+ I + + A A F+ Sbjct: 219 GKELADVGVNMNLAPVADLVDIARPASNEPIGRWGREYGHDAATVSSQAGAFAEGMQ 275 >gi|218462141|ref|ZP_03502232.1| probable beta-N-acetylhexosaminidase protein [Rhizobium etli Kim 5] Length = 282 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L GINV+ PVLD+ + + + P + + Sbjct: 56 AFDLARLGINVDCLPVLDVPVEGSSNVIG-DRAYGGDPGTVIAMGRAAAEGLK 107 >gi|194337785|ref|YP_002019579.1| Beta-N-acetylhexosaminidase [Pelodictyon phaeoclathratiforme BU-1] gi|194310262|gb|ACF44962.1| Beta-N-acetylhexosaminidase [Pelodictyon phaeoclathratiforme BU-1] Length = 375 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYIK 55 AK L I +N SPV DL P+ + K FS PA + + + Sbjct: 149 AKTLKAMHIGMNLSPVADLNVNPDNPVIGKLGRSFSSDPAVVTGNISIICSLFRD 203 >gi|300022049|ref|YP_003754660.1| glycoside hydrolase [Hyphomicrobium denitrificans ATCC 51888] gi|299523870|gb|ADJ22339.1| glycoside hydrolase family 3 domain protein [Hyphomicrobium denitrificans ATCC 51888] Length = 365 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 13/50 (26%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 L + GIN++F+PVLD+ P+ + F A F++ Sbjct: 116 ELASLGINLSFAPVLDVDSNPKNPVIGA-RSFDTTVEGVIAKALTFAKAM 164 >gi|239626526|ref|ZP_04669557.1| glycoside hydrolase [Clostridiales bacterium 1_7_47_FAA] gi|239516672|gb|EEQ56538.1| glycoside hydrolase [Clostridiales bacterium 1_7_47FAA] Length = 446 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+N++F+P D+L P+ + + F R P E + + + Sbjct: 226 IGAYLHEYGLNLDFAPDADVLTNPDNTVVKT-RSFGRNPQLVTEMSLAYLEGLWE 279 >gi|317406699|gb|EFV86862.1| beta-hexosaminidase [Achromobacter xylosoxidans C54] Length = 351 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L G++++F+PVLDL YG I F + ++ + Sbjct: 117 LAAELRACGVDMSFTPVLDLDYGVSKVIG--NRAFHQDARVVTMLSRALIQGL 167 >gi|325277310|ref|ZP_08142937.1| beta-hexosaminidase [Pseudomonas sp. TJI-51] gi|324097576|gb|EGB95795.1| beta-hexosaminidase [Pseudomonas sp. TJI-51] Length = 264 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL + + F P +A + A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDHQRSAVVGS--RAFEGDPLRATQLAGAFIRGMN 156 >gi|116202251|ref|XP_001226937.1| hypothetical protein CHGG_09010 [Chaetomium globosum CBS 148.51] gi|88177528|gb|EAQ84996.1| hypothetical protein CHGG_09010 [Chaetomium globosum CBS 148.51] Length = 405 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A + G+N+ PVLD+L P + + Y Sbjct: 122 ATEISAVGVNLILGPVLDVLTNARYQPLGV-RAIGDDPQEVSQYGIASMNGYKD 174 >gi|313668989|ref|YP_004049273.1| hexosaminidase [Neisseria lactamica ST-640] gi|313006451|emb|CBN87914.1| putative hexosaminidase [Neisseria lactamica 020-06] Length = 361 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHRNPEAVTRLALALQKGLAK 166 >gi|298246456|ref|ZP_06970262.1| Beta-N-acetylhexosaminidase [Ktedonobacter racemifer DSM 44963] gi|297553937|gb|EFH87802.1| Beta-N-acetylhexosaminidase [Ktedonobacter racemifer DSM 44963] Length = 421 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A++L G+NVNF P +D+L P + F + + + + Sbjct: 181 ARDLSGLGLNVNFMPTVDVLTNPNNP-GLPQRTFGSSATLVTNMGRAYLKGLNE 233 >gi|325923740|ref|ZP_08185358.1| beta-glucosidase-like glycosyl hydrolase [Xanthomonas gardneri ATCC 19865] gi|325545778|gb|EGD17014.1| beta-glucosidase-like glycosyl hydrolase [Xanthomonas gardneri ATCC 19865] Length = 679 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A++L+ IN NF+PV D+ P + FS A + Sbjct: 216 LAQDLLALKINTNFAPVADVNANPFNPVINV-RAFSDNADVVSRLAGKIAAGM 267 >gi|154707124|ref|YP_001424543.1| beta-hexosaminidase [Coxiella burnetii Dugway 5J108-111] gi|154356410|gb|ABS77872.1| anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Coxiella burnetii Dugway 5J108-111] Length = 313 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 L GI+VN +PVLD+ G I FS P E + T N Sbjct: 106 HELKEVGIDVNMTPVLDIDQGKNEIIG--ERSFSGDPRVVEALGSVVIDTLHAN 157 >gi|313890743|ref|ZP_07824368.1| putative beta-N-acetylglucosaminidase/beta-glucosidase [Streptococcus pseudoporcinus SPIN 20026] gi|313120844|gb|EFR43958.1| putative beta-N-acetylglucosaminidase/beta-glucosidase [Streptococcus pseudoporcinus SPIN 20026] Length = 596 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N +F+P++DL I ++ + ++ + R +++ Sbjct: 133 EASAVGCNASFAPIMDLSRNWRNPII-ANRTWASDVDQVIALSKEYMRGIMEH 184 >gi|171682018|ref|XP_001905952.1| hypothetical protein [Podospora anserina S mat+] gi|170940968|emb|CAP66618.1| unnamed protein product [Podospora anserina S mat+] Length = 898 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A + G+N+ PVLD+L P + + Y Sbjct: 147 ATEVSAVGVNLILGPVLDVLTNARYQPLGV-RAVGDDPQEVSQYGIAAMNGYKD 199 >gi|270159405|ref|ZP_06188061.1| glycosyl hydrolase family 3 protein [Legionella longbeachae D-4968] gi|289165783|ref|YP_003455921.1| glycosyl hydrolase [Legionella longbeachae NSW150] gi|269987744|gb|EEZ93999.1| glycosyl hydrolase family 3 protein [Legionella longbeachae D-4968] gi|288858956|emb|CBJ12882.1| putative glycosyl hydrolase [Legionella longbeachae NSW150] Length = 357 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLL-YGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L + G N+NF+PV+DL + I FS IP + A+ F + Sbjct: 128 MALTLKSLGFNLNFAPVVDLNLQEEQGIIGALHRSFSAIPEQVIRFAKQFVNVF 181 >gi|239637332|ref|ZP_04678315.1| beta-N-acetylglucosaminidase/beta-glucosidase [Staphylococcus warneri L37603] gi|239597064|gb|EEQ79578.1| beta-N-acetylglucosaminidase/beta-glucosidase [Staphylococcus warneri L37603] Length = 574 Score = 54.8 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + G+N+NF P +D+L I + + F + + Sbjct: 137 GRESHALGVNINFDPCVDILKNWRNTIVNT-RAYGTTADTVIKYTNAFIEGFNE 189 >gi|212212509|ref|YP_002303445.1| beta-hexosaminidase [Coxiella burnetii CbuG_Q212] gi|212010919|gb|ACJ18300.1| anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Coxiella burnetii CbuG_Q212] Length = 313 Score = 54.8 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 L GI+VN +PVLD+ G I FS P E + T N Sbjct: 106 HELKEVGIDVNMTPVLDIDQGKNEIIG--ERSFSGDPRVVEALGSVVIDTLHAN 157 >gi|121634325|ref|YP_974570.1| beta-hexosaminidase [Neisseria meningitidis FAM18] gi|166233258|sp|A1KSD9|NAGZ_NEIMF RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|120866031|emb|CAM09769.1| putative hexosaminidase [Neisseria meningitidis FAM18] gi|325129655|gb|EGC52470.1| beta-N-acetylhexosaminidase [Neisseria meningitidis OX99.30304] gi|325131670|gb|EGC54375.1| beta-N-acetylhexosaminidase [Neisseria meningitidis M6190] gi|325133660|gb|EGC56317.1| beta-N-acetylhexosaminidase [Neisseria meningitidis M13399] gi|325137686|gb|EGC60263.1| beta-N-acetylhexosaminidase [Neisseria meningitidis ES14902] gi|325141738|gb|EGC64191.1| beta-N-acetylhexosaminidase [Neisseria meningitidis 961-5945] gi|325143842|gb|EGC66157.1| beta-N-acetylhexosaminidase [Neisseria meningitidis M01-240013] gi|325197742|gb|ADY93198.1| beta-N-acetylhexosaminidase [Neisseria meningitidis G2136] gi|325206618|gb|ADZ02071.1| beta-N-acetylhexosaminidase [Neisseria meningitidis M04-240196] Length = 361 Score = 54.8 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHHNPEAVAHLALALQKGLAK 166 >gi|153207609|ref|ZP_01946273.1| beta-N-acetylhexosaminidase [Coxiella burnetii 'MSU Goat Q177'] gi|165918894|ref|ZP_02218980.1| beta-N-acetylhexosaminidase [Coxiella burnetii RSA 334] gi|212218521|ref|YP_002305308.1| beta-hexosaminidase [Coxiella burnetii CbuK_Q154] gi|120576428|gb|EAX33052.1| beta-N-acetylhexosaminidase [Coxiella burnetii 'MSU Goat Q177'] gi|165917442|gb|EDR36046.1| beta-N-acetylhexosaminidase [Coxiella burnetii RSA 334] gi|212012783|gb|ACJ20163.1| anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Coxiella burnetii CbuK_Q154] Length = 313 Score = 54.8 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 L GI+VN +PVLD+ G I FS P E + T N Sbjct: 106 HELKEVGIDVNMTPVLDIDQGKNEIIG--ERSFSGDPRVVEALGSVVIDTLHAN 157 >gi|327480340|gb|AEA83650.1| beta-hexosaminidase [Pseudomonas stutzeri DSM 4166] Length = 332 Score = 54.8 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++ +F+PVLDL + + F P A F R Sbjct: 101 MASEVLAVGLDFSFAPVLDLDHQRSAVVGA--RAFEGDPQVAVTLIDAFIRGMH 152 >gi|164425990|ref|XP_960361.2| hypothetical protein NCU04726 [Neurospora crassa OR74A] gi|157071155|gb|EAA31125.2| hypothetical protein NCU04726 [Neurospora crassa OR74A] Length = 1052 Score = 54.8 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A + G+N+ PVLD+L S P + + + Y Sbjct: 91 ATEVSACGVNLILGPVLDVLTNARYQPLGV-RATSDDPQEVSQYGIAAMKGYKD 143 >gi|39979176|emb|CAE85548.1| related to beta-N-acetylglucosaminidase [Neurospora crassa] Length = 1085 Score = 54.8 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A + G+N+ PVLD+L S P + + + Y Sbjct: 124 ATEVSACGVNLILGPVLDVLTNARYQPLGV-RATSDDPQEVSQYGIAAMKGYKD 176 >gi|330815991|ref|YP_004359696.1| Beta-glucosidase-related glycosidase [Burkholderia gladioli BSR3] gi|327368384|gb|AEA59740.1| Beta-glucosidase-related glycosidase [Burkholderia gladioli BSR3] Length = 342 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAAELRACGIDLSFTPVLDLDYGRSKVIG--DRAFHRDPRVVTLLAKS 155 >gi|253996100|ref|YP_003048164.1| beta-hexosaminidase [Methylotenera mobilis JLW8] gi|253982779|gb|ACT47637.1| glycoside hydrolase family 3 domain protein [Methylotenera mobilis JLW8] Length = 348 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L G++ +F+PVLD+ YG I F P + A + K Sbjct: 108 LAAELRAHGVDFSFTPVLDMDYGDSLVIG--DRAFHLNPQAISDLAFALMQGLKK 160 >gi|92117305|ref|YP_577034.1| Beta-N-acetylhexosaminidase [Nitrobacter hamburgensis X14] gi|91800199|gb|ABE62574.1| Beta-N-acetylhexosaminidase [Nitrobacter hamburgensis X14] Length = 341 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A +L GI V+ P+ D+ + + P K A+ + + Sbjct: 110 IAADLADLGITVDCLPLADVPASGADAVIG-DRAYGADPDKVATIARAVTEGLEQ 163 >gi|192764520|gb|ACF05804.1| N-acetylhexosaminidase [Collimonas fungivorans Ter331] Length = 349 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L G++++F+PVLDL YG + I F R P A+ Sbjct: 118 LASELRACGVDLSFTPVLDLDYGDSSVIG--ERAFHRDPRVVALLAKS 163 >gi|86357448|ref|YP_469340.1| beta-N-acetylhexosaminidase protein [Rhizobium etli CFN 42] gi|86281550|gb|ABC90613.1| probable beta-N-acetylhexosaminidase protein [Rhizobium etli CFN 42] Length = 356 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L GINV+ PVLD+ + + + P + Sbjct: 130 AFDLSNLGINVDCLPVLDVPVEGSSNVIG-DRAYGGDPETVIAMGRAAGEGLK 181 >gi|300311265|ref|YP_003775357.1| beta-N-acetylhexosaminidase [Herbaspirillum seropedicae SmR1] gi|300074050|gb|ADJ63449.1| beta-N-acetylhexosaminidase protein [Herbaspirillum seropedicae SmR1] Length = 342 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG T I F R P A+ Sbjct: 113 LAAELRACGIDLSFTPVLDLDYGASTVIG--DRSFHRDPRVVTLMAKS 158 >gi|114707224|ref|ZP_01440122.1| glycosyl hydrolase, family 3 [Fulvimarina pelagi HTCC2506] gi|114537420|gb|EAU40546.1| glycosyl hydrolase, family 3 [Fulvimarina pelagi HTCC2506] Length = 340 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 +A +L+ GIN + P +D+ I S P + + + Sbjct: 111 LAADLMRYGINADCVPCIDVPVEGAHDIIG-DRALSNDPHEVAVLGRAMAEG 161 >gi|48477092|ref|YP_022798.1| beta-hexosaminidase [Picrophilus torridus DSM 9790] gi|48429740|gb|AAT42605.1| beta-hexosaminidase [Picrophilus torridus DSM 9790] Length = 454 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L + GI N +PVLDLL P+ + F + K + + + Sbjct: 107 GSELRSIGILWNHAPVLDLLESPKNPVI-LERSFGKNSKKVSKLGKSYINGLQ 158 >gi|310818552|ref|YP_003950910.1| glycosyl hydrolase, family 3 [Stigmatella aurantiaca DW4/3-1] gi|309391624|gb|ADO69083.1| Glycosyl hydrolase, family 3 [Stigmatella aurantiaca DW4/3-1] Length = 366 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 11/40 (27%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPA 40 +A L G + +F+PVLD+ P + FS+ Sbjct: 111 LAHELRAVGFDWDFAPVLDVDTNPANPVIG-DRSFSQHAQ 149 >gi|223558165|gb|ACM91578.1| chitosanase [Anabaena laxa RPAN8] gi|223558167|gb|ACM91579.1| chitosanase [Anabaena iyengarii RPAN9] Length = 217 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLF 49 A L + GIN+++SPV D+ P+ I F P A A+ + Sbjct: 114 AIELKSLGINLSWSPVADIYSHPQNPIIGS-RAFGNTPETAATGAREY 160 >gi|115372816|ref|ZP_01460121.1| beta-hexosaminidase [Stigmatella aurantiaca DW4/3-1] gi|115370083|gb|EAU69013.1| beta-hexosaminidase [Stigmatella aurantiaca DW4/3-1] Length = 289 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 11/40 (27%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPA 40 +A L G + +F+PVLD+ P + FS+ Sbjct: 34 LAHELRAVGFDWDFAPVLDVDTNPANPVIG-DRSFSQHAQ 72 >gi|75911043|ref|YP_325339.1| glycoside hydrolase family protein [Anabaena variabilis ATCC 29413] gi|75704768|gb|ABA24444.1| Glycoside hydrolase, family 3-like protein [Anabaena variabilis ATCC 29413] gi|262409829|gb|ACY66645.1| glycoside hydrolase family 3-like protein [Anabaena sphaerica RPAN12] Length = 361 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLF 49 A L + GIN+++SPV D+ P+ I F P A A+ + Sbjct: 114 AIELKSLGINLSWSPVADIYSHPQNPIIGS-RAFGNTPETAATGAREY 160 >gi|29654384|ref|NP_820076.1| beta-hexosaminidase [Coxiella burnetii RSA 493] gi|161831283|ref|YP_001596651.1| beta-hexosaminidase [Coxiella burnetii RSA 331] gi|29541651|gb|AAO90590.1| anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Coxiella burnetii RSA 493] gi|161763150|gb|ABX78792.1| beta-N-acetylhexosaminidase [Coxiella burnetii RSA 331] Length = 313 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 L GI+VN +PVLD+ G I FS P E + T N Sbjct: 106 HELKEVGIDVNMTPVLDIDQGKNEIIG--ERSFSGDPRVVEALGSVVIDTLHAN 157 >gi|190575404|ref|YP_001973249.1| beta-hexosaminidase [Stenotrophomonas maltophilia K279a] gi|226724453|sp|B2FPW9|NAGZ_STRMK RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|190013326|emb|CAQ46960.1| putative beta-hexosaminidase [Stenotrophomonas maltophilia K279a] Length = 335 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + R Sbjct: 104 MASEVRASGLDLSFAPVVDLGRGNRAI---GNRAFSEDPQVVAAFTAAYVRGMH 154 >gi|194366740|ref|YP_002029350.1| beta-hexosaminidase [Stenotrophomonas maltophilia R551-3] gi|226724452|sp|B4SRK3|NAGZ_STRM5 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|194349544|gb|ACF52667.1| glycoside hydrolase family 3 domain protein [Stenotrophomonas maltophilia R551-3] Length = 335 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + R Sbjct: 104 MASEVRASGLDLSFAPVVDLGRGNRAI---GNRAFSEDPQVVAAFTAAYVRGMH 154 >gi|171463196|ref|YP_001797309.1| Beta-N-acetylhexosaminidase [Polynucleobacter necessarius subsp. necessarius STIR1] gi|171192734|gb|ACB43695.1| Beta-N-acetylhexosaminidase [Polynucleobacter necessarius subsp. necessarius STIR1] Length = 357 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L G++ +F+PVLDL +G I F+R P ++ + Sbjct: 122 LAAELRACGVDFSFTPVLDLDFGRSGVIG--DRSFNRDPQIVFALSKSLNEGLR 173 >gi|261393099|emb|CAX50696.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase; beta-N-acetylhexosaminidase) [Neisseria meningitidis 8013] Length = 361 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHHNPEAVAHLALALQKGLAK 166 >gi|158321394|ref|YP_001513901.1| glycoside hydrolase family 3 protein [Alkaliphilus oremlandii OhILAs] gi|158141593|gb|ABW19905.1| glycoside hydrolase family 3 domain protein [Alkaliphilus oremlandii OhILAs] Length = 418 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + + G N+NF+PVLD+ P + +K F + P + + Sbjct: 173 LGAMVKSFGYNMNFAPVLDIDSNPANPVIEK-RSFGKTPDIVSKMGIAEMKGM 224 >gi|17229323|ref|NP_485871.1| hypothetical protein all1831 [Nostoc sp. PCC 7120] gi|17130921|dbj|BAB73530.1| all1831 [Nostoc sp. PCC 7120] Length = 365 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLF 49 A L + GIN+++SPV D+ P+ I F P A A+ + Sbjct: 114 AIELKSLGINLSWSPVADIYSHPQNPIIGS-RAFGNTPDTAAAGAREY 160 >gi|126432832|ref|YP_001068523.1| Beta-N-acetylhexosaminidase [Mycobacterium sp. JLS] gi|126232632|gb|ABN96032.1| Beta-N-acetylhexosaminidase [Mycobacterium sp. JLS] Length = 397 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + G+ ++F+PV+D+ G I F PA E A ++R Sbjct: 175 GRAMRGLGVTIDFAPVVDV-TGASAAIG--DRSFGDDPATVTEYAGAYARGLRD 225 >gi|108797209|ref|YP_637406.1| Beta-N-acetylhexosaminidase [Mycobacterium sp. MCS] gi|119866294|ref|YP_936246.1| Beta-N-acetylhexosaminidase [Mycobacterium sp. KMS] gi|108767628|gb|ABG06350.1| Beta-N-acetylhexosaminidase [Mycobacterium sp. MCS] gi|119692383|gb|ABL89456.1| Beta-N-acetylhexosaminidase [Mycobacterium sp. KMS] Length = 401 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + G+ ++F+PV+D+ G I F PA E A ++R Sbjct: 179 GRAMRGLGVTIDFAPVVDV-TGASAAIG--DRSFGDDPATVTEYAGAYARGLRD 229 >gi|21242087|ref|NP_641669.1| beta-hexosaminidase [Xanthomonas axonopodis pv. citri str. 306] gi|23821876|sp|Q8PMU1|NAGZ_XANAC RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|21107495|gb|AAM36205.1| N-acetyl-beta-glucosaminidase [Xanthomonas axonopodis pv. citri str. 306] Length = 334 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + SG++++F+PV+DL G FS P + + + Sbjct: 104 MASEVRASGVDLSFAPVVDLGRGNRAI---GDRAFSDEPQIVATFTRAYVQALH 154 >gi|329912349|ref|ZP_08275730.1| Beta N-acetyl-glucosaminidase [Oxalobacteraceae bacterium IMCC9480] gi|327545636|gb|EGF30794.1| Beta N-acetyl-glucosaminidase [Oxalobacteraceae bacterium IMCC9480] Length = 243 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L G++++F+PVLDL +G I F R PA + A+ + + Sbjct: 117 LAAELRACGVDLSFTPVLDLDHGESGVIG--DRAFHRDPAVVTQLAKSLNHGLL 168 >gi|300716247|ref|YP_003741050.1| Beta-hexosaminidase (N-acetyl-beta-glucosaminidase) [Erwinia billingiae Eb661] gi|299062083|emb|CAX59199.1| Beta-hexosaminidase (N-acetyl-beta-glucosaminidase) [Erwinia billingiae Eb661] Length = 340 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ +G F PA A A+ F R Sbjct: 104 MASEMIAMDIDISFAPVLDIGHGSAAI---GERSFHEDPAIALRMARQFIRGMHD 155 >gi|325202681|gb|ADY98135.1| beta-N-acetylhexosaminidase [Neisseria meningitidis M01-240149] Length = 361 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHHNPEAVAHLALALQKGLAK 166 >gi|320588964|gb|EFX01432.1| glycoside hydrolase [Grosmannia clavigera kw1407] Length = 1012 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A + G+N+ PVLD+L S P + + Y Sbjct: 128 ATEVSACGVNLMLGPVLDVLTNARYQPLGV-RATSDDPQEVSQYGIAAMNGYKD 180 >gi|320532767|ref|ZP_08033549.1| glycosyl hydrolase family 3 protein [Actinomyces sp. oral taxon 171 str. F0337] gi|320135012|gb|EFW27178.1| glycosyl hydrolase family 3 protein [Actinomyces sp. oral taxon 171 str. F0337] Length = 353 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Query: 2 AKNLVTSGINVNFSPVLDLLYGP----ETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 K L G+N+N +PV+DL+ P I + + A A F+ Sbjct: 129 GKELADVGVNMNLAPVVDLVDIPRPTTNEPIGKWGREYGHDAATVSSQAGAFAEGMQ 185 >gi|291538022|emb|CBL11133.1| Beta-glucosidase-related glycosidases [Roseburia intestinalis XB6B4] Length = 563 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 G N F+PV+D+ I + P + + R + Sbjct: 130 CSEGAAVGCNWAFAPVVDIDRNWRNPITNV-RTYGDDPDRVLACGLNYMRAAKE 182 >gi|149914958|ref|ZP_01903487.1| beta-hexosaminidase, putative [Roseobacter sp. AzwK-3b] gi|149811146|gb|EDM70983.1| beta-hexosaminidase, putative [Roseobacter sp. AzwK-3b] Length = 343 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+ N +P++D+ K + P + + + Sbjct: 115 IASELRDLGIDSNCAPLVDVAGPETHD-FLKNRCYGFDPGTVARLGRAVANGLMD 168 >gi|186683055|ref|YP_001866251.1| glycoside hydrolase family 3 protein [Nostoc punctiforme PCC 73102] gi|186465507|gb|ACC81308.1| glycoside hydrolase, family 3 domain protein [Nostoc punctiforme PCC 73102] Length = 362 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L + GIN++++P+ D+ P + F P A + A+ + + Sbjct: 114 ATELKSLGINLSWAPIADVFSHPHNPVIGP-RAFGNTPEIAAKDARDYYLGLQE 166 >gi|325135880|gb|EGC58492.1| beta-N-acetylhexosaminidase [Neisseria meningitidis M0579] gi|325207573|gb|ADZ03025.1| beta-N-acetylhexosaminidase [Neisseria meningitidis NZ-05/33] Length = 361 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHHNPEAVAHLALALQKGLAK 166 >gi|325003099|ref|ZP_08124211.1| beta-glucosidase-like glycosyl hydrolase [Pseudonocardia sp. P1] Length = 398 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A L G+ N +P +D P + + FS P A AQ ++ Sbjct: 175 AGQLKARGVTWNLAPSVDTSDQPRSSVIG-DRSFSDDPETATRYAQAWAEGQQ 226 >gi|206890885|ref|YP_002249144.1| beta-glucosidase [Thermodesulfovibrio yellowstonii DSM 11347] gi|206742823|gb|ACI21880.1| beta-glucosidase [Thermodesulfovibrio yellowstonii DSM 11347] Length = 477 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 14/51 (27%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 K + GIN+ PVLD+ P+ I FS P E + + + Sbjct: 110 KEALDVGINLALIPVLDVNREPKNPIICT-RAFSDNPEIVSEYGKFVIKLF 159 >gi|54302507|ref|YP_132500.1| beta-hexosaminidase [Photobacterium profundum SS9] gi|81398279|sp|Q6LJ30|NAGZ_PHOPR RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|46915929|emb|CAG22700.1| putative beta-hexosaminidase [Photobacterium profundum SS9] Length = 334 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++ +PVLDL + + FS P K + A F + + Sbjct: 101 MAAELLAMDIDLSLAPVLDLGFDCKAI---GDRAFSDDPKKIIKYASQFIKGMKQ 152 >gi|299134944|ref|ZP_07028135.1| Beta-N-acetylhexosaminidase [Afipia sp. 1NLS2] gi|298589921|gb|EFI50125.1| Beta-N-acetylhexosaminidase [Afipia sp. 1NLS2] Length = 340 Score = 54.4 bits (130), Expect = 4e-06, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A +L GI+V+ P+ D+ + + PAK A+ + Sbjct: 110 IAADLAALGISVDCLPLADVPVAGADAVIG-DRAYGTTPAKVATIARAVADGLRD 163 >gi|311898955|dbj|BAJ31363.1| putative glycoside hydrolase [Kitasatospora setae KM-6054] Length = 419 Score = 54.4 bits (130), Expect = 4e-06, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L G+N+N +PVLD+ P F + +S PA + F + Sbjct: 197 AAALTRYGLNLNLAPVLDVYRTPGDFADSAQRSYSTDPATVGKLGSAFLKAQQD 250 >gi|194335339|ref|YP_002017133.1| glycoside hydrolase family 3 domain protein [Pelodictyon phaeoclathratiforme BU-1] gi|194307816|gb|ACF42516.1| glycoside hydrolase family 3 domain protein [Pelodictyon phaeoclathratiforme BU-1] Length = 591 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ G++ N++P +DL P I F + + + Sbjct: 164 IAEEAKIVGLHQNYAPTVDLNSNPLNPIINT-RSFGDRIPLTITMSNAVIKGLQSH 218 >gi|269124061|ref|YP_003306638.1| Beta-N-acetylhexosaminidase [Streptobacillus moniliformis DSM 12112] gi|268315387|gb|ACZ01761.1| Beta-N-acetylhexosaminidase [Streptobacillus moniliformis DSM 12112] Length = 573 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 12/49 (24%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Query: 7 TSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 GINVNF P +D+L I + R + + + K Sbjct: 141 ALGINVNFDPCVDVLKNWRNTIVNT-RAYGRDVDIVIKHSNAYLEGLDK 188 >gi|90412605|ref|ZP_01220607.1| beta-hexosaminidase [Photobacterium profundum 3TCK] gi|90326413|gb|EAS42825.1| beta-hexosaminidase [Photobacterium profundum 3TCK] Length = 334 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++ +PVLDL + + FS P K + A F + + Sbjct: 101 MAAELLAMDIDLSLAPVLDLGFDCKAI---GDRAFSDDPKKIIKYASQFIKGMKQ 152 >gi|325203621|gb|ADY99074.1| beta-N-acetylhexosaminidase [Neisseria meningitidis M01-240355] Length = 361 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHHNPEAVAHLALALQKGLAK 166 >gi|325680863|ref|ZP_08160401.1| glycosyl hydrolase family 3 N-terminal domain protein [Ruminococcus albus 8] gi|324107643|gb|EGC01921.1| glycosyl hydrolase family 3 N-terminal domain protein [Ruminococcus albus 8] Length = 483 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+++ + G N++F+PV D P+ + +S ++ + + Sbjct: 266 IAQDIASLGFNLDFAPVADTWSNPDNTVIGT-RAYSDDFSETATLVASAVKGFND 319 >gi|284028919|ref|YP_003378850.1| glycoside hydrolase family 3 domain-containing protein [Kribbella flavida DSM 17836] gi|283808212|gb|ADB30051.1| glycoside hydrolase family 3 domain protein [Kribbella flavida DSM 17836] Length = 414 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 19/56 (33%), Gaps = 4/56 (7%) Query: 2 AKNLVTSGINVNFSPVLDLLYGP----ETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + L +G+NV+ +PV D++ I + P F R Sbjct: 188 GRQLKRAGVNVDLAPVADVVPESLGDDNAPIGALDRGYGSTPDAVGPHVAAFIRGM 243 >gi|150020584|ref|YP_001305938.1| glycoside hydrolase family 3 protein [Thermosipho melanesiensis BI429] gi|149793105|gb|ABR30553.1| glycoside hydrolase, family 3 domain protein [Thermosipho melanesiensis BI429] Length = 443 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + K L G N+ F+PV+D+ + + + +S E+SA+ F K+ Sbjct: 99 LGKMLKMHGFNMVFAPVVDVKHPNSSHVTGF-RAYSSDHKIVEKSAKEFILGLKKH 153 >gi|56478595|ref|YP_160184.1| beta-hexosaminidase [Aromatoleum aromaticum EbN1] gi|81356714|sp|Q5P081|NAGZ_AZOSE RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|56314638|emb|CAI09283.1| putative beta-hexosaminidase [Aromatoleum aromaticum EbN1] Length = 356 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L+ G++++F+PVLDL YG + F R P AQ Sbjct: 120 LAAELLAHGVDLSFTPVLDLDYGCSRVVG--DRAFHRDPLVVAALAQSLVSGMAD 172 >gi|304388248|ref|ZP_07370368.1| beta-N-acetylhexosaminidase [Neisseria meningitidis ATCC 13091] gi|304337775|gb|EFM03924.1| beta-N-acetylhexosaminidase [Neisseria meningitidis ATCC 13091] Length = 361 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F P A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGNCPVIG--NRSFHHNPEAVAHLALALQKGLAK 166 >gi|261823369|ref|YP_003261475.1| glycoside hydrolase [Pectobacterium wasabiae WPP163] gi|261607382|gb|ACX89868.1| glycoside hydrolase family 3 domain protein [Pectobacterium wasabiae WPP163] Length = 598 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA++++ + IN NF+PV+D+ P + FS A+ + + Sbjct: 135 MAQDMLFTHINTNFAPVVDVNTNPFNPVINV-RAFSDDADTVYRVAEKMTAGMKQ 188 >gi|163790510|ref|ZP_02184940.1| probable beta-hexosamidase A [Carnobacterium sp. AT7] gi|159874263|gb|EDP68337.1| probable beta-hexosamidase A [Carnobacterium sp. AT7] Length = 586 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 G N +F+P++DLL I +S + E + + + + Sbjct: 131 EAAAIGCNWSFAPIVDLLRNWRNPIIST-RTWSADVDQTIELSLAYMKGIQE 181 >gi|152995643|ref|YP_001340478.1| glycoside hydrolase family 3 protein [Marinomonas sp. MWYL1] gi|150836567|gb|ABR70543.1| glycoside hydrolase family 3 domain protein [Marinomonas sp. MWYL1] Length = 523 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ GIN +F+PV+D+ + + + E ++ T+ KN Sbjct: 97 IAQEAKLLGINWSFTPVVDINAKFRSAVVGT-RSYGSDVDVIETMSRSNITTFQKN 151 >gi|295115997|emb|CBL36844.1| Beta-glucosidase-related glycosidases [butyrate-producing bacterium SM4/1] Length = 505 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L G N++F+PV D+L P+ + KR F + K+ Sbjct: 280 IGAYLAELGFNMDFAPVADVLTNPDNTVV-KRRSFGSDAKTVANMVVRETEGLKKH 334 >gi|295090960|emb|CBK77067.1| Beta-glucosidase-related glycosidases [Clostridium cf. saccharolyticum K10] Length = 505 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L G N++F+PV D+L P+ + KR F + K+ Sbjct: 280 IGAYLAELGFNMDFAPVADVLTNPDNTVV-KRRSFGSDAKTVANMVVRETEGLKKH 334 >gi|283795943|ref|ZP_06345096.1| glycosyl hydrolase domain protein [Clostridium sp. M62/1] gi|291076584|gb|EFE13948.1| glycosyl hydrolase domain protein [Clostridium sp. M62/1] Length = 505 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L G N++F+PV D+L P+ + KR F + K+ Sbjct: 280 IGAYLAELGFNMDFAPVADVLTNPDNTVV-KRRSFGSDAKTVANMVVRETEGLKKH 334 >gi|271963721|ref|YP_003337917.1| beta-N-acetylhexosaminidase [Streptosporangium roseum DSM 43021] gi|270506896|gb|ACZ85174.1| Beta-N-acetylhexosaminidase [Streptosporangium roseum DSM 43021] Length = 484 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +L G+N++ +P D+ + + F A Sbjct: 115 IGDDLARCGVNLDMAPSADVNTADDNPVIGT-RSFGPDTALVARHTVAAVHGLQ 167 >gi|302554054|ref|ZP_07306396.1| sugar hydrolase [Streptomyces viridochromogenes DSM 40736] gi|302471672|gb|EFL34765.1| sugar hydrolase [Streptomyces viridochromogenes DSM 40736] Length = 510 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L + G+N+N++P D+ P + F A + Sbjct: 114 LGRRLASCGVNLNWAPSADVNSDPRNPVIGV-RSFGADTELAARHTAGYVTGLQ 166 >gi|15604547|ref|NP_221065.1| hypothetical protein RP706 [Rickettsia prowazekii str. Madrid E] gi|3861242|emb|CAA15141.1| unknown [Rickettsia prowazekii] gi|292572343|gb|ADE30258.1| Beta-glucosidase [Rickettsia prowazekii Rp22] Length = 314 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +AK L GIN++F+PV DL++ I F + P + Sbjct: 111 IAKELREVGINLDFAPVADLIHDGADKII-SDRSFGKEPEIVVPLFLSAIAGLQE 164 >gi|254781070|ref|YP_003065483.1| hypothetical protein CLIBASIA_04860 [Candidatus Liberibacter asiaticus str. psy62] gi|254040747|gb|ACT57543.1| hypothetical protein CLIBASIA_04860 [Candidatus Liberibacter asiaticus str. psy62] Length = 58 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 58/58 (100%), Positives = 58/58 (100%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK Sbjct: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 >gi|219685740|ref|ZP_03540552.1| putative beta-glucosidase [Borrelia garinii Far04] gi|219672735|gb|EED29762.1| putative beta-glucosidase [Borrelia garinii Far04] Length = 531 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GIN+NF+P++D+ F +S + F + + Sbjct: 125 IAQELSQLGINLNFAPIVDIYSNENNFTIGP-RTYSDNTKIVSLFSLAFYKGQKQ 178 >gi|241206697|ref|YP_002977793.1| beta-N-acetylhexosaminidase [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240860587|gb|ACS58254.1| Beta-N-acetylhexosaminidase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 559 Score = 54.4 bits (130), Expect = 6e-06, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ G+ +F+PV+D+ + I + K E A +N Sbjct: 129 LAREGRAMGVRWSFTPVIDINNAFRSPIVGT-RSYGSDVNKIERHAVAHVHGLQRN 183 >gi|323137652|ref|ZP_08072728.1| glycoside hydrolase family 3 domain protein [Methylocystis sp. ATCC 49242] gi|322396949|gb|EFX99474.1| glycoside hydrolase family 3 domain protein [Methylocystis sp. ATCC 49242] Length = 335 Score = 54.0 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A +L GI+V+ PVLD I +SR PA+A + + + Sbjct: 107 IAHDLREVGIDVDCLPVLDTPAPDSHAII-SDRAYSRDPARAAKVGRAAAEGL 158 >gi|261416143|ref|YP_003249826.1| glycoside hydrolase family 3 domain protein [Fibrobacter succinogenes subsp. succinogenes S85] gi|261372599|gb|ACX75344.1| glycoside hydrolase family 3 domain protein [Fibrobacter succinogenes subsp. succinogenes S85] gi|302327825|gb|ADL27026.1| glycosyl hydrolase, family 3 [Fibrobacter succinogenes subsp. succinogenes S85] Length = 384 Score = 54.0 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + G +++++PV D+ P+ + FS P A + + Sbjct: 168 IGTYVKKYGFDIDYAPVADVNTNPDNIVIGP-RAFSDDPETAAKFVVSYLNGL 219 >gi|254252840|ref|ZP_04946158.1| Beta-glucosidase-related glycosidase [Burkholderia dolosa AUO158] gi|124895449|gb|EAY69329.1| Beta-glucosidase-related glycosidase [Burkholderia dolosa AUO158] Length = 342 Score = 54.0 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+++F+PVLDL YG I F R P A+ Sbjct: 110 LAGELRACGIDMSFTPVLDLDYGHSKVIG--DRAFHRDPRVVTLLAKS 155 >gi|227505756|ref|ZP_03935805.1| beta-N-acetylglucosaminidase family protein [Corynebacterium striatum ATCC 6940] gi|227197724|gb|EEI77772.1| beta-N-acetylglucosaminidase family protein [Corynebacterium striatum ATCC 6940] Length = 363 Score = 54.0 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + L GINV+F+PVLD+ G + FS PA+A E F+R Sbjct: 151 IGGVLKAHGINVDFAPVLDVDGGGLEVVG--DRSFSTDPAQAGEYGAAFARGL 201 >gi|219684319|ref|ZP_03539263.1| putative beta-glucosidase [Borrelia garinii PBr] gi|219672308|gb|EED29361.1| putative beta-glucosidase [Borrelia garinii PBr] Length = 531 Score = 54.0 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GIN+NF+P++D+ F +S + F + + Sbjct: 125 IAQELSQLGINLNFAPIVDIYSNENNFTIGP-RTYSDNTKIVSLFSLAFYKGQKQ 178 >gi|310767320|gb|ADP12270.1| putative glycosyl hydrolase [Erwinia sp. Ejp617] Length = 343 Score = 54.0 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ +G F PA A A+ F R + Sbjct: 104 MASEMIAMDIDISFAPVLDIGHGSAAI---GERSFHEDPAIALRLARCFIRGMHE 155 >gi|298291871|ref|YP_003693810.1| beta-N-acetylhexosaminidase [Starkeya novella DSM 506] gi|296928382|gb|ADH89191.1| Beta-N-acetylhexosaminidase [Starkeya novella DSM 506] Length = 342 Score = 54.0 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A +L GINV+ P DL I + PA+ A+ + ++ Sbjct: 115 IADDLAILGINVDCVPCADLRLPEGHGIIG-DRAYGSTPAQVAHLARAAAEGLME 168 >gi|306833489|ref|ZP_07466616.1| possible beta-N-acetylhexosaminidase [Streptococcus bovis ATCC 700338] gi|304424259|gb|EFM27398.1| possible beta-N-acetylhexosaminidase [Streptococcus bovis ATCC 700338] Length = 596 Score = 54.0 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 8/49 (16%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 G NV+F+P++DL I + + ++ + + Sbjct: 133 EAAAVGCNVSFAPIVDLTRNWRNPII-ANRNWGSNVDQVITLSKEYMKG 180 >gi|190891509|ref|YP_001978051.1| beta-N-acetylhexosaminidase [Rhizobium etli CIAT 652] gi|190696788|gb|ACE90873.1| probable beta-N-acetylhexosaminidase protein [Rhizobium etli CIAT 652] Length = 356 Score = 54.0 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L GI+V+ PVLD+ + + + P + + Sbjct: 130 AFDLSKLGIDVDCLPVLDVPVEGSSNVIG-DRAYGGDPGTVIAMGRAAAEGLK 181 >gi|302342242|ref|YP_003806771.1| glycoside hydrolase family 3 domain protein [Desulfarculus baarsii DSM 2075] gi|301638855|gb|ADK84177.1| glycoside hydrolase family 3 domain protein [Desulfarculus baarsii DSM 2075] Length = 352 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M + L +G N N +PV+D+ +A+ P K E A F + + Sbjct: 115 MGRELAAAGFNFNLAPVVDVHAVQGGVMAR--RSLGADPLKVGELAAAFIQGQQE 167 >gi|311740415|ref|ZP_07714243.1| family 3 glycosyl hyrolase [Corynebacterium pseudogenitalium ATCC 33035] gi|311304461|gb|EFQ80536.1| family 3 glycosyl hyrolase [Corynebacterium pseudogenitalium ATCC 33035] Length = 406 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +L GINV+F+PVLD+ + FS P +A E F+R Sbjct: 182 IGTSLKVHGINVDFAPVLDVDGNGLEVVG--DRSFSTDPVQAGEYGAAFARGL 232 >gi|116327859|ref|YP_797579.1| Beta-glucosidase-related glycosidase [Leptospira borgpetersenii serovar Hardjo-bovis L550] gi|116330743|ref|YP_800461.1| Beta-glucosidase-related glycosidase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] gi|116120603|gb|ABJ78646.1| Beta-glucosidase-related glycosidase [Leptospira borgpetersenii serovar Hardjo-bovis L550] gi|116124432|gb|ABJ75703.1| Beta-glucosidase-related glycosidase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] Length = 579 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 + L G N F+P LD+ P+ + P S + + Sbjct: 160 SYQLRKLGFNFVFAPDLDINNNPDNPVINT-RSMGSTPETVSISGIGYEKG 209 >gi|283478759|emb|CAY74675.1| putative glycosyl hydrolase [Erwinia pyrifoliae DSM 12163] Length = 344 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ +G F PA A A+ F R + Sbjct: 105 MASEMIAMDIDISFAPVLDIGHGSAAI---GERSFHEDPAIALRLARCFIRGMHE 156 >gi|257054254|ref|YP_003132086.1| beta-glucosidase-like glycosyl hydrolase [Saccharomonospora viridis DSM 43017] gi|256584126|gb|ACU95259.1| beta-glucosidase-like glycosyl hydrolase [Saccharomonospora viridis DSM 43017] Length = 383 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+ V+++PV+DL GP + FS P A E A F+ + Sbjct: 166 GEQLSARGVTVDYAPVVDLTDGPANGVIG-DRSFSADPQTATEYAAAFASGLSE 218 >gi|259908783|ref|YP_002649139.1| beta-hexosaminidase [Erwinia pyrifoliae Ep1/96] gi|224964405|emb|CAX55914.1| Beta-hexosaminidase (N-acetyl-beta-glucosaminidase) [Erwinia pyrifoliae Ep1/96] Length = 343 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ +G F PA A A+ F R + Sbjct: 104 MASEMIAMDIDISFAPVLDIGHGSAAI---GERSFHEDPAIALRLARCFIRGMHE 155 >gi|295693441|ref|YP_003602051.1| beta-hexosamidase a, glycoside hydrolase family 3 [Lactobacillus crispatus ST1] gi|295031547|emb|CBL51026.1| Beta-hexosamidase A, glycoside hydrolase family 3 [Lactobacillus crispatus ST1] Length = 567 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + G N++F+P++D+ I F + A + N Sbjct: 128 GEEAAQVGNNMSFAPIVDIDNNFRNPIMNT-RTFGSDKNRVIRMADAQVKGLEDN 181 >gi|111220352|ref|YP_711146.1| putative Beta-N-acetylglucosaminidase [Frankia alni ACN14a] gi|111147884|emb|CAJ59549.1| putative Beta-N-acetylglucosaminidase precursor [Frankia alni ACN14a] Length = 628 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIP 39 +L GINV+F+P D+ P + F P Sbjct: 235 GTDLRALGINVDFAPDADVNTNPANPVIG-ERSFGDDP 271 >gi|145595898|ref|YP_001160195.1| glycoside hydrolase family 3 protein [Salinispora tropica CNB-440] gi|145305235|gb|ABP55817.1| glycoside hydrolase, family 3 domain protein [Salinispora tropica CNB-440] Length = 575 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L G+NV+F+PV D+L P T I + P+ E R Sbjct: 208 GTELAAMGVNVDFAPVADVLVTPSTVIGS--RSYGADPSMVAEQVSGVVRGLQ 258 >gi|116749949|ref|YP_846636.1| Beta-N-acetylhexosaminidase [Syntrophobacter fumaroxidans MPOB] gi|116699013|gb|ABK18201.1| Beta-N-acetylhexosaminidase [Syntrophobacter fumaroxidans MPOB] Length = 337 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L GI++N +PVLDL + + P E + +T Sbjct: 113 AMDLRRMGIHINLAPVLDLRVNANSH-FMEGRCLGDDPLTVAELGCRWIKTLQ 164 >gi|255325604|ref|ZP_05366704.1| beta-N-acetylglucosaminidase [Corynebacterium tuberculostearicum SK141] gi|255297392|gb|EET76709.1| beta-N-acetylglucosaminidase [Corynebacterium tuberculostearicum SK141] Length = 386 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +L GINV+F+PVLD+ + FS P +A E F+R Sbjct: 162 IGTSLKVHGINVDFAPVLDVDGNGLEVVG--DRSFSTDPVQAGEYGAAFARGL 212 >gi|212716160|ref|ZP_03324288.1| hypothetical protein BIFCAT_01076 [Bifidobacterium catenulatum DSM 16992] gi|212661527|gb|EEB22102.1| hypothetical protein BIFCAT_01076 [Bifidobacterium catenulatum DSM 16992] Length = 348 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVL---DLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L ++GINV+ +PV+ + + F A + A+ F + Sbjct: 125 GSQLKSAGINVDLAPVVGTVTVDRTTNDPVGALDRDFGLDAAGNADHAKAFIQGMAD 181 >gi|210634504|ref|ZP_03298131.1| hypothetical protein COLSTE_02053 [Collinsella stercoris DSM 13279] gi|210158805|gb|EEA89776.1| hypothetical protein COLSTE_02053 [Collinsella stercoris DSM 13279] Length = 806 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + L INVNF+P D+ P + +S P + ++ Sbjct: 188 IGRELEALKINVNFAPSFDVNNNPNNPVIGL-RSYSSDPELVAQLGTAMMSGMQEH 242 >gi|313139952|ref|ZP_07802145.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB 41171] gi|313132462|gb|EFR50079.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB 41171] Length = 399 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 16/57 (28%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPV---LDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L +GINV+ +PV + + I F + F Sbjct: 175 GGQLKQAGINVDLAPVLGTVQVKRSSNAPIGALNRDFGLDSNGNAQHGIAFVEGMRD 231 >gi|217970708|ref|YP_002355942.1| beta-hexosaminidase [Thauera sp. MZ1T] gi|217508035|gb|ACK55046.1| glycoside hydrolase family 3 domain protein [Thauera sp. MZ1T] Length = 381 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L G++++F+PVLDL YG I F R P AQ + Sbjct: 115 LAAELRAHGVDLSFTPVLDLDYGCCRAIG--NRAFHRDPQVVAALAQALCAGMAE 167 >gi|114762850|ref|ZP_01442282.1| beta-N-acetylhexosaminidase, putative [Pelagibaca bermudensis HTCC2601] gi|114544460|gb|EAU47467.1| beta-N-acetylhexosaminidase, putative [Roseovarius sp. HTCC2601] Length = 335 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L GI+ N +P+LD+ + + P + E + ++ ++ Sbjct: 110 ALELRGLGIDGNCAPMLDVARAATHP-FLRNRCYGETPERVAEIGRAVAQGLLQ 162 >gi|85373143|ref|YP_457205.1| glycosyl hydrolase [Erythrobacter litoralis HTCC2594] gi|84786226|gb|ABC62408.1| glycosyl hydrolase [Erythrobacter litoralis HTCC2594] Length = 351 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 16/55 (29%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI V+ P LD+ + P + + K Sbjct: 121 LAMELAEVGITVDCHPPLDVRQPGAHDVIG-DRALGSEPMQVAALGRAILDGLAK 174 >gi|237746711|ref|ZP_04577191.1| beta-N-acetylhexosaminidase [Oxalobacter formigenes HOxBLS] gi|229378062|gb|EEO28153.1| beta-N-acetylhexosaminidase [Oxalobacter formigenes HOxBLS] Length = 348 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L GI+ +F+PVLDL +G I F R P A+ Sbjct: 113 LASELRACGIDFSFTPVLDLDHGVSKVIG--DRSFHRDPNVVTFLAKS 158 >gi|304310928|ref|YP_003810526.1| Putative N-acetyl-glucosaminidase [gamma proteobacterium HdN1] gi|301796661|emb|CBL44873.1| Putative N-acetyl-glucosaminidase [gamma proteobacterium HdN1] Length = 336 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 MA L I+++F+PVLDL Y I F P+ A+ + Sbjct: 106 MAAELRAFDIDLSFAPVLDLDYSRSQVIG--NRAFHSKPSAVLALAEAWI 153 >gi|284033952|ref|YP_003383883.1| glycoside hydrolase family 3 domain-containing protein [Kribbella flavida DSM 17836] gi|283813245|gb|ADB35084.1| glycoside hydrolase family 3 domain protein [Kribbella flavida DSM 17836] Length = 599 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 9/50 (18%), Positives = 15/50 (30%), Gaps = 1/50 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 L G+N ++PV D+ + FS P + Sbjct: 177 ELRAVGVNQAYAPVADVNVNALNPVIGV-RSFSSDPTLVADLTAAQVTGL 225 >gi|148548803|ref|YP_001268905.1| beta-hexosaminidase [Pseudomonas putida F1] gi|148512861|gb|ABQ79721.1| glycoside hydrolase, family 3 domain protein [Pseudomonas putida F1] Length = 336 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++++F+PVLDL + + F P +A A F R Sbjct: 105 MATEVLAVGLDLSFAPVLDLDHQRSAVVGS--RAFEGEPLRATRLAGAFIRGMN 156 >gi|310287248|ref|YP_003938506.1| hypothetical protein BBIF_0727 [Bifidobacterium bifidum S17] gi|309251184|gb|ADO52932.1| conserved hypothetical protein [Bifidobacterium bifidum S17] Length = 430 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 16/57 (28%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPV---LDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L +GINV+ +PV + + I F + F Sbjct: 206 GGQLKQAGINVDLAPVLGTVQVKRSSNAPIGALNRDFGLDSNGNAQHGIAFVEGMRD 262 >gi|224282793|ref|ZP_03646115.1| glycoside hydrolase, family 3 domain protein [Bifidobacterium bifidum NCIMB 41171] Length = 428 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 16/57 (28%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPV---LDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L +GINV+ +PV + + I F + F Sbjct: 204 GGQLKQAGINVDLAPVLGTVQVKRSSNAPIGALNRDFGLDSNGNAQHGIAFVEGMRD 260 >gi|326331005|ref|ZP_08197304.1| putative beta-N-Acetylglucosaminidase [Nocardioidaceae bacterium Broad-1] gi|325951216|gb|EGD43257.1| putative beta-N-Acetylglucosaminidase [Nocardioidaceae bacterium Broad-1] Length = 620 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+ +++PV D+ P + A + + K Sbjct: 198 IGTELAAVGVTQDYAPVADVNLNPNNPVIGI-RSAGADSAAVSDIVAAEVGGFDK 251 >gi|145296839|ref|YP_001139660.1| hypothetical protein cgR_2740 [Corynebacterium glutamicum R] gi|140846759|dbj|BAF55758.1| hypothetical protein [Corynebacterium glutamicum R] Length = 381 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+ VNF+PV+D+ + FS PA A A F++ K Sbjct: 156 LGTGLAAHGVTVNFAPVVDVDAWGLPVVG--DRSFSNDPAVAATYATAFAKGLSK 208 >gi|62391691|ref|YP_227093.1| Beta-N-acetylglucosaminidase precursor [Corynebacterium glutamicum ATCC 13032] gi|41327033|emb|CAF20877.1| BETA-N-ACETYLGLUCOSAMINIDASE PRECURSOR [Corynebacterium glutamicum ATCC 13032] Length = 385 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+ VNF+PV+D+ + FS PA A A F++ K Sbjct: 160 LGTGLAAHGVTVNFAPVVDVDAWGLPVVG--DRSFSNDPAVAATYATAFAKGLSK 212 >gi|23308984|ref|NP_602044.2| beta-N-acetylglucosaminidase-like protein [Corynebacterium glutamicum ATCC 13032] gi|21325625|dbj|BAC00246.1| Beta-glucosidase-related glycosidases [Corynebacterium glutamicum ATCC 13032] Length = 395 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+ VNF+PV+D+ + FS PA A A F++ K Sbjct: 170 LGTGLAAHGVTVNFAPVVDVDAWGLPVVG--DRSFSNDPAVAATYATAFAKGLSK 222 >gi|169631532|ref|YP_001705181.1| putative secreted hydrolase [Mycobacterium abscessus ATCC 19977] gi|169243499|emb|CAM64527.1| Putative secreted hydrolase [Mycobacterium abscessus] Length = 375 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + GI ++F+P D+ G FS P K E A+ R Y Sbjct: 153 AQKMKDLGITIDFAPDADVTDGDPDGAIG-DRSFSGDPQKVAEYAEASVRGYQ 204 >gi|78189614|ref|YP_379952.1| beta-N-acetylglucosaminidase [Chlorobium chlorochromatii CaD3] gi|78171813|gb|ABB28909.1| beta-N-acetylglucosaminidase [Chlorobium chlorochromatii CaD3] Length = 592 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ G++ N++P +DL P + F A + + Sbjct: 177 IAQEATLLGMHHNYAPTVDLNSNPRNPVINT-RAFGDTIPLTIVMANAIIKGLQSH 231 >gi|310794792|gb|EFQ30253.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Glomerella graminicola M1.001] Length = 903 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 14/54 (25%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A + GIN PVLD+L P + + Sbjct: 106 ATEVGACGINFMLGPVLDVLSNARYQPVGV-RATGDDPQEVSQYGIAAINGIRD 158 >gi|56964890|ref|YP_176621.1| beta-N-acetylhexosaminidase [Bacillus clausii KSM-K16] gi|56911133|dbj|BAD65660.1| beta-N-acetylhexosaminidase [Bacillus clausii KSM-K16] Length = 521 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK L G+N N +PV D+ P + F P+K + A+ Sbjct: 114 AKELRAVGVNWNLAPVADVNNNPNNPVIGV-RSFGEDPSKVGDFAKEMMTGMQ 165 >gi|24373803|ref|NP_717846.1| beta-hexosaminidase [Shewanella oneidensis MR-1] gi|47605886|sp|Q8EEW2|NAGZ_SHEON RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|24348195|gb|AAN55290.1|AE015666_14 beta-hexosaminidase [Shewanella oneidensis MR-1] Length = 342 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L+ I+++F+PVLDL G I + FS P + A+ F Sbjct: 105 MAIELLACDIDLSFAPVLDLN-GISQVIGK--RSFSANPDEVIALARSFIEGM 154 >gi|167041982|gb|ABZ06719.1| putative glycosyl hydrolase family 3 N terminal domain protein [uncultured marine microorganism HF4000_141E02] Length = 340 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L+ G++ +F+PVLD+ +G I F P + + F K Sbjct: 108 LGLELLEVGVDFSFAPVLDIDHGVSEVIGS--RSFHSDPKVVDCLGEQFYEGLQK 160 >gi|167041425|gb|ABZ06177.1| putative glycosyl hydrolase family 3 N terminal domain protein [uncultured marine microorganism HF4000_006O13] Length = 340 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L+ G++ +F+PVLD+ +G I F P + + F K Sbjct: 108 LGLELLEVGVDFSFAPVLDIDHGVSEVIGS--RSFHSDPKVVDCLGEQFYEGLQK 160 >gi|284799717|ref|ZP_05984674.2| beta-N-acetylhexosaminidase [Neisseria subflava NJ9703] gi|284797320|gb|EFC52667.1| beta-N-acetylhexosaminidase [Neisseria subflava NJ9703] Length = 350 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R + A + K Sbjct: 103 LATELSACGIDLSFTPVLDLDWGQCAVIG--NRSFHRDANIVTQLALALQKGLNK 155 >gi|171057284|ref|YP_001789633.1| Beta-N-acetylhexosaminidase [Leptothrix cholodnii SP-6] gi|170774729|gb|ACB32868.1| Beta-N-acetylhexosaminidase [Leptothrix cholodnii SP-6] Length = 367 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L G++++F+PVLDL + I R A A+ ++ Sbjct: 116 LAAELRACGVDLSFTPVLDLEHAHSNVIG--DRALHRDARVATLLAKSLMHGLLQ 168 >gi|311064097|ref|YP_003970822.1| glycoside hydrolase, family 3 domain-containing protein [Bifidobacterium bifidum PRL2010] gi|310866416|gb|ADP35785.1| Glycoside hydrolase, family 3 domain protein [Bifidobacterium bifidum PRL2010] Length = 428 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 16/57 (28%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPV---LDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L +GIN++ +PV + + I F + F Sbjct: 204 GGQLKQAGINIDLAPVLGTVQVKRSSNAPIGALNRDFGLDSNGNAQHGIAFVEGMRD 260 >gi|50083788|ref|YP_045298.1| beta-hexosaminidase [Acinetobacter sp. ADP1] gi|49529764|emb|CAG67476.1| beta-N-acetyl-D-glucosaminidase [Acinetobacter sp. ADP1] Length = 339 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLD+ I F++ P A F + + Sbjct: 106 MASEVLAVGIDFSFAPVLDIN-AISDVIG--DRGFAQNPQDIVPLAAAFMKGMKQ 157 >gi|209885392|ref|YP_002289249.1| beta-hexosaminidase [Oligotropha carboxidovorans OM5] gi|209873588|gb|ACI93384.1| beta-hexosaminidase [Oligotropha carboxidovorans OM5] Length = 340 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A +L GI+V+ P+ DL + + P K A+ + Sbjct: 110 IASDLAGLGISVDCLPLADLPVEGADAVIG-DRAYGTTPDKVVALARAVANGLQD 163 >gi|229822255|ref|YP_002883781.1| Beta-N-acetylhexosaminidase [Beutenbergia cavernae DSM 12333] gi|229568168|gb|ACQ82019.1| Beta-N-acetylhexosaminidase [Beutenbergia cavernae DSM 12333] Length = 408 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Query: 2 AKNLVTSGINVNFSPVLDLLYGP-----ETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L SGIN+N +PV+D++ P I F A FS Sbjct: 186 GAELAASGINLNLAPVMDVVASPEAAAANPPIGYFHREFGYDAETVASHANAFSAGMR 243 >gi|225075406|ref|ZP_03718605.1| hypothetical protein NEIFLAOT_00411 [Neisseria flavescens NRL30031/H210] gi|224953224|gb|EEG34433.1| hypothetical protein NEIFLAOT_00411 [Neisseria flavescens NRL30031/H210] Length = 350 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R + A + K Sbjct: 103 LATELSACGIDLSFTPVLDLDWGQCAVIG--NRSFHRDANIVTQLALALQKGLNK 155 >gi|157690951|ref|YP_001485413.1| glycoside hydrolase [Bacillus pumilus SAFR-032] gi|157679709|gb|ABV60853.1| glycoside hydrolase [Bacillus pumilus SAFR-032] Length = 639 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L T GIN NFSPVLD+ P + FS PA + K Sbjct: 157 IGKELNTLGINTNFSPVLDVNNNPNNPVIGV-RSFSSDPALVTRLGLQTMKGLQK 210 >gi|145220500|ref|YP_001131209.1| Beta-N-acetylhexosaminidase [Prosthecochloris vibrioformis DSM 265] gi|145206664|gb|ABP37707.1| Beta-N-acetylhexosaminidase [Chlorobium phaeovibrioides DSM 265] Length = 382 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Query: 5 LVTSGINVNFSPVLDLLYGPETFIAQ-KRSIFSRIPAKAEESAQLFSRTYIK 55 L + I +N +PV+DL P + FS + +A L + K Sbjct: 153 LRSLHITMNLAPVVDLNTNPRNPVIGLLGRSFSAEADRVTRNAALTLDAFEK 204 >gi|303248130|ref|ZP_07334395.1| glycoside hydrolase family 3 domain protein [Desulfovibrio fructosovorans JJ] gi|302490529|gb|EFL50437.1| glycoside hydrolase family 3 domain protein [Desulfovibrio fructosovorans JJ] Length = 572 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIP 39 L GINV+F+PV D+ P + F P Sbjct: 154 ELAAVGINVDFAPVADVNVNPANPVIGI-RSFGSDP 188 >gi|307946870|ref|ZP_07662205.1| beta-hexosaminidase [Roseibium sp. TrichSKD4] gi|307770534|gb|EFO29760.1| beta-hexosaminidase [Roseibium sp. TrichSKD4] Length = 339 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI V+ P LD+ + S P + + + ++ Sbjct: 109 IAHELRGVGITVDCLPCLDVSFPETVDAIG-DRSLSADPNVVADLGRSVADGLLE 162 >gi|94969017|ref|YP_591065.1| Beta-N-acetylhexosaminidase [Candidatus Koribacter versatilis Ellin345] gi|94551067|gb|ABF40991.1| Beta-N-acetylhexosaminidase [Candidatus Koribacter versatilis Ellin345] Length = 372 Score = 53.6 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A G N +F+PV DL E+ + P E A+ F + + Sbjct: 113 LAAEARALGFNTDFAPVFDL-RTVESVKVLAGRTIAADPKHIIELAREFLKGFKD 166 >gi|319950269|ref|ZP_08024190.1| glycosidase [Dietzia cinnamea P4] gi|319436067|gb|EFV91266.1| glycosidase [Dietzia cinnamea P4] Length = 436 Score = 53.6 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+ V+F+P LD+ P+ + FS PA+ A+ F+ Sbjct: 178 GEFLRGMGVTVDFAPSLDVSEQPDGAVIG-DRSFSPDPARVVSYARAFATGLRD 230 >gi|197105429|ref|YP_002130806.1| glycosyl hydrolase, family 3 [Phenylobacterium zucineum HLK1] gi|196478849|gb|ACG78377.1| glycosyl hydrolase, family 3 [Phenylobacterium zucineum HLK1] Length = 333 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A +L GINV+ PVLD+ I + + Sbjct: 107 IAHDLAELGINVDCVPVLDVPDPEGHEIIG-DRAYGETVEDVALLGRAACEGL 158 >gi|227834172|ref|YP_002835879.1| putative glycoside hydrolase [Corynebacterium aurimucosum ATCC 700975] gi|227455188|gb|ACP33941.1| putative glycoside hydrolase [Corynebacterium aurimucosum ATCC 700975] Length = 349 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +L G+ V+F+PVLD+ G + FS PA A E F+R Sbjct: 152 IGHSLRAHGVTVDFAPVLDVDGGDLEVVG--DRAFSTDPAAAGEYGAAFARGLQ 203 >gi|75675997|ref|YP_318418.1| glycoside hydrolase family protein [Nitrobacter winogradskyi Nb-255] gi|74420867|gb|ABA05066.1| glycoside hydrolase, family 3 [Nitrobacter winogradskyi Nb-255] Length = 338 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A +L GI V+ P+ D+ + + P K A+ + + Sbjct: 110 IAADLADLGITVDCLPLADVPVPGADAVIG-DRAYGTDPLKVATIARAVTEGLEQ 163 >gi|262183339|ref|ZP_06042760.1| putative glycoside hydrolase [Corynebacterium aurimucosum ATCC 700975] Length = 345 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +L G+ V+F+PVLD+ G + FS PA A E F+R Sbjct: 148 IGHSLRAHGVTVDFAPVLDVDGGDLEVVG--DRAFSTDPAAAGEYGAAFARGLQ 199 >gi|28188982|dbj|BAC56177.1| beta-N-acetylglucosaminidase [Clostridium paraputrificum] Length = 413 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 13/45 (28%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESA 46 AK L GIN +F VLD+ I + K E Sbjct: 158 AKKLKLLGINTDFGTVLDINTNKNNPIIGV-RSYGSTKEKVTEFG 201 >gi|241759225|ref|ZP_04757331.1| beta-hexosaminidase [Neisseria flavescens SK114] gi|241320361|gb|EER56658.1| beta-hexosaminidase [Neisseria flavescens SK114] Length = 361 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R + A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGQCAVIG--NRSFHRDANIVTQLALALQKGLNK 166 >gi|157375972|ref|YP_001474572.1| beta-hexosaminidase [Shewanella sediminis HAW-EB3] gi|157318346|gb|ABV37444.1| beta-hexosaminidase [Shewanella sediminis HAW-EB3] Length = 333 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++F+PVLDL + + K F P E A F + Sbjct: 101 MAIELLACDIDLSFAPVLDL--NGISKVIGK-RAFGSEPDVVIELAGSFIDGMEQ 152 >gi|45657290|ref|YP_001376.1| glycosyl hydrolase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] gi|45600528|gb|AAS70013.1| glycosyl hydrolase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] Length = 605 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 9/51 (17%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 + L G+N F+P LD+ P+ + P + + + Sbjct: 185 SYQLRKLGLNFVFAPDLDINNNPDNPVINT-RSMGSTPEMVSIAGIGYEKG 234 >gi|24215262|ref|NP_712743.1| glycosylhydrolase [Leptospira interrogans serovar Lai str. 56601] gi|24196352|gb|AAN49761.1| glycosylhydrolase [Leptospira interrogans serovar Lai str. 56601] Length = 619 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 9/51 (17%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 + L G+N F+P LD+ P+ + P + + + Sbjct: 199 SYQLRKLGLNFVFAPDLDINNNPDNPVINT-RSMGSTPEMVSIAGIGYEKG 248 >gi|284030525|ref|YP_003380456.1| glycoside hydrolase family 3 domain-containing protein [Kribbella flavida DSM 17836] gi|283809818|gb|ADB31657.1| glycoside hydrolase family 3 domain protein [Kribbella flavida DSM 17836] Length = 487 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 9/48 (18%), Positives = 14/48 (29%), Gaps = 1/48 (2%) Query: 8 SGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 GI+V +P +D+ P I F F + Sbjct: 117 LGIDVMLAPSVDVNSNPANPIIST-RSFGTTAGVVSRHGVAFVQGVHD 163 >gi|302878425|ref|YP_003846989.1| glycoside hydrolase family 3 domain-containing protein [Gallionella capsiferriformans ES-2] gi|302581214|gb|ADL55225.1| glycoside hydrolase family 3 domain protein [Gallionella capsiferriformans ES-2] Length = 349 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESA 46 M+ L G++ +F+PVLD+ Y I F P E A Sbjct: 108 MSSELRGCGVDFSFTPVLDVDYEQSGVIG--DRAFHSDPQAIAELA 151 >gi|269214920|ref|ZP_05987420.2| beta-N-acetylhexosaminidase [Neisseria lactamica ATCC 23970] gi|269208672|gb|EEZ75127.1| beta-N-acetylhexosaminidase [Neisseria lactamica ATCC 23970] Length = 350 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L I+++F+PVLDL +G I F R P A + K Sbjct: 103 LATELSACNIDLSFTPVLDLDWGNCPVIG--NRSFHRNPEAVARLALALQKGLAK 155 >gi|163746493|ref|ZP_02153851.1| beta-hexosaminidase, putative [Oceanibulbus indolifex HEL-45] gi|161380378|gb|EDQ04789.1| beta-hexosaminidase, putative [Oceanibulbus indolifex HEL-45] Length = 335 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L + GI+ N +P++D+ + + P + + S + Sbjct: 107 IAHELASVGIDSNCAPLIDVASAKTHP-FLRNRCYGDTPGQVAAIGRAVSDALL 159 >gi|225027266|ref|ZP_03716458.1| hypothetical protein EUBHAL_01522 [Eubacterium hallii DSM 3353] gi|224955419|gb|EEG36628.1| hypothetical protein EUBHAL_01522 [Eubacterium hallii DSM 3353] Length = 409 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K + G N++F+PV D+ E FS + Sbjct: 177 IGKEIRELGFNLDFAPVADVNTNAENTEIG-NRSFSSDAKTVAGMVSQEVKGLQ 229 >gi|297570307|ref|YP_003691651.1| glycoside hydrolase family 3 domain protein [Desulfurivibrio alkaliphilus AHT2] gi|296926222|gb|ADH87032.1| glycoside hydrolase family 3 domain protein [Desulfurivibrio alkaliphilus AHT2] Length = 331 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ L + GIN+N +PVLDL + + +R + PA+ QL N Sbjct: 115 AQELRSVGINMNMAPVLDLCPAGQGY-YMERRVLGDDPAEVARLGQLIIEKMQHN 168 >gi|197302730|ref|ZP_03167784.1| hypothetical protein RUMLAC_01460 [Ruminococcus lactaris ATCC 29176] gi|197298312|gb|EDY32858.1| hypothetical protein RUMLAC_01460 [Ruminococcus lactaris ATCC 29176] Length = 408 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G N++++PV D+L PE + +K F AK +Q + Sbjct: 188 IGNYLAELGFNLDYAPVGDVLTNPENTVVKK-RSFGNDSAKVAALSQKVLDGLHE 241 >gi|254465924|ref|ZP_05079335.1| beta-N-acetylhexosaminidase [Rhodobacterales bacterium Y4I] gi|206686832|gb|EDZ47314.1| beta-N-acetylhexosaminidase [Rhodobacterales bacterium Y4I] Length = 334 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+ N +P+ D+ K + + ++ ++ Sbjct: 106 IAHELHGLGIDSNCAPIADVACADTHE-FLKNRCYGEDTQSVAAIGRAVAQGHLD 159 >gi|288870593|ref|ZP_06114651.2| glycosyl hydrolase, family 3 [Clostridium hathewayi DSM 13479] gi|288866617|gb|EFC98915.1| glycosyl hydrolase, family 3 [Clostridium hathewayi DSM 13479] Length = 583 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 K + G N F+PV+D+ + F E + + R Sbjct: 137 CKEAASVGCNWTFAPVVDINKNWRNCVV-SNRCFGSDADMVLEMGKEYMRG 186 >gi|319639191|ref|ZP_07993942.1| beta-hexosaminidase [Neisseria mucosa C102] gi|317399375|gb|EFV80045.1| beta-hexosaminidase [Neisseria mucosa C102] Length = 361 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+++F+PVLDL +G I F R + A + K Sbjct: 114 LATELSACGIDLSFTPVLDLDWGQCAVIG--NRSFHRDANIVTQLALALQKGLNK 166 >gi|254457746|ref|ZP_05071174.1| B-N-acetylglucosaminidase, glycoside hydrolase family 3 protein [Campylobacterales bacterium GD 1] gi|207086538|gb|EDZ63822.1| B-N-acetylglucosaminidase, glycoside hydrolase family 3 protein [Campylobacterales bacterium GD 1] Length = 555 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQ-KRSIFSRIPAKAEESAQLFSRTYIKN 56 +K L + IN NF+PV+DL P+ + F + K A++ + K+ Sbjct: 138 SKMLSNNNINCNFAPVVDLDINPKNKVISELERSFGKDSEKVTHYAKIVIDSQTKH 193 >gi|298252203|ref|ZP_06976006.1| glycoside hydrolase family 3 domain protein [Ktedonobacter racemifer DSM 44963] gi|297546795|gb|EFH80663.1| glycoside hydrolase family 3 domain protein [Ktedonobacter racemifer DSM 44963] Length = 418 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A ++ GINVN +PV+D+ T F A F KN Sbjct: 195 ANHMQQVGINVNLAPVVDVQTA--TPPLLASRTFGTDGNSVATYAGAFLNGLQKN 247 >gi|325964081|ref|YP_004241987.1| beta-glucosidase-like glycosyl hydrolase [Arthrobacter phenanthrenivorans Sphe3] gi|323470168|gb|ADX73853.1| beta-glucosidase-like glycosyl hydrolase [Arthrobacter phenanthrenivorans Sphe3] Length = 483 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A LV G NV+F+P D+ GP S P A FS+ + Sbjct: 121 LAAELVPLGFNVDFAPDTDVTIGPRDPTIGA-RSMSSDPGTAASLGVAFSQGML 173 >gi|222153329|ref|YP_002562506.1| glycosyl hydrolase family protein [Streptococcus uberis 0140J] gi|222114142|emb|CAR42627.1| glycosyl hydrolase family protein [Streptococcus uberis 0140J] Length = 574 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+NVNF P +D+L I + + + Sbjct: 137 AREASALGVNVNFDPCVDILENWRNTIVNT-RAYGTNADDVIKYTTAYLEGL 187 >gi|71064858|ref|YP_263585.1| beta-hexosaminidase [Psychrobacter arcticus 273-4] gi|71037843|gb|AAZ18151.1| glycoside hydrolase family protein [Psychrobacter arcticus 273-4] Length = 360 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ GI+++F+PVLD G I F P A F R Sbjct: 106 MAAEVLAVGIDLSFAPVLDRD-GISQVIG--DRSFHHDPQAIIALASQFMRGMK 156 >gi|218781822|ref|YP_002433140.1| beta-N-acetylhexosaminidase [Desulfatibacillum alkenivorans AK-01] gi|218763206|gb|ACL05672.1| Beta-N-acetylhexosaminidase [Desulfatibacillum alkenivorans AK-01] Length = 328 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MAK L+ +G N+N +PV+D+ P+ F P + + + Sbjct: 108 MAKELLEAGFNMNMAPVMDV-VPPDFDSIMIGRAFEGGPDEVARLGGYVIQYLQE 161 >gi|116254218|ref|YP_770056.1| glycosyl hydrolase [Rhizobium leguminosarum bv. viciae 3841] gi|115258866|emb|CAK09974.1| putative glycosyl hydrolase [Rhizobium leguminosarum bv. viciae 3841] Length = 559 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ G+ +F+PV+D+ + I + +K E A +N Sbjct: 129 LAREGRAMGVRWSFTPVIDINAAFRSPIVGT-RSYGSDVSKIERHAVAHVHGLQRN 183 >gi|146293266|ref|YP_001183690.1| beta-hexosaminidase [Shewanella putrefaciens CN-32] gi|145564956|gb|ABP75891.1| glycoside hydrolase, family 3 domain protein [Shewanella putrefaciens CN-32] Length = 342 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L+ I+++F+PVLDL G I + FS P++ A F Sbjct: 105 MAIELLACDIDLSFAPVLDLN-GISEVIGK--RSFSADPSEVIALADSFIDGM 154 >gi|332529452|ref|ZP_08405411.1| glycoside hydrolase family protein [Hylemonella gracilis ATCC 19624] gi|332041098|gb|EGI77465.1| glycoside hydrolase family protein [Hylemonella gracilis ATCC 19624] Length = 358 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L G++++F+PVLDL +GP I F A A+ ++ Sbjct: 114 LASELRACGVDLSFTPVLDLDWGPSGVIG--DRAFHADARVATLLAKSLMHGLLQ 166 >gi|296138160|ref|YP_003645403.1| glycoside hydrolase [Tsukamurella paurometabola DSM 20162] gi|296026294|gb|ADG77064.1| glycoside hydrolase family 3 domain protein [Tsukamurella paurometabola DSM 20162] Length = 387 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI V+F+P D+ + +S PA + A+ F+ Sbjct: 165 GALMASMGITVDFAPDADVSAQLADSVIG-DRSYSDDPAVVTKYAKAFAAGLRD 217 >gi|167746352|ref|ZP_02418479.1| hypothetical protein ANACAC_01061 [Anaerostipes caccae DSM 14662] gi|167654345|gb|EDR98474.1| hypothetical protein ANACAC_01061 [Anaerostipes caccae DSM 14662] Length = 417 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++ L GIN+N +PV D+L F + + + K Sbjct: 188 SRQLKALGINMNLAPVADVLSNQYNTEVG-NRAFGSDAKEVAAVVKTLVKNMQK 240 >gi|119897938|ref|YP_933151.1| beta-hexosaminidase [Azoarcus sp. BH72] gi|119670351|emb|CAL94264.1| putative beta-hexosaminidase [Azoarcus sp. BH72] Length = 377 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L+ G++++F+PVLDL YG I F R P + AQ + Sbjct: 116 LAAELLAHGVDLSFTPVLDLDYGVSRAIG--NRAFHRDPQVVAQLAQALLAGMAE 168 >gi|84687540|ref|ZP_01015416.1| Putative Glycoside hydrolase [Maritimibacter alkaliphilus HTCC2654] gi|84664449|gb|EAQ10937.1| Putative Glycoside hydrolase [Rhodobacterales bacterium HTCC2654] Length = 334 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+ N +PVLDL+ P+T + + + A + + Sbjct: 106 IAHELRAVGIDGNCAPVLDLVR-PDTHEILANRCYGDDVVRVADIAGAAATGLVD 159 >gi|298369897|ref|ZP_06981213.1| beta-N-acetylhexosaminidase [Neisseria sp. oral taxon 014 str. F0314] gi|298281357|gb|EFI22846.1| beta-N-acetylhexosaminidase [Neisseria sp. oral taxon 014 str. F0314] Length = 361 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L GI+++F+PVLDL +G I F E A + Sbjct: 114 LAAELSACGIDLSFTPVLDLDWGQCAVIG--NRSFHHDAETVAELALALQKGLN 165 >gi|309781192|ref|ZP_07675929.1| beta-N-acetylhexosaminidase [Ralstonia sp. 5_7_47FAA] gi|308920013|gb|EFP65673.1| beta-N-acetylhexosaminidase [Ralstonia sp. 5_7_47FAA] Length = 349 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQ 47 +A L I+++F+PVLDL YG + I F R P A Sbjct: 115 LAAELRACDIDLSFTPVLDLDYGSSSVIG--DRAFHRDPRVVTMLAN 159 >gi|241662610|ref|YP_002980970.1| beta-hexosaminidase [Ralstonia pickettii 12D] gi|240864637|gb|ACS62298.1| Beta-N-acetylhexosaminidase [Ralstonia pickettii 12D] Length = 349 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQ 47 +A L I+++F+PVLDL YG + I F R P A Sbjct: 115 LAAELRACDIDLSFTPVLDLDYGSSSVIG--DRAFHRDPRVVTMLAN 159 >gi|294141536|ref|YP_003557514.1| beta-hexosaminidase [Shewanella violacea DSS12] gi|293328005|dbj|BAJ02736.1| beta-hexosaminidase [Shewanella violacea DSS12] Length = 336 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++F+PVLDL I + F P A+ F + Sbjct: 105 MAIELLACDIDLSFAPVLDLDR-ISRVIGK--RAFGSEPETVISLAESFISGMNQ 156 >gi|56552067|ref|YP_162906.1| beta-N-acetylhexosaminidase [Zymomonas mobilis subsp. mobilis ZM4] gi|260752402|ref|YP_003225295.1| beta-N-acetylhexosaminidase [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|4768848|gb|AAD29642.1|AF124757_2 unknown [Zymomonas mobilis subsp. mobilis ZM4] gi|56543641|gb|AAV89795.1| Beta-N-acetylhexosaminidase [Zymomonas mobilis subsp. mobilis ZM4] gi|258551765|gb|ACV74711.1| Beta-N-acetylhexosaminidase [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 344 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GINV+ P+LD+ I F P + + K Sbjct: 107 LALLLQDVGINVDCMPLLDIRDPEGDNIIG-DRSFGHNPEQVAALGRAVLDGLAK 160 >gi|319426222|gb|ADV54296.1| glycoside hydrolase family 3 domain protein [Shewanella putrefaciens 200] Length = 342 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L+ I+++F+PVLDL G I + FS P++ A F Sbjct: 105 MAIELLACDIDLSFAPVLDLN-GISEVIGK--RSFSADPSEVIALADSFIDGM 154 >gi|297243667|ref|ZP_06927598.1| glycoside hydrolase family protein [Gardnerella vaginalis AMD] gi|296888418|gb|EFH27159.1| glycoside hydrolase family protein [Gardnerella vaginalis AMD] Length = 455 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L G NV+F+PV D++ P+ + K F + F+ ++ Sbjct: 223 IGNYLSNLGFNVDFAPVADVITNPDNNLMIK-RSFGSNASLVANMTDAFTDGLQEH 277 >gi|150396379|ref|YP_001326846.1| beta-N-acetylhexosaminidase [Sinorhizobium medicae WSM419] gi|150027894|gb|ABR60011.1| Beta-N-acetylhexosaminidase [Sinorhizobium medicae WSM419] Length = 344 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ GI V+ PVLD+ + + PA E + S Sbjct: 118 AFDLMRFGITVDCLPVLDVPVPGSHDVIG-NRAYGHDPATVTEIGRAMSEGLK 169 >gi|307825795|ref|ZP_07656011.1| glycoside hydrolase family 3 domain protein [Methylobacter tundripaludum SV96] gi|307733103|gb|EFO03964.1| glycoside hydrolase family 3 domain protein [Methylobacter tundripaludum SV96] Length = 336 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ G++ +F+PVLD+ G I FS PA A + LF + + Sbjct: 104 MAAELLAVGVDFSFAPVLDIDCGVSEIIG--NRSFSTDPALATRLSSLFRKGMNE 156 >gi|114797421|ref|YP_760746.1| beta-hexosaminidase [Hyphomonas neptunium ATCC 15444] gi|114737595|gb|ABI75720.1| beta-hexosaminidase [Hyphomonas neptunium ATCC 15444] Length = 344 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L I+ + SPV+DL + F P +A + A+ Sbjct: 107 IASELAALSIHADCSPVVDLPVPGAHDVIG-DRAFGTEPEQAADLARAALEGL 158 >gi|289617280|emb|CBI56047.1| unnamed protein product [Sordaria macrospora] Length = 1034 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A + G+N+ PVLD+L S P + + + Y Sbjct: 141 ATEVSACGVNLILGPVLDVLTNARYQPLGV-RATSDDPQEVSQYGIAALQGYKD 193 >gi|266622184|ref|ZP_06115119.1| beta-N-acetylglucosaminidase/beta-glucosidase [Clostridium hathewayi DSM 13479] gi|288866085|gb|EFC98383.1| beta-N-acetylglucosaminidase/beta-glucosidase [Clostridium hathewayi DSM 13479] Length = 565 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 A G N NF+PV+DLLY I Q F+ P A+ F R Sbjct: 128 AAESAAIGCNWNFAPVVDLLYNWRNTIVQC-RAFNNSPEDTIRYAKSFFRG 177 >gi|187928028|ref|YP_001898515.1| beta-hexosaminidase [Ralstonia pickettii 12J] gi|187724918|gb|ACD26083.1| Beta-N-acetylhexosaminidase [Ralstonia pickettii 12J] Length = 349 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQ 47 +A L I+++F+PVLDL YG + I F R P A Sbjct: 115 LAAELRACDIDLSFTPVLDLDYGSSSVIG--DRAFHRDPRVVTMLAN 159 >gi|152977897|ref|YP_001343526.1| beta-hexosaminidase [Actinobacillus succinogenes 130Z] gi|171472923|sp|A6VKU4|NAGZ_ACTSZ RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|150839620|gb|ABR73591.1| Beta-N-acetylhexosaminidase [Actinobacillus succinogenes 130Z] Length = 346 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + I+++F+PVLDL + + F A F Sbjct: 105 MAAEMTALDIDLSFAPVLDLGHECKAI---GDRSFCSDAESVFRLASAFIDGMH 155 >gi|194017631|ref|ZP_03056242.1| glycoside hydrolase [Bacillus pumilus ATCC 7061] gi|194010903|gb|EDW20474.1| glycoside hydrolase [Bacillus pumilus ATCC 7061] Length = 639 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L GIN NFSPVLD+ P + FS PA + K Sbjct: 157 IGKELNVLGINTNFSPVLDVNNNPNNPVIGV-RSFSSDPALVTRLGLQTMKGLQK 210 >gi|168213331|ref|ZP_02638956.1| beta-N-acetylglucosaminidase/beta-glucosidase [Clostridium perfringens CPE str. F4969] gi|170715172|gb|EDT27354.1| beta-N-acetylglucosaminidase/beta-glucosidase [Clostridium perfringens CPE str. F4969] Length = 589 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 9/49 (18%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 G N +F+P++D+ I +S + E + + R Sbjct: 130 EAAAIGCNWSFAPIVDINRNWRNPIIST-RTWSADADQTLELSLEYMRG 177 >gi|120598654|ref|YP_963228.1| beta-hexosaminidase [Shewanella sp. W3-18-1] gi|120558747|gb|ABM24674.1| glycoside hydrolase, family 3 domain protein [Shewanella sp. W3-18-1] Length = 342 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L+ I+++F+PVLDL G I + FS P++ A F Sbjct: 105 MAIELLACDIDLSFAPVLDLN-GISEVIGK--RSFSADPSEVIALADSFIDGM 154 >gi|302530153|ref|ZP_07282495.1| beta-N-acetylhexosaminidase [Streptomyces sp. AA4] gi|302439048|gb|EFL10864.1| beta-N-acetylhexosaminidase [Streptomyces sp. AA4] Length = 400 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 K L G+ V+++P D+ P+ + +S P KA + A F+ Sbjct: 182 GKQLRARGVTVDYAPDADVSDEPDDAVIG-DRSYSADPEKARQYAMAFAEGLR 233 >gi|226330518|ref|ZP_03806036.1| hypothetical protein PROPEN_04436 [Proteus penneri ATCC 35198] gi|225201313|gb|EEG83667.1| hypothetical protein PROPEN_04436 [Proteus penneri ATCC 35198] Length = 339 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLDL + IA F P A A+ F + Sbjct: 104 MASEMIAMDIDISFAPVLDLGHNC---IAIGERSFHDSPEIAMTMAESFIKGMR 154 >gi|91977263|ref|YP_569922.1| Beta-N-acetylhexosaminidase [Rhodopseudomonas palustris BisB5] gi|91683719|gb|ABE40021.1| Beta-N-acetylhexosaminidase [Rhodopseudomonas palustris BisB5] Length = 341 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A +L GI V+ P+ D+ + + PAK A+ + + Sbjct: 110 IAADLADLGITVDCLPLADVPIAGADAVIG-DRAYGTEPAKVAAIARAVTEGLEQ 163 >gi|158520312|ref|YP_001528182.1| Beta-N-acetylhexosaminidase [Desulfococcus oleovorans Hxd3] gi|158509138|gb|ABW66105.1| Beta-N-acetylhexosaminidase [Desulfococcus oleovorans Hxd3] Length = 343 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A L G+N+N +PVLD+ G + F+ P + + KN Sbjct: 122 ASELAGIGVNMNMAPVLDVADGVTDSV-MAGRAFAGGPREVARLGGVVIEEMQKN 175 >gi|292487968|ref|YP_003530845.1| putative beta-hexosaminidase [Erwinia amylovora CFBP1430] gi|291553392|emb|CBA20437.1| putative beta-hexosaminidase [Erwinia amylovora CFBP1430] gi|312172093|emb|CBX80350.1| putative beta-hexosaminidase [Erwinia amylovora ATCC BAA-2158] Length = 339 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ +G F + PA A + A+ F R Sbjct: 100 MASEMIAMDIDISFAPVLDIGHGSAAI---GERSFHQDPAVALQMARCFIRGMRD 151 >gi|332678767|gb|AEE87896.1| Beta-hexosaminidase [Francisella cf. novicida Fx1] Length = 378 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 25/56 (44%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MAK + GIN+N +P +D+ I + FS + A LF + K+ Sbjct: 146 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEKH 201 >gi|197709105|gb|ACH72647.1| beta-N-acetylglucosaminidase [Hypocrea virens] Length = 932 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A + G+N+ PVLD+L + P + + Sbjct: 134 ATEISACGVNLMLGPVLDVLNNARYQVIGV-RASGDDPQEVSQYGLAALSGIRD 186 >gi|171913661|ref|ZP_02929131.1| glycosyl hyrolase, family 3 [Verrucomicrobium spinosum DSM 4136] Length = 370 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN++ PVLD+ Y + K + P + ++A F+R K Sbjct: 109 GRLLRLFGINLDLCPVLDISYDDTADNSLKGRCYGTDPQQVVDNAGTFNRAMRK 162 >gi|241762020|ref|ZP_04760104.1| Beta-N-acetylhexosaminidase [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|241373486|gb|EER63073.1| Beta-N-acetylhexosaminidase [Zymomonas mobilis subsp. mobilis ATCC 10988] Length = 344 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GINV+ P+LDL I F P + + K Sbjct: 107 LALLLQDVGINVDCMPLLDLRDPEGDNIIG-DRSFGHNPEQVAALGRAVLDGLAK 160 >gi|164686759|ref|ZP_02210787.1| hypothetical protein CLOBAR_00354 [Clostridium bartlettii DSM 16795] gi|164604149|gb|EDQ97614.1| hypothetical protein CLOBAR_00354 [Clostridium bartlettii DSM 16795] Length = 597 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 9/49 (18%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 G N +F+P++D+ I +S + E + + R Sbjct: 138 EAAAIGCNWSFAPIVDINRNWRNPIIST-RTWSADVEQTLELSLEYMRG 185 >gi|268318158|ref|YP_003291877.1| glycoside hydrolase family 3 domain-containing protein [Rhodothermus marinus DSM 4252] gi|262335692|gb|ACY49489.1| glycoside hydrolase family 3 domain protein [Rhodothermus marinus DSM 4252] Length = 615 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 12/60 (20%), Positives = 19/60 (31%), Gaps = 6/60 (10%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI----KNP 57 A + +GI+ NF+P + + + FS P R NP Sbjct: 158 AIEMRATGIHWNFAPCIAVARDER--WGRTYESFSEDPELVATLGAAAVRGLQNGGLNNP 215 >gi|91776197|ref|YP_545953.1| beta-hexosaminidase [Methylobacillus flagellatus KT] gi|123380421|sp|Q1H075|NAGZ_METFK RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|91710184|gb|ABE50112.1| Beta-N-acetylhexosaminidase [Methylobacillus flagellatus KT] Length = 349 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L GI+ +F+PVLD+ YG I F E A + Sbjct: 108 IAAELRAHGIDFSFTPVLDMDYGESQVIG--DRAFHGDRQAINELAFSLMQGLK 159 >gi|292899187|ref|YP_003538556.1| beta-hexosaminidase [Erwinia amylovora ATCC 49946] gi|291199035|emb|CBJ46146.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase) [Erwinia amylovora ATCC 49946] Length = 343 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ +G F + PA A + A+ F R Sbjct: 104 MASEMIAMDIDISFAPVLDIGHGSAAI---GERSFHQDPAVALQMARCFIRGMRD 155 >gi|269104417|ref|ZP_06157113.1| beta-hexosaminidase [Photobacterium damselae subsp. damselae CIP 102761] gi|268161057|gb|EEZ39554.1| beta-hexosaminidase [Photobacterium damselae subsp. damselae CIP 102761] Length = 330 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++ +PVLDL + + FS PA+ A F + + Sbjct: 97 MAAELLAMDIDLSLAPVLDLGFDCKAI---GDRAFSNDPAEIALYAGEFIQGMKQ 148 >gi|198284528|ref|YP_002220849.1| glycoside hydrolase family 3 domain-containing protein [Acidithiobacillus ferrooxidans ATCC 53993] gi|218665283|ref|YP_002427195.1| beta-hexosaminidase [Acidithiobacillus ferrooxidans ATCC 23270] gi|198249049|gb|ACH84642.1| glycoside hydrolase family 3 domain protein [Acidithiobacillus ferrooxidans ATCC 53993] gi|218517496|gb|ACK78082.1| beta-hexosaminidase [Acidithiobacillus ferrooxidans ATCC 23270] Length = 354 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + L G++++F+P +DL G I R P A + Sbjct: 118 LGTELRALGVDLDFTPCVDLDRGISAVIG--DRAIHRDPVWVGAIAAALWKGM 168 >gi|118498045|ref|YP_899095.1| glycosy hydrolase family protein [Francisella tularensis subsp. novicida U112] gi|82452987|gb|ABB76142.1| BlgX [Francisella novicida] gi|118423951|gb|ABK90341.1| glycosyl hydrolase family 3 [Francisella novicida U112] Length = 378 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 25/56 (44%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MAK + GIN+N +P +D+ I + FS + A LF + K+ Sbjct: 146 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEKH 201 >gi|325067868|ref|ZP_08126541.1| Beta-N-acetylhexosaminidase [Actinomyces oris K20] Length = 329 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Query: 2 AKNLVTSGINVNFSPVLD---LLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L +G+N+N +PV+D + I + + A A F+ Sbjct: 105 GRELADAGVNMNLAPVVDLVDISRPTSNEPIGRWGREYGHDAATVSSQAGAFAEGMR 161 >gi|309810930|ref|ZP_07704730.1| putative beta-hexosaminidase A [Dermacoccus sp. Ellin185] gi|308435084|gb|EFP58916.1| putative beta-hexosaminidase A [Dermacoccus sp. Ellin185] Length = 616 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L + G+ +NF+P D+ GP S P + + Y + Sbjct: 230 GQELRSLGVTMNFAPDADVTVGPHDPTIGV-RSPSSDPQRVARAVNAQVAGYQQ 282 >gi|225572643|ref|ZP_03781398.1| hypothetical protein RUMHYD_00831 [Blautia hydrogenotrophica DSM 10507] gi|225039997|gb|EEG50243.1| hypothetical protein RUMHYD_00831 [Blautia hydrogenotrophica DSM 10507] Length = 441 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L + G N++F+PV D+L E + K F P + R Sbjct: 222 LGAYLKSYGFNMDFAPVADVLVNSENTVV-KERAFGSDPNLVSSMVEAEVRGLK 274 >gi|327189132|gb|EGE56317.1| putative beta-N-acetylhexosaminidase protein [Rhizobium etli CNPAF512] Length = 337 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L GI+V+ PVLD+ + + + + + Sbjct: 111 AFDLSKLGIDVDCLPVLDVPVEGSSNVIG-DRAYGGDSETVIAMGRAAAEGLK 162 >gi|259046905|ref|ZP_05737306.1| beta-N-acetylglucosaminidase/beta-glucosidase (3-beta-N-acetyl-D-glucosaminidase/beta-D- glucosidase)(Nag3) [Granulicatella adiacens ATCC 49175] gi|259036528|gb|EEW37783.1| beta-N-acetylglucosaminidase/beta-glucosidase (3-beta-N-acetyl-D-glucosaminidase/beta-D- glucosidase)(Nag3) [Granulicatella adiacens ATCC 49175] Length = 574 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ G+NVNF P +D+L I + + + Sbjct: 137 AREETALGVNVNFDPCVDILENWRNTIVNT-RAYGTTAEDVIKYTNAYVEGLK 188 >gi|84495063|ref|ZP_00994182.1| hypothetical protein JNB_09694 [Janibacter sp. HTCC2649] gi|84384556|gb|EAQ00436.1| hypothetical protein JNB_09694 [Janibacter sp. HTCC2649] Length = 632 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Query: 2 AKNLVTSGINVNFSPVLDL----LYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L +G+N+N +PV+D + P+ I F P+ F Sbjct: 147 GQQLAAAGVNLNLAPVMDTVPSAAFAPQNIPIGYYDREFGYTPSTVGSHGSAFVSGMH 204 >gi|289208422|ref|YP_003460488.1| beta-N-acetylhexosaminidase [Thioalkalivibrio sp. K90mix] gi|288944053|gb|ADC71752.1| Beta-N-acetylhexosaminidase [Thioalkalivibrio sp. K90mix] Length = 347 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L +GI+ +F+PVLD G I F P A R Sbjct: 113 LALELREAGIDFSFTPVLDRDIGVSEVIG--DRAFHHDPDVIARLAGDLIRGL 163 >gi|312795547|ref|YP_004028469.1| Anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Burkholderia rhizoxinica HKI 454] gi|312167322|emb|CBW74325.1| Anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase (EC 3.2.1.-) [Burkholderia rhizoxinica HKI 454] Length = 345 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L SG++++F+PVLDL YG I F P A+ + Sbjct: 113 MASELRASGLDLSFAPVLDLDYGHAKAIG--DRAFHADPRVVALLAKSVAHGL 163 >gi|254786000|ref|YP_003073429.1| glycoside hydrolase family 3 domain-containing protein [Teredinibacter turnerae T7901] gi|237686480|gb|ACR13744.1| glycoside hydrolase family 3 domain protein [Teredinibacter turnerae T7901] Length = 343 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L+ G++++F+PVLD+ I F PA ++ + I+ Sbjct: 110 LAAELIACGLDMSFTPVLDVDDCRSQIIGS--RSFGPDPAAVIALSEALTDGLIE 162 >gi|254373400|ref|ZP_04988888.1| hypothetical protein FTCG_00990 [Francisella tularensis subsp. novicida GA99-3549] gi|151571126|gb|EDN36780.1| hypothetical protein FTCG_00990 [Francisella novicida GA99-3549] Length = 347 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 25/56 (44%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MAK + GIN+N +P +D+ I + FS + A LF + K+ Sbjct: 115 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEKH 170 >gi|254477229|ref|ZP_05090615.1| beta-hexosaminidase [Ruegeria sp. R11] gi|214031472|gb|EEB72307.1| beta-hexosaminidase [Ruegeria sp. R11] Length = 334 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GI+ N +P+ D+ + + R A +A+ + + Sbjct: 106 IAQELREVGIDSNCAPLADVASKDTHP-FLQNRCYGRDLAAVVANARATADGLLD 159 >gi|291521627|emb|CBK79920.1| Beta-glucosidase-related glycosidases [Coprococcus catus GD/7] Length = 589 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + G+N++ +PV D+L G T I F + A R + Sbjct: 359 IGSLMSAYGLNLDLAPVADVLSGNSTGIG--DRTFGTDAQTVSDMASEVIRGIQE 411 >gi|312114661|ref|YP_004012257.1| glycoside hydrolase [Rhodomicrobium vannielii ATCC 17100] gi|311219790|gb|ADP71158.1| glycoside hydrolase family 3 domain protein [Rhodomicrobium vannielii ATCC 17100] Length = 338 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA +L T G N +PVLD+ I + + + + Sbjct: 110 MAADLATLGFNTTAAPVLDVPIPGADNIIG-DRAYGEDVETVIALGRAVADGLL 162 >gi|208779545|ref|ZP_03246890.1| glycosyl hydrolase family 3 N domain protein [Francisella novicida FTG] gi|208744506|gb|EDZ90805.1| glycosyl hydrolase family 3 N domain protein [Francisella novicida FTG] Length = 351 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 25/56 (44%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MAK + GIN+N +P +D+ I + FS + A LF + K+ Sbjct: 119 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEKH 174 >gi|167756836|ref|ZP_02428963.1| hypothetical protein CLORAM_02385 [Clostridium ramosum DSM 1402] gi|167703011|gb|EDS17590.1| hypothetical protein CLORAM_02385 [Clostridium ramosum DSM 1402] Length = 1079 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L G+NVNF+P D+ P + FS P A + + N Sbjct: 161 IGSELNAVGVNVNFAPDADVNNNPNNPVIGL-RSFSSNPQLAAKFVSAYIEGVQSN 215 >gi|89054000|ref|YP_509451.1| Beta-N-acetylhexosaminidase [Jannaschia sp. CCS1] gi|88863549|gb|ABD54426.1| Beta-N-acetylhexosaminidase [Jannaschia sp. CCS1] Length = 338 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 14/55 (25%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GI+V P D+ K ++ A+ Sbjct: 105 IGHELREVGIDVQCGPTCDVARDTTHP-FLKNRLYGYDADSVTRYAEAVVSGLAD 158 >gi|237734549|ref|ZP_04565030.1| beta-hexosamidase A [Mollicutes bacterium D7] gi|229382369|gb|EEO32460.1| beta-hexosamidase A [Coprobacillus sp. D7] Length = 1092 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L G+NVNF+P D+ P + FS P A + + N Sbjct: 174 IGSELNAVGVNVNFAPDADVNNNPNNPVIGL-RSFSSNPQLAAKFVSAYIEGVQSN 228 >gi|194323270|ref|ZP_03057054.1| glycosyl hydrolase family 3 N domain protein [Francisella tularensis subsp. novicida FTE] gi|194322634|gb|EDX20114.1| glycosyl hydrolase family 3 N domain protein [Francisella tularensis subsp. novicida FTE] Length = 351 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 25/56 (44%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 MAK + GIN+N +P +D+ I + FS + A LF + K+ Sbjct: 119 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEKH 174 >gi|300933106|ref|ZP_07148362.1| putative beta-glucosidase-related glycosidase [Corynebacterium resistens DSM 45100] Length = 411 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPE-TFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+ V+F+PV+DL + + FS P + + ++ Sbjct: 185 GRKLRKLGVTVDFAPVVDLGGAEDISANGIGSRAFSADPQVVAKYGRAYAEGLRD 239 >gi|322690784|ref|YP_004220354.1| beta-hexosaminidase [Bifidobacterium longum subsp. longum JCM 1217] gi|320455640|dbj|BAJ66262.1| putative beta-hexosaminidase [Bifidobacterium longum subsp. longum JCM 1217] Length = 401 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 15/57 (26%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDL---LYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L +GINV+ +PVL I F A E Sbjct: 178 GSQLAAAGINVDLAPVLGTVVGNRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLRD 234 >gi|18309136|ref|NP_561070.1| beta-hexosamidase A [Clostridium perfringens str. 13] gi|168205686|ref|ZP_02631691.1| beta-N-acetylglucosaminidase/beta-glucosidase [Clostridium perfringens E str. JGS1987] gi|168217254|ref|ZP_02642879.1| beta-N-acetylglucosaminidase/beta-glucosidase [Clostridium perfringens NCTC 8239] gi|169344331|ref|ZP_02865310.1| beta-N-acetylglucosaminidase/beta-glucosidase (3-beta-N-acetyl-D-glucosaminidase/beta-D- glucosidase)(Nag3) [Clostridium perfringens C str. JGS1495] gi|18143811|dbj|BAB79860.1| probable beta-hexosamidase A [Clostridium perfringens str. 13] gi|169297589|gb|EDS79691.1| beta-N-acetylglucosaminidase/beta-glucosidase (3-beta-N-acetyl-D-glucosaminidase/beta-D- glucosidase)(Nag3) [Clostridium perfringens C str. JGS1495] gi|170662845|gb|EDT15528.1| beta-N-acetylglucosaminidase/beta-glucosidase [Clostridium perfringens E str. JGS1987] gi|182380633|gb|EDT78112.1| beta-N-acetylglucosaminidase/beta-glucosidase [Clostridium perfringens NCTC 8239] Length = 589 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 9/49 (18%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 G N +F+P++D+ I +S + E + + R Sbjct: 130 EASAIGCNWSFAPIVDINRNWRNPIIST-RTWSADADQTLELSLEYMRG 177 >gi|182624804|ref|ZP_02952584.1| beta-N-acetylglucosaminidase/beta-glucosidase [Clostridium perfringens D str. JGS1721] gi|177910014|gb|EDT72416.1| beta-N-acetylglucosaminidase/beta-glucosidase [Clostridium perfringens D str. JGS1721] Length = 589 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 9/49 (18%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 G N +F+P++D+ I +S + E + + R Sbjct: 130 EASAIGCNWSFAPIVDINRNWRNPIIST-RTWSADADQTLELSLEYMRG 177 >gi|325267692|ref|ZP_08134343.1| beta-N-acetylhexosaminidase [Kingella denitrificans ATCC 33394] gi|324980816|gb|EGC16477.1| beta-N-acetylhexosaminidase [Kingella denitrificans ATCC 33394] Length = 360 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L G++++F+PVLDL +G I F R P E A R Sbjct: 113 LAAELAACGVDLSFTPVLDLDWGQCAVIG--NRSFHRRPDIVTELALALQRGLN 164 >gi|302529885|ref|ZP_07282227.1| glycosyl hydrolase [Streptomyces sp. AA4] gi|302438780|gb|EFL10596.1| glycosyl hydrolase [Streptomyces sp. AA4] Length = 353 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 25/52 (48%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +NL G+NVN +PVLD+ P FI + +S+ P A + F Sbjct: 133 QNLAGVGMNVNLAPVLDVYRQPGNFIDKYGRSYSQDPQVAGALGRDFVTAQQ 184 >gi|227546196|ref|ZP_03976245.1| beta-N-acetylglucosaminidase [Bifidobacterium longum subsp. infantis ATCC 55813] gi|227213177|gb|EEI81049.1| beta-N-acetylglucosaminidase [Bifidobacterium longum subsp. infantis ATCC 55813] Length = 333 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 15/57 (26%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDL---LYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L +GINV+ +PVL I F A E Sbjct: 110 GSQLAAAGINVDLAPVLGTVVGDRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLRD 166 >gi|23465597|ref|NP_696200.1| B-hexosaminidase [Bifidobacterium longum NCC2705] gi|23326266|gb|AAN24836.1| possible B-hexosaminidase [Bifidobacterium longum NCC2705] Length = 400 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 15/57 (26%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDL---LYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L +GINV+ +PVL I F A E Sbjct: 177 GSQLAAAGINVDLAPVLGTVVGDRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLRD 233 >gi|300786249|ref|YP_003766540.1| beta-N-acetylhexosaminidase [Amycolatopsis mediterranei U32] gi|299795763|gb|ADJ46138.1| beta-N-acetylhexosaminidase [Amycolatopsis mediterranei U32] Length = 485 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+ +N +P DL E I F PAKA + K Sbjct: 113 LGERLAACGVTLNLAPCADLTLAAEDPIIGV-RAFGSDPAKASPHVAAYVTGLQK 166 >gi|222151535|ref|YP_002560691.1| hypothetical protein MCCL_1288 [Macrococcus caseolyticus JCSC5402] gi|222120660|dbj|BAH17995.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402] Length = 379 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 + +N+ G N++F+PVLD+ P + F ++ F + Sbjct: 158 IGENVKRMGFNLDFAPVLDIWSNPANKVIG-DRSFGHDAHMVSGMSRSFRQG 208 >gi|251797155|ref|YP_003011886.1| glycoside hydrolase [Paenibacillus sp. JDR-2] gi|247544781|gb|ACT01800.1| glycoside hydrolase family 3 domain protein [Paenibacillus sp. JDR-2] Length = 403 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 9/46 (19%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESA 46 + + + G+N +F+PVLD+ P+ + F Sbjct: 160 LGEAVKAIGLNTDFAPVLDINTNPKNPVIG-NRAFGTTAELVSRMG 204 >gi|119632797|gb|ABL84403.1| hypothetical protein [Streptococcus suis] Length = 84 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N +F+P++DL I + + E ++ + R +++ Sbjct: 15 EAAAVGCNASFAPIMDLSRNWRNPII-ANRTWGANVDQVIELSKEYMRGIMEH 66 >gi|220911566|ref|YP_002486875.1| carbohydrate kinase, thermoresistant glucokinase family [Arthrobacter chlorophenolicus A6] gi|219858444|gb|ACL38786.1| carbohydrate kinase, thermoresistant glucokinase family [Arthrobacter chlorophenolicus A6] Length = 759 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 G N F+P++D+ Y + F P E A+ + ++P Sbjct: 311 ETAALGCNWAFAPIVDIHYNWRNTVIST-RSFGNTPEIVVERAKEYFDGISESP 363 >gi|157961365|ref|YP_001501399.1| beta-hexosaminidase [Shewanella pealeana ATCC 700345] gi|157846365|gb|ABV86864.1| glycoside hydrolase family 3 domain protein [Shewanella pealeana ATCC 700345] Length = 355 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++F+PVLDL G I FS + E A F + Sbjct: 125 MAIELLAVDIDLSFAPVLDLN-GVSQVIGT--RSFSPDKGEVAELASAFIDGMEQ 176 >gi|113868512|ref|YP_727001.1| beta-hexosaminidase [Ralstonia eutropha H16] gi|113527288|emb|CAJ93633.1| Beta-glucosidase-related glycosidase [Ralstonia eutropha H16] Length = 349 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 23/56 (41%), Gaps = 7/56 (12%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A L I+++F+PVLDL YG I F P A ++ + Sbjct: 115 LAAELRACDIDLSFTPVLDLDYGRSAVIG--DRAFHADPRVVSMLA-----GHLNH 163 >gi|146282104|ref|YP_001172257.1| beta-hexosaminidase [Pseudomonas stutzeri A1501] gi|145570309|gb|ABP79415.1| beta-hexosaminidase [Pseudomonas stutzeri A1501] Length = 265 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ G++ +F+PVLDL + + F P A F R Sbjct: 34 MASEVLAVGLDFSFAPVLDLDHQRSAVVGA--RAFEGDPQVAVPLIDSFIRGMH 85 >gi|46191083|ref|ZP_00120500.2| COG1472: Beta-glucosidase-related glycosidases [Bifidobacterium longum DJO10A] gi|189439644|ref|YP_001954725.1| beta-glucosidase-like glycosidase [Bifidobacterium longum DJO10A] gi|189428079|gb|ACD98227.1| Beta-glucosidase-like glycosidase [Bifidobacterium longum DJO10A] Length = 392 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 15/57 (26%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDL---LYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L +GINV+ +PVL I F A E Sbjct: 169 GSQLAAAGINVDLAPVLGTVVGDRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLRD 225 >gi|307317042|ref|ZP_07596483.1| Beta-N-acetylhexosaminidase [Sinorhizobium meliloti AK83] gi|306897130|gb|EFN27875.1| Beta-N-acetylhexosaminidase [Sinorhizobium meliloti AK83] Length = 344 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ GI V+ PVLD+ + + PA + S Sbjct: 118 AFDLMRFGITVDCLPVLDVPVPGSHDVIG-NRAYGHDPATVTAIGRAMSEGLK 169 >gi|306833488|ref|ZP_07466615.1| possible beta-N-acetylhexosaminidase [Streptococcus bovis ATCC 700338] gi|304424258|gb|EFM27397.1| possible beta-N-acetylhexosaminidase [Streptococcus bovis ATCC 700338] Length = 574 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+NVNF P +D+L I + + Sbjct: 137 AREEKALGVNVNFDPCVDILENWRNTIVNT-RAYGTTAQDVITYTSAYLDGL 187 >gi|298252202|ref|ZP_06976005.1| glycoside hydrolase family 3 domain protein [Ktedonobacter racemifer DSM 44963] gi|297546794|gb|EFH80662.1| glycoside hydrolase family 3 domain protein [Ktedonobacter racemifer DSM 44963] Length = 415 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK+L GIN N +PV+D+ T + IF A F KN Sbjct: 191 AKHLQQLGINTNLAPVVDVQTV--TPPLLQSRIFGSDGDTVATYAGAFLNGVQKN 243 >gi|300021756|ref|YP_003754367.1| glycoside hydrolase [Hyphomicrobium denitrificans ATCC 51888] gi|299523577|gb|ADJ22046.1| glycoside hydrolase family 3 domain protein [Hyphomicrobium denitrificans ATCC 51888] Length = 383 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG--PETFIA--QKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L T G+N+NF PV+DL P S P + A + T + Sbjct: 160 ARELQTLGVNMNFGPVVDLQSSAAPANDSGSRIYSRAISSDPEIVAKVAVWYCETLAE 217 >gi|153832006|ref|ZP_01984673.1| periplasmic beta-glucosidase [Vibrio harveyi HY01] gi|148872004|gb|EDL70827.1| periplasmic beta-glucosidase [Vibrio harveyi HY01] Length = 718 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + GIN F+P+LD++ P + P + A+ + Sbjct: 132 IAAEAASLGINWTFAPMLDIVRDPR--WGRVIESSGEDPYLTSQFARAVINGFQ 183 >gi|296284540|ref|ZP_06862538.1| glycosyl hydrolase [Citromicrobium bathyomarinum JL354] Length = 340 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 15/53 (28%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L +GI V+F D+ + P + + Sbjct: 108 MATELAAAGITVDFHAPCDVARPETDDVIG-DRALGAEPMQVAALGRAILDGM 159 >gi|325962125|ref|YP_004240031.1| carbohydrate kinase, thermoresistant glucokinase family [Arthrobacter phenanthrenivorans Sphe3] gi|323468212|gb|ADX71897.1| carbohydrate kinase, thermoresistant glucokinase family [Arthrobacter phenanthrenivorans Sphe3] Length = 776 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 G N F+P++D+ Y + F P E A+ + ++P Sbjct: 328 ETAALGCNWAFAPIVDIHYNWRNTVIST-RAFGNTPEIVVERAKEYFDGISESP 380 >gi|312133042|ref|YP_004000381.1| bglx1 [Bifidobacterium longum subsp. longum BBMN68] gi|311774032|gb|ADQ03520.1| BglX1 [Bifidobacterium longum subsp. longum BBMN68] Length = 392 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 15/57 (26%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDL---LYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L +GINV+ +PVL I F A E Sbjct: 169 GSQLAAAGINVDLAPVLGTVVGDRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLRD 225 >gi|145611154|ref|XP_368623.2| hypothetical protein MGG_00621 [Magnaporthe oryzae 70-15] gi|145018470|gb|EDK02749.1| hypothetical protein MGG_00621 [Magnaporthe oryzae 70-15] Length = 890 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + G+N+ PVLD+L S P + + Y Sbjct: 127 ATEVSAVGVNLILGPVLDVLTNARYQPLGV-RATSDDPQEVSQYGIAAMNGYK 178 >gi|114047304|ref|YP_737854.1| beta-hexosaminidase [Shewanella sp. MR-7] gi|123030658|sp|Q0HVQ8|NAGZ_SHESR RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|113888746|gb|ABI42797.1| glycoside hydrolase, family 3 domain protein [Shewanella sp. MR-7] Length = 342 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++F+PVLDL G I + FS P + AQ F + Sbjct: 105 MAIELLACDIDLSFAPVLDLN-GISQVIGK--RSFSAKPDEVIALAQSFIEGMAE 156 >gi|318056374|ref|ZP_07975097.1| glycoside hydrolase family 3 domain protein [Streptomyces sp. SA3_actG] Length = 515 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 7/45 (15%), Positives = 15/45 (33%), Gaps = 1/45 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEES 45 +A+ + G ++ PV D+ P + + P Sbjct: 113 IAQEVRAYGADLVLGPVADVNADPANPVIGV-RSYGADPHLVGRH 156 >gi|317481853|ref|ZP_07940880.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bifidobacterium sp. 12_1_47BFAA] gi|316916644|gb|EFV38039.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bifidobacterium sp. 12_1_47BFAA] Length = 426 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 15/57 (26%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDL---LYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L +GINV+ +PVL I F A E Sbjct: 203 GSQLAAAGINVDLAPVLGTVVGDRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLRD 259 >gi|261337274|ref|ZP_05965158.1| putative beta-N-acetylhexosaminidase [Bifidobacterium gallicum DSM 20093] gi|270277639|gb|EFA23493.1| putative beta-N-acetylhexosaminidase [Bifidobacterium gallicum DSM 20093] Length = 502 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLD---LLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L +G+N++ +P LD + I F + F K Sbjct: 276 GQQLRQAGVNIDLAPSLDTVVIDRSSNAPIGALDRDFGLSAKGNAQHGIAFVEGMRK 332 >gi|322688794|ref|YP_004208528.1| beta-hexosaminidase [Bifidobacterium longum subsp. infantis 157F] gi|320460130|dbj|BAJ70750.1| putative beta-hexosaminidase [Bifidobacterium longum subsp. infantis 157F] Length = 400 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 15/57 (26%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDL---LYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L +GINV+ +PVL I F A E Sbjct: 177 GSQLAAAGINVDLAPVLGTVVGDRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLRD 233 >gi|188534141|ref|YP_001907938.1| beta-hexosaminidase [Erwinia tasmaniensis Et1/99] gi|226724438|sp|B2VDM3|NAGZ_ERWT9 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|188029183|emb|CAO97055.1| Beta-hexosaminidase (N-acetyl-beta-glucosaminidase) [Erwinia tasmaniensis Et1/99] Length = 343 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ YG F PA A + A+ F R + Sbjct: 104 MASEMIAMDIDISFAPVLDIGYGSAAI---GERSFHEDPAIALQMARCFIRGMRE 155 >gi|83952165|ref|ZP_00960897.1| beta-N-acetylhexosaminidase, putative [Roseovarius nubinhibens ISM] gi|83837171|gb|EAP76468.1| beta-N-acetylhexosaminidase, putative [Roseovarius nubinhibens ISM] Length = 336 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA+ L G++ N +P++D++ + P E + + Sbjct: 114 MAEELRALGVDSNCAPLVDVIAEATHE-FLTDRCYGDAPDAVGEIGAAVAEGLL 166 >gi|291519423|emb|CBK74644.1| Beta-glucosidase-related glycosidases [Butyrivibrio fibrisolvens 16/4] Length = 585 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 K G+N +F+P++D+ I F P + A + +N Sbjct: 130 CKEGAALGMNWSFAPIVDINKEFHNPITNV-RTFGDNPQMVVDFASRYMDGADEN 183 >gi|33602319|ref|NP_889879.1| beta-hexosaminidase [Bordetella bronchiseptica RB50] gi|47605845|sp|Q7W9J5|NAGZ_BORPA RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|47605847|sp|Q7WH65|NAGZ_BORBR RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|33576758|emb|CAE33836.1| putative beta-hexosaminidase [Bordetella bronchiseptica RB50] Length = 353 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L G++++F+PVLDL YG I F ++ ++ Sbjct: 119 LAAELRACGVDLSFTPVLDLDYGVSKVIG--NRAFHHDARVVTMLSRALAQGL 169 >gi|333027949|ref|ZP_08456013.1| putative glycoside hydrolase family 3 domain protein [Streptomyces sp. Tu6071] gi|332747801|gb|EGJ78242.1| putative glycoside hydrolase family 3 domain protein [Streptomyces sp. Tu6071] Length = 508 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 7/45 (15%), Positives = 15/45 (33%), Gaps = 1/45 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEES 45 +A+ + G ++ PV D+ P + + P Sbjct: 106 IAQEVRAYGADLVLGPVADVNADPANPVIGV-RSYGADPHLVGRH 149 >gi|256378070|ref|YP_003101730.1| glycoside hydrolase family 3 domain protein [Actinosynnema mirum DSM 43827] gi|255922373|gb|ACU37884.1| glycoside hydrolase family 3 domain protein [Actinosynnema mirum DSM 43827] Length = 403 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + G+N + +PVLDL + FS PA A A+ F+ + Sbjct: 187 GEAMKARGVNTDLAPVLDLTSQAANTVIG-DRSFSVDPATAVSYAEAFAEGLRQ 239 >gi|319954302|ref|YP_004165569.1| glycoside hydrolase family 3 domain protein [Cellulophaga algicola DSM 14237] gi|319422962|gb|ADV50071.1| glycoside hydrolase family 3 domain protein [Cellulophaga algicola DSM 14237] Length = 524 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 +A + +GI+ N +PV+D+ P + F A F + Sbjct: 139 IAADCKAAGIHWNLAPVVDINNNPNNPVIG-YRSFGENKYLVTLKAAAFIKG 189 >gi|294788722|ref|ZP_06753963.1| beta-N-acetylhexosaminidase [Simonsiella muelleri ATCC 29453] gi|294483204|gb|EFG30890.1| beta-N-acetylhexosaminidase [Simonsiella muelleri ATCC 29453] Length = 350 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A LV G++++F+PVLDL +G I F R P A R Sbjct: 103 LATELVACGVDLSFTPVLDLDWGKCAVIG--NRSFHRQPEIVTALALALQRGLN 154 >gi|237748848|ref|ZP_04579328.1| beta-hexosaminidase [Oxalobacter formigenes OXCC13] gi|229380210|gb|EEO30301.1| beta-hexosaminidase [Oxalobacter formigenes OXCC13] Length = 355 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L + GI+ +F+PVLDL YG T I FSR P A+ Sbjct: 120 LASELRSCGIDFSFTPVLDLDYGVSTVIG--NRSFSRNPNIVTFLAKS 165 >gi|15965278|ref|NP_385631.1| putative hydrolase glycosidase protein [Sinorhizobium meliloti 1021] gi|307309301|ref|ZP_07588969.1| Beta-N-acetylhexosaminidase [Sinorhizobium meliloti BL225C] gi|15074458|emb|CAC46104.1| Putative Beta-hexosaminidase [Sinorhizobium meliloti 1021] gi|306900302|gb|EFN30919.1| Beta-N-acetylhexosaminidase [Sinorhizobium meliloti BL225C] Length = 344 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ GI V+ PVLD+ + + PA + S Sbjct: 118 AFDLMRFGITVDCLPVLDVPVPGSHDVIG-NRAYGHDPATVTAIGRAMSEGLK 169 >gi|239622199|ref|ZP_04665230.1| conserved hypothetical protein [Bifidobacterium longum subsp. infantis CCUG 52486] gi|239514196|gb|EEQ54063.1| conserved hypothetical protein [Bifidobacterium longum subsp. infantis CCUG 52486] Length = 418 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 15/57 (26%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDL---LYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L +GINV+ +PVL I F A E Sbjct: 195 GSQLAAAGINVDLAPVLGTVVGDRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLRD 251 >gi|318075725|ref|ZP_07983057.1| O-glycosyl hydrolase family 3 protein [Streptomyces sp. SA3_actF] Length = 359 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 7/45 (15%), Positives = 15/45 (33%), Gaps = 1/45 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEES 45 +A+ + G ++ PV D+ P + + P Sbjct: 113 IAQEVRAYGADLVLGPVADVNADPANPVIGV-RSYGADPHLVGRH 156 >gi|189461857|ref|ZP_03010642.1| hypothetical protein BACCOP_02523 [Bacteroides coprocola DSM 17136] gi|189431451|gb|EDV00436.1| hypothetical protein BACCOP_02523 [Bacteroides coprocola DSM 17136] Length = 990 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G++VNF+PV D+ P F P + +SR Sbjct: 152 ARQLREIGVHVNFAPVADVDNNPNNP-VINVRSFGSDPKVVADKVVAYSRGLED 204 >gi|148556834|ref|YP_001264416.1| Beta-N-acetylhexosaminidase [Sphingomonas wittichii RW1] gi|148502024|gb|ABQ70278.1| Beta-N-acetylhexosaminidase [Sphingomonas wittichii RW1] Length = 337 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSR 51 +A L GI V+ P+LD+ I P + + Sbjct: 108 IAATLAKVGITVDCLPLLDVRQPGAHDIIG-DRALGAEPLRVAAMGRAVIE 157 >gi|294628076|ref|ZP_06706636.1| beta-N-acetylhexosaminidase [Streptomyces sp. e14] gi|292831409|gb|EFF89758.1| beta-N-acetylhexosaminidase [Streptomyces sp. e14] Length = 435 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 2 AKNLVTSGINVNFSPVLDLLYGP----ETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 AK L ++G+N+N +PV D++ I + + PA F+ + Sbjct: 209 AKELKSAGVNLNLAPVADVVPASLGARNIPIGSFQREYGHTPATVTSHTGAFAAGF 264 >gi|33596392|ref|NP_884035.1| beta-hexosaminidase [Bordetella parapertussis 12822] gi|33566161|emb|CAE37065.1| putative beta-hexosaminidase [Bordetella parapertussis] Length = 367 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L G++++F+PVLDL YG I F ++ ++ Sbjct: 133 LAAELRACGVDLSFTPVLDLDYGVSKVIG--NRAFHHDARVVTMLSRALAQGL 183 >gi|311070818|ref|YP_003975741.1| putative beta-hexosaminidase, putative lipoprotein [Bacillus atrophaeus 1942] gi|310871335|gb|ADP34810.1| putative beta-hexosaminidase, putative lipoprotein [Bacillus atrophaeus 1942] Length = 642 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L GIN +F PVLD+ P + FS + + K Sbjct: 160 IGKELSALGINTDFGPVLDINNNPNNPVIGV-RSFSSNREVTAKLGMYSMKGLQK 213 >gi|302534498|ref|ZP_07286840.1| beta-N-acetylglucosaminidase [Streptomyces sp. C] gi|302443393|gb|EFL15209.1| beta-N-acetylglucosaminidase [Streptomyces sp. C] Length = 605 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GI +++PV D+ P + F PA A R Y Sbjct: 194 GTELAALGIRQDWAPVADVNVNPANPVIGV-RSFGSDPAAVAALAAAQVRGYQ 245 >gi|94263300|ref|ZP_01287116.1| Glycoside hydrolase, family 3-like [delta proteobacterium MLMS-1] gi|93456383|gb|EAT06507.1| Glycoside hydrolase, family 3-like [delta proteobacterium MLMS-1] Length = 320 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A L GIN+NF+PVLDL + F +R + PA +L T Sbjct: 102 ATELRAVGININFAPVLDLCPAGQGF-YMERRVLGEEPATVARLGRLLIETMQ 153 >gi|94266964|ref|ZP_01290614.1| Glycoside hydrolase, family 3-like [delta proteobacterium MLMS-1] gi|93452342|gb|EAT02970.1| Glycoside hydrolase, family 3-like [delta proteobacterium MLMS-1] Length = 335 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A L GIN+NF+PVLDL + F +R + PA +L T Sbjct: 117 ATELRAVGININFAPVLDLCPAGQGF-YMERRVLGEEPATVARLGRLLIETMQ 168 >gi|159039162|ref|YP_001538415.1| glycoside hydrolase family 3 protein [Salinispora arenicola CNS-205] gi|157917997|gb|ABV99424.1| glycoside hydrolase family 3 domain protein [Salinispora arenicola CNS-205] Length = 575 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L G+NV+F+PV D+L P T I + P+ R Sbjct: 208 GTELAAMGVNVDFAPVADVLVTPSTVIGS--RSYGADPSAVAAQVSGAVRGLQ 258 >gi|119774463|ref|YP_927203.1| beta-hexosaminidase [Shewanella amazonensis SB2B] gi|119766963|gb|ABL99533.1| beta-hexosaminidase [Shewanella amazonensis SB2B] Length = 341 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L+ S I+++F+PVLD+ G I + FS P + A F R Sbjct: 105 MAVELLASDIDLSFAPVLDVN-GVSDVIGR--RAFSANPDEITALADAFIRGM 154 >gi|306837053|ref|ZP_07469997.1| beta-N-acetylglucosaminidase [Corynebacterium accolens ATCC 49726] gi|304567065|gb|EFM42686.1| beta-N-acetylglucosaminidase [Corynebacterium accolens ATCC 49726] Length = 379 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + K L+ GINV+F+PVLD+ + FS PA+A + F+R Sbjct: 163 IGKRLMDYGINVDFAPVLDVDGDGLEVVG--DRAFSTDPAQAGDYGAAFARGL 213 >gi|301163840|emb|CBW23395.1| putative exported hydrolase [Bacteroides fragilis 638R] Length = 859 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +AK L GI + +PV+D+ + F P R Y+ N Sbjct: 155 IAKELTAQGITQSLTPVIDVCRDLR--WGRVEECFGEDPYLVSRMGVSQVRGYLDN 208 >gi|265766195|ref|ZP_06094236.1| periplasmic beta-glucosidase [Bacteroides sp. 2_1_16] gi|263253863|gb|EEZ25328.1| periplasmic beta-glucosidase [Bacteroides sp. 2_1_16] Length = 859 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +AK L GI + +PV+D+ + F P R Y+ N Sbjct: 155 IAKELTAQGITQSLTPVIDVCRDLR--WGRVEECFGEDPYLVSRMGVSQVRGYLDN 208 >gi|53714352|ref|YP_100344.1| periplasmic beta-glucosidase [Bacteroides fragilis YCH46] gi|52217217|dbj|BAD49810.1| periplasmic beta-glucosidase precursor [Bacteroides fragilis YCH46] Length = 859 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +AK L GI + +PV+D+ + F P R Y+ N Sbjct: 155 IAKELTAQGITQSLTPVIDVCRDLR--WGRVEECFGEDPYLVSRMGVSQVRGYLDN 208 >gi|194290147|ref|YP_002006054.1| beta-hexosaminidase [Cupriavidus taiwanensis LMG 19424] gi|193223982|emb|CAQ69991.1| Beta-hexosaminidase; N-acetyl-beta-glucosaminidase; Beta-N-acetylhexosaminidase [Cupriavidus taiwanensis LMG 19424] Length = 355 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 23/56 (41%), Gaps = 7/56 (12%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A L I+++F+PVLDL YG I F P A ++ + Sbjct: 121 LAAELRACDIDLSFTPVLDLDYGRSAVIG--DRAFHADPRVVSMLA-----GHLNH 169 >gi|329850418|ref|ZP_08265263.1| glycosyl hydrolase family 3 N terminal domain protein [Asticcacaulis biprosthecum C19] gi|328840733|gb|EGF90304.1| glycosyl hydrolase family 3 N terminal domain protein [Asticcacaulis biprosthecum C19] Length = 365 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA +L GINV+ PVLD+ I + + + Sbjct: 115 MANDLYALGINVDCVPVLDVPQPGAHDIIG-DRAYGLTAGDVAVMGRAACEGLL 167 >gi|262280917|ref|ZP_06058700.1| beta-N-acetyl-D-glucosaminidase [Acinetobacter calcoaceticus RUH2202] gi|262257817|gb|EEY76552.1| beta-N-acetyl-D-glucosaminidase [Acinetobacter calcoaceticus RUH2202] Length = 339 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLDL I FS+ A F + K Sbjct: 106 MATEVLAVGIDFSFAPVLDLN-AISDVIG--DRGFSKNIEDIAPLAGAFMQGMKK 157 >gi|169634413|ref|YP_001708149.1| beta-hexosaminidase [Acinetobacter baumannii SDF] gi|169153205|emb|CAP02297.1| beta-N-acetyl-D-glucosaminidase [Acinetobacter baumannii] Length = 339 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLDL I FS+ A F R K Sbjct: 106 MATEVLAVGIDFSFAPVLDLN-AISDVIG--DRGFSKNIEDIAPLAGAFMRGMKK 157 >gi|117920736|ref|YP_869928.1| beta-hexosaminidase [Shewanella sp. ANA-3] gi|166233260|sp|A0KXK3|NAGZ_SHESA RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|117613068|gb|ABK48522.1| glycoside hydrolase, family 3 domain protein [Shewanella sp. ANA-3] Length = 342 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++F+PVLDL G I + FS P + AQ F + Sbjct: 105 MAIELLACDIDLSFAPVLDLN-GISQVIGK--RSFSAKPEEVIALAQSFIEGMAE 156 >gi|222153330|ref|YP_002562507.1| glycosyl hydrolase family protein [Streptococcus uberis 0140J] gi|222114143|emb|CAR42629.1| glycosyl hydrolase family protein [Streptococcus uberis 0140J] Length = 596 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N +F+P++D+ I + + + ++ + + +++ Sbjct: 133 EASAVGCNASFAPIVDITRNWRNPII-ANRTWGSNVDQIIDLSKQYMKGIMEH 184 >gi|83645457|ref|YP_433892.1| beta-glucosidase-like protein [Hahella chejuensis KCTC 2396] gi|83633500|gb|ABC29467.1| Beta-glucosidase-related Glycosidase [Hahella chejuensis KCTC 2396] Length = 346 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A L ++ +F+PVLD+ YG I F P A AQ F R Sbjct: 112 AVELRELDLDFSFAPVLDVDYGKNKVI--ADRAFGDTPTMAAALAQAFWRGM 161 >gi|73541934|ref|YP_296454.1| beta-hexosaminidase [Ralstonia eutropha JMP134] gi|72119347|gb|AAZ61610.1| Beta-N-acetylhexosaminidase [Ralstonia eutropha JMP134] Length = 349 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 23/56 (41%), Gaps = 7/56 (12%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A L I+++F+PVLDL YG I F P A ++ + Sbjct: 115 LAAELRACDIDLSFTPVLDLDYGRSAVIG--DRAFHADPRVVTMLA-----GHLNH 163 >gi|227501948|ref|ZP_03931997.1| beta-N-acetylglucosaminidase family protein [Corynebacterium accolens ATCC 49725] gi|227077332|gb|EEI15295.1| beta-N-acetylglucosaminidase family protein [Corynebacterium accolens ATCC 49725] Length = 379 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + K L+ GINV+F+PVLD+ + FS PA+A + F+R Sbjct: 163 IGKRLMDYGINVDFAPVLDVDGDGLEVVG--DRAFSTDPAQAGDYGAAFARGL 213 >gi|33593098|ref|NP_880742.1| beta-hexosaminidase [Bordetella pertussis Tohama I] gi|47605839|sp|Q7VWV8|NAGZ_BORPE RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|33563473|emb|CAE42358.1| putative beta-hexosaminidase [Bordetella pertussis Tohama I] gi|332382510|gb|AEE67357.1| beta-hexosaminidase [Bordetella pertussis CS] Length = 352 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L G++++F+PVLDL YG I F ++ ++ Sbjct: 119 LAAELRACGVDLSFTPVLDLDYGVSKVIG--NRAFHHDARVVTMLSRALTQGL 169 >gi|184156822|ref|YP_001845161.1| beta-hexosaminidase [Acinetobacter baumannii ACICU] gi|332873237|ref|ZP_08441194.1| beta-L-N-acetylhexosaminidase [Acinetobacter baumannii 6014059] gi|183208416|gb|ACC55814.1| Beta-glucosidase-related glycosidase [Acinetobacter baumannii ACICU] gi|323516588|gb|ADX90969.1| beta-hexosaminidase [Acinetobacter baumannii TCDC-AB0715] gi|332738749|gb|EGJ69619.1| beta-L-N-acetylhexosaminidase [Acinetobacter baumannii 6014059] Length = 339 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLDL I FS+ A F R K Sbjct: 106 MATEVLAVGIDFSFAPVLDLN-AISDVIG--DRGFSKNIEDIAPLAGAFMRGMKK 157 >gi|113970064|ref|YP_733857.1| beta-hexosaminidase [Shewanella sp. MR-4] gi|123325091|sp|Q0HJG7|NAGZ_SHESM RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|113884748|gb|ABI38800.1| glycoside hydrolase, family 3 domain protein [Shewanella sp. MR-4] Length = 342 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++F+PVLDL G I + FS P + AQ F + Sbjct: 105 MAIELLACDIDLSFAPVLDLN-GISQVIGK--RSFSAKPDEVIALAQSFIEGMAE 156 >gi|304391799|ref|ZP_07373741.1| beta-hexosaminidase [Ahrensia sp. R2A130] gi|303296028|gb|EFL90386.1| beta-hexosaminidase [Ahrensia sp. R2A130] Length = 381 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A +L G+NV+ PVLD+ + + + Q Sbjct: 140 AFDLHAVGVNVDCLPVLDVPTPDGHDVIG-DRAYGYDVETVTDLGQAACEGL 190 >gi|145219008|ref|YP_001129717.1| glycoside hydrolase family 3 protein [Prosthecochloris vibrioformis DSM 265] gi|145205172|gb|ABP36215.1| glycoside hydrolase, family 3 domain protein [Chlorobium phaeovibrioides DSM 265] Length = 595 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 10/47 (21%), Positives = 14/47 (29%), Gaps = 1/47 (2%) Query: 8 SGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 GI N++PV DL + F P A + Sbjct: 171 VGIRQNYAPVGDLNSNQMNPVINT-RSFGDRPETAVRMTGAYIEGLQ 216 >gi|253564846|ref|ZP_04842302.1| periplasmic beta-glucosidase [Bacteroides sp. 3_2_5] gi|251946311|gb|EES86688.1| periplasmic beta-glucosidase [Bacteroides sp. 3_2_5] Length = 859 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +AK L GI + +PV+D+ + F P R Y+ N Sbjct: 155 IAKELSAQGITQSLTPVIDVCRDLR--WGRVEECFGEDPFLVSRMGVSQVRGYLDN 208 >gi|193076302|gb|ABO10945.2| beta-N-acetyl-D-glucosaminidase [Acinetobacter baumannii ATCC 17978] Length = 339 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLDL I FS+ A F R K Sbjct: 106 MATEVLAVGIDFSFAPVLDLN-AISDVIG--DRGFSKNIEDIAPLAGAFMRGMKK 157 >gi|60682370|ref|YP_212514.1| putative exported hydrolase [Bacteroides fragilis NCTC 9343] gi|60493804|emb|CAH08594.1| putative exported hydrolase [Bacteroides fragilis NCTC 9343] Length = 859 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +AK L GI + +PV+D+ + F P R Y+ N Sbjct: 155 IAKELSAQGITQSLTPVIDVCRDLR--WGRVEECFGEDPFLVSRMGVSQVRGYLDN 208 >gi|332306971|ref|YP_004434822.1| glycoside hydrolase family 3 domain protein [Glaciecola agarilytica 4H-3-7+YE-5] gi|332174300|gb|AEE23554.1| glycoside hydrolase family 3 domain protein [Glaciecola agarilytica 4H-3-7+YE-5] Length = 333 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + I+++F+PVLDL G I F P + A F + Sbjct: 102 MAAECLAFDIDLSFAPVLDLN-GVSDVIG--DRSFHSQPEPLIQMASAFIKGMH 152 >gi|294630942|ref|ZP_06709502.1| beta-D-xylosidase [Streptomyces sp. e14] gi|292834275|gb|EFF92624.1| beta-D-xylosidase [Streptomyces sp. e14] Length = 745 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ + G++ +PVLD++ P + P A + R Sbjct: 121 IGRDMRSVGVHQGLAPVLDVVRDPR--WGRVEETIGEDPYLVATVATAYVRGLQ 172 >gi|253569371|ref|ZP_04846781.1| periplasmic beta-glucosidase [Bacteroides sp. 1_1_6] gi|251841390|gb|EES69471.1| periplasmic beta-glucosidase [Bacteroides sp. 1_1_6] Length = 759 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + GI+ SPVLD+ + F P E F Y KN Sbjct: 152 GEEAKVIGIHQILSPVLDIARELR--WGRVEETFGEDPYLISEMGIAFINGYQKN 204 >gi|29348263|ref|NP_811766.1| periplasmic beta-glucosidase [Bacteroides thetaiotaomicron VPI-5482] gi|29340166|gb|AAO77960.1| periplasmic beta-glucosidase precursor [Bacteroides thetaiotaomicron VPI-5482] Length = 759 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + GI+ SPVLD+ + F P E F Y KN Sbjct: 152 GEEAKVIGIHQILSPVLDIARELR--WGRVEETFGEDPYLISEMGIAFINGYQKN 204 >gi|88813296|ref|ZP_01128535.1| Glycoside hydrolase, family 3-like protein [Nitrococcus mobilis Nb-231] gi|88789468|gb|EAR20596.1| Glycoside hydrolase, family 3-like protein [Nitrococcus mobilis Nb-231] Length = 337 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L +G++++F+PVLD+ G I F R + + R + Sbjct: 102 MAAELRAAGVDLSFAPVLDVERGVSRVIG--ERAFHRRAGAVADLTLSWVRGMRQ 154 >gi|332687330|ref|YP_004457103.1| beta-hexosamidase A [Melissococcus plutonius ATCC 35311] gi|332371339|dbj|BAK22294.1| beta-hexosamidase A [Melissococcus plutonius ATCC 35311] Length = 567 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N++F+P++D+ I F + + A+ + KN Sbjct: 130 EASQVGCNMSFAPIVDIDKNFRNPITNT-RTFGSDKTRVMKMAEAQIKGLEKN 181 >gi|294340980|emb|CAZ89375.1| Beta-hexosaminidase (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) [Thiomonas sp. 3As] Length = 361 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 +A L G++ +F+PVLDL +G + I F AQ Sbjct: 111 LASELRACGVDFSFTPVLDLDWGGSSVIG--DRAFHADARVVTVLAQSLM 158 >gi|296136811|ref|YP_003644053.1| glycoside hydrolase family 3 domain protein [Thiomonas intermedia K12] gi|295796933|gb|ADG31723.1| glycoside hydrolase family 3 domain protein [Thiomonas intermedia K12] Length = 361 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 +A L G++ +F+PVLDL +G + I F AQ Sbjct: 111 LASELRACGVDFSFTPVLDLDWGGSSVIG--DRAFHADARVVTVLAQSLM 158 >gi|116669071|ref|YP_830004.1| gluconate kinase [Arthrobacter sp. FB24] gi|116609180|gb|ABK01904.1| gluconate kinase, SKI family [Arthrobacter sp. FB24] Length = 779 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 G N F+P++D+ Y + F P E AQ + ++P Sbjct: 331 ETAALGCNWAFAPIVDIHYNWRNTVIST-RSFGNTPEIVVERAQEYFDGISESP 383 >gi|260549082|ref|ZP_05823303.1| beta-N-acetyl-D-glucosaminidase [Acinetobacter sp. RUH2624] gi|260407810|gb|EEX01282.1| beta-N-acetyl-D-glucosaminidase [Acinetobacter sp. RUH2624] Length = 339 Score = 51.7 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLDL I FS+ A F R K Sbjct: 106 MATEVLAVGIDFSFAPVLDLN-AISDVIG--DRGFSKNIEDIAPLAGAFMRGMKK 157 >gi|172039868|ref|YP_001799582.1| glycoside hydrolase family protein [Corynebacterium urealyticum DSM 7109] gi|171851172|emb|CAQ04148.1| putative glycoside hydrolase (family 3 protein) [Corynebacterium urealyticum DSM 7109] Length = 401 Score = 51.7 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 19/57 (33%), Gaps = 5/57 (8%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPE---TFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + G V+F+P +DL G I F P A+ + + Sbjct: 177 GRKMAELGFTVDFAPSIDLAGGENIEDNAIGS--RSFGSDPQVVARYARAYVEGLLD 231 >gi|118589117|ref|ZP_01546524.1| putative hydrolase glycosidase protein [Stappia aggregata IAM 12614] gi|118438446|gb|EAV45080.1| putative hydrolase glycosidase protein [Stappia aggregata IAM 12614] Length = 339 Score = 51.7 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 +A +L GI+V+ P LD+ + P+T A FS+ P + + Sbjct: 109 IADDLYQVGISVDCLPCLDVRF-PDTVDAIGDRAFSQDPEVVATLGKAMAEG 159 >gi|239500774|ref|ZP_04660084.1| beta-hexosaminidase [Acinetobacter baumannii AB900] Length = 339 Score = 51.7 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLDL I FS+ A F R K Sbjct: 106 MATEVLAVGIDFSFAPVLDLN-AISDVIG--DRGFSKNIEDIAPLAGAFMRGMKK 157 >gi|299771626|ref|YP_003733652.1| beta-hexosaminidase [Acinetobacter sp. DR1] gi|298701714|gb|ADI92279.1| beta-hexosaminidase [Acinetobacter sp. DR1] Length = 339 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLDL I FS+ A F + K Sbjct: 106 MATEVLAVGIDFSFAPVLDLN-AISDVIG--DRGFSKNIEDIAPLAGAFMQGMKK 157 >gi|153009676|ref|YP_001370891.1| beta-N-acetylhexosaminidase [Ochrobactrum anthropi ATCC 49188] gi|151561564|gb|ABS15062.1| Beta-N-acetylhexosaminidase [Ochrobactrum anthropi ATCC 49188] Length = 339 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+NV+ PVLD+ + +S+ P E + + + Sbjct: 112 AFDLLKVGVNVDCLPVLDVPVEGAHDVIGA-RAYSKNPQAVAEMGRAAAEGLL 163 >gi|94311349|ref|YP_584559.1| beta-hexosaminidase [Cupriavidus metallidurans CH34] gi|93355201|gb|ABF09290.1| beta N-acetyl-glucosaminidase [Cupriavidus metallidurans CH34] Length = 349 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L I+++F+PVLDL YG I F P A + + Sbjct: 115 LAAELRACDIDLSFTPVLDLDYGRSGVIG--DRAFHADPRVVTMLANHLTHGLL 166 >gi|83748438|ref|ZP_00945460.1| Anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Ralstonia solanacearum UW551] gi|207725210|ref|YP_002255606.1| hexosaminidase protein [Ralstonia solanacearum MolK2] gi|207743585|ref|YP_002259977.1| hexosaminidase protein [Ralstonia solanacearum IPO1609] gi|83724849|gb|EAP72005.1| Anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Ralstonia solanacearum UW551] gi|206590444|emb|CAQ37406.1| hexosaminidase protein [Ralstonia solanacearum MolK2] gi|206594984|emb|CAQ61911.1| hexosaminidase protein [Ralstonia solanacearum IPO1609] Length = 350 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQ 47 +A L I+++F+PVLDL YG + I F R P A Sbjct: 116 LAAELRACDIDLSFTPVLDLDYGTSSVIG--DRAFHRDPRVVTMLAN 160 >gi|326316032|ref|YP_004233704.1| glycoside hydrolase family 3 domain-containing protein [Acidovorax avenae subsp. avenae ATCC 19860] gi|323372868|gb|ADX45137.1| glycoside hydrolase family 3 domain protein [Acidovorax avenae subsp. avenae ATCC 19860] Length = 379 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 14/65 (21%), Positives = 24/65 (36%), Gaps = 11/65 (16%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETF----------IAQKRSIFSRIPAKAEESAQLFS 50 +A L G++ +F+PVLDL + + F R P A+ + Sbjct: 120 LASELRACGVDFSFAPVLDLDWPSGGKGPSGSASASSVIG-DRSFHRDPRVVAMLARSVA 178 Query: 51 RTYIK 55 +K Sbjct: 179 HGMLK 183 >gi|260556134|ref|ZP_05828353.1| beta-N-acetyl-D-glucosaminidase [Acinetobacter baumannii ATCC 19606] gi|260410189|gb|EEX03488.1| beta-N-acetyl-D-glucosaminidase [Acinetobacter baumannii ATCC 19606] Length = 339 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLDL I FS+ A F R K Sbjct: 106 MATEVLAVGIDFSFAPVLDLN-AISDVIG--DRGFSKNIEDIAPLAGAFMRGMKK 157 >gi|270487788|ref|ZP_06204862.1| glycosyl hydrolase family 3 N-terminal domain protein [Yersinia pestis KIM D27] gi|270336292|gb|EFA47069.1| glycosyl hydrolase family 3 N-terminal domain protein [Yersinia pestis KIM D27] Length = 234 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + GI+ F+P+LD+ P + P + A + + Sbjct: 133 IAREAASLGIHWTFAPMLDIARDPR--WGRTIETSGEDPWLTAQFAAAVVKGFQ 184 >gi|186896919|ref|YP_001874031.1| glycoside hydrolase family 3 protein [Yersinia pseudotuberculosis PB1/+] gi|186699945|gb|ACC90574.1| glycoside hydrolase family 3 domain protein [Yersinia pseudotuberculosis PB1/+] Length = 727 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + GI+ F+P+LD+ P + P + A + + Sbjct: 133 IAREAASLGIHWTFAPMLDIARDPR--WGRTIETSGEDPWLTAQFAAAVVKGFQ 184 >gi|145597713|ref|YP_001161789.1| glycosyl hydrolase [Yersinia pestis Pestoides F] gi|145209409|gb|ABP38816.1| glycosyl hydrolase [Yersinia pestis Pestoides F] Length = 727 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + GI+ F+P+LD+ P + P + A + + Sbjct: 133 IAREAASLGIHWTFAPMLDIARDPR--WGRTIETSGEDPWLTAQFAAAVVKGFQ 184 >gi|51597736|ref|YP_071927.1| glycosyl hydrolase [Yersinia pseudotuberculosis IP 32953] gi|170022844|ref|YP_001719349.1| glycoside hydrolase family 3 protein [Yersinia pseudotuberculosis YPIII] gi|51591018|emb|CAH22677.1| Putative glycosyl hydrolase [Yersinia pseudotuberculosis IP 32953] gi|169749378|gb|ACA66896.1| glycoside hydrolase family 3 domain protein [Yersinia pseudotuberculosis YPIII] Length = 727 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + GI+ F+P+LD+ P + P + A + + Sbjct: 133 IAREAASLGIHWTFAPMLDIARDPR--WGRTIETSGEDPWLTAQFAAAVVKGFQ 184 >gi|153948774|ref|YP_001399525.1| periplasmic beta-glucosidase [Yersinia pseudotuberculosis IP 31758] gi|152960269|gb|ABS47730.1| putative periplasmic beta-glucosidase [Yersinia pseudotuberculosis IP 31758] Length = 727 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + GI+ F+P+LD+ P + P + A + + Sbjct: 133 IAREAASLGIHWTFAPMLDIARDPR--WGRTIETSGEDPWLTAQFAAAVVKGFQ 184 >gi|22127435|ref|NP_670858.1| glycosidase [Yersinia pestis KIM 10] gi|45442699|ref|NP_994238.1| putative glycosyl hydrolase [Yersinia pestis biovar Microtus str. 91001] gi|108809165|ref|YP_653081.1| putative glycosyl hydrolase [Yersinia pestis Antiqua] gi|108810644|ref|YP_646411.1| glycosyl hydrolase [Yersinia pestis Nepal516] gi|150260351|ref|ZP_01917079.1| putative glycosyl hydrolase [Yersinia pestis CA88-4125] gi|165924924|ref|ZP_02220756.1| putative periplasmic beta-glucosidase [Yersinia pestis biovar Orientalis str. F1991016] gi|165937877|ref|ZP_02226438.1| putative periplasmic beta-glucosidase [Yersinia pestis biovar Orientalis str. IP275] gi|166008765|ref|ZP_02229663.1| putative periplasmic beta-glucosidase [Yersinia pestis biovar Antiqua str. E1979001] gi|166212242|ref|ZP_02238277.1| putative periplasmic beta-glucosidase [Yersinia pestis biovar Antiqua str. B42003004] gi|167398798|ref|ZP_02304322.1| putative periplasmic beta-glucosidase [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167422965|ref|ZP_02314718.1| putative periplasmic beta-glucosidase [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167426410|ref|ZP_02318163.1| putative periplasmic beta-glucosidase [Yersinia pestis biovar Mediaevalis str. K1973002] gi|167466767|ref|ZP_02331471.1| glycosyl hydrolase [Yersinia pestis FV-1] gi|218927810|ref|YP_002345685.1| putative glycosyl hydrolase [Yersinia pestis CO92] gi|229837292|ref|ZP_04457455.1| putative glycosyl hydrolase [Yersinia pestis Pestoides A] gi|229840507|ref|ZP_04460666.1| putative glycosyl hydrolase [Yersinia pestis biovar Orientalis str. PEXU2] gi|229842949|ref|ZP_04463100.1| putative glycosyl hydrolase [Yersinia pestis biovar Orientalis str. India 195] gi|229900837|ref|ZP_04515961.1| putative glycosyl hydrolase [Yersinia pestis Nepal516] gi|294502697|ref|YP_003566759.1| putative glycosyl hydrolase [Yersinia pestis Z176003] gi|21960526|gb|AAM87109.1|AE013958_6 glycosidase [Yersinia pestis KIM 10] gi|45437565|gb|AAS63115.1| putative glycosyl hydrolase [Yersinia pestis biovar Microtus str. 91001] gi|108774292|gb|ABG16811.1| glycosyl hydrolase [Yersinia pestis Nepal516] gi|108781078|gb|ABG15136.1| putative glycosyl hydrolase [Yersinia pestis Antiqua] gi|115346421|emb|CAL19293.1| putative glycosyl hydrolase [Yersinia pestis CO92] gi|149289759|gb|EDM39836.1| putative glycosyl hydrolase [Yersinia pestis CA88-4125] gi|165914289|gb|EDR32905.1| putative periplasmic beta-glucosidase [Yersinia pestis biovar Orientalis str. IP275] gi|165923124|gb|EDR40275.1| putative periplasmic beta-glucosidase [Yersinia pestis biovar Orientalis str. F1991016] gi|165992104|gb|EDR44405.1| putative periplasmic beta-glucosidase [Yersinia pestis biovar Antiqua str. E1979001] gi|166206988|gb|EDR51468.1| putative periplasmic beta-glucosidase [Yersinia pestis biovar Antiqua str. B42003004] gi|166957128|gb|EDR55149.1| putative periplasmic beta-glucosidase [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167051302|gb|EDR62710.1| putative periplasmic beta-glucosidase [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167054633|gb|EDR64440.1| putative periplasmic beta-glucosidase [Yersinia pestis biovar Mediaevalis str. K1973002] gi|229682176|gb|EEO78268.1| putative glycosyl hydrolase [Yersinia pestis Nepal516] gi|229690015|gb|EEO82073.1| putative glycosyl hydrolase [Yersinia pestis biovar Orientalis str. India 195] gi|229696873|gb|EEO86920.1| putative glycosyl hydrolase [Yersinia pestis biovar Orientalis str. PEXU2] gi|229705415|gb|EEO91425.1| putative glycosyl hydrolase [Yersinia pestis Pestoides A] gi|262360726|gb|ACY57447.1| putative glycosyl hydrolase [Yersinia pestis D106004] gi|262364673|gb|ACY61230.1| putative glycosyl hydrolase [Yersinia pestis D182038] gi|294353156|gb|ADE63497.1| putative glycosyl hydrolase [Yersinia pestis Z176003] gi|320016823|gb|ADW00395.1| putative glycosyl hydrolase [Yersinia pestis biovar Medievalis str. Harbin 35] Length = 727 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + GI+ F+P+LD+ P + P + A + + Sbjct: 133 IAREAASLGIHWTFAPMLDIARDPR--WGRTIETSGEDPWLTAQFAAAVVKGFQ 184 >gi|167009145|ref|ZP_02274076.1| glycosyl hydrolase family 3 [Francisella tularensis subsp. holarctica FSC200] gi|254367306|ref|ZP_04983332.1| glycosyl hydrolase [Francisella tularensis subsp. holarctica 257] gi|134253122|gb|EBA52216.1| glycosyl hydrolase [Francisella tularensis subsp. holarctica 257] Length = 347 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MAK + GIN+N +P +D+ I + FS + A LF + K Sbjct: 115 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEK 169 >gi|46128035|ref|XP_388571.1| hypothetical protein FG08395.1 [Gibberella zeae PH-1] Length = 924 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A + G+N+ PVLD+L P + + R Sbjct: 123 ATEISACGVNLMLGPVLDVLNNARYQPLGV-RATGDDPQEVSQYGLAALRGIRD 175 >gi|224457774|ref|ZP_03666247.1| glycosy hydrolase family protein [Francisella tularensis subsp. tularensis MA00-2987] gi|254371223|ref|ZP_04987225.1| hypothetical protein [Francisella tularensis subsp. tularensis FSC033] gi|254875454|ref|ZP_05248164.1| glycosyl hydrolase [Francisella tularensis subsp. tularensis MA00-2987] gi|151569463|gb|EDN35117.1| hypothetical protein FTBG_00992 [Francisella tularensis subsp. tularensis FSC033] gi|254841453|gb|EET19889.1| glycosyl hydrolase [Francisella tularensis subsp. tularensis MA00-2987] gi|282159820|gb|ADA79211.1| glycosyl hydrolase family 3 [Francisella tularensis subsp. tularensis NE061598] Length = 347 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MAK + GIN+N +P +D+ I + FS + A LF + K Sbjct: 115 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEK 169 >gi|115314432|ref|YP_763155.1| glycosyl hydrolase [Francisella tularensis subsp. holarctica OSU18] gi|156501943|ref|YP_001428008.1| glycosy hydrolase family protein [Francisella tularensis subsp. holarctica FTNF002-00] gi|290954606|ref|ZP_06559227.1| glycosy hydrolase family protein [Francisella tularensis subsp. holarctica URFT1] gi|295311949|ref|ZP_06802773.1| glycosy hydrolase family protein [Francisella tularensis subsp. holarctica URFT1] gi|115129331|gb|ABI82518.1| probable glycosyl hydrolase [Francisella tularensis subsp. holarctica OSU18] gi|156252546|gb|ABU61052.1| glycosyl hydrolase family 3 [Francisella tularensis subsp. holarctica FTNF002-00] Length = 347 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MAK + GIN+N +P +D+ I + FS + A LF + K Sbjct: 115 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEK 169 >gi|332668610|ref|YP_004451617.1| glycoside hydrolase family 3 domain-containing protein [Cellulomonas fimi ATCC 484] gi|332337647|gb|AEE44230.1| glycoside hydrolase family 3 domain protein [Cellulomonas fimi ATCC 484] Length = 405 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G++V+ +PVLDL GP + FS P +A F+ Sbjct: 161 GERLAEIGVDVDLAPVLDLDDGPWAGVIG-DRSFSADPERAARYGLAFAAGLDD 213 >gi|323694482|ref|ZP_08108652.1| glycosyl hydrolase domain-containing protein [Clostridium symbiosum WAL-14673] gi|323501470|gb|EGB17362.1| glycosyl hydrolase domain-containing protein [Clostridium symbiosum WAL-14673] Length = 410 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L G N++F+PV D+L PE + R F A + + + Sbjct: 195 IGTYLADLGFNMDFAPVADVLTNPENTVV-ARRSFGTDEAVTAAFSNEVVKGLQAH 249 >gi|322506714|gb|ADX02168.1| nagZ [Acinetobacter baumannii 1656-2] Length = 350 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLDL I FS+ A F R K Sbjct: 117 MATEVLAVGIDFSFAPVLDLN-AISDVIG--DRGFSKNIEDIAPLAGAFMRGMKK 168 >gi|148255780|ref|YP_001240365.1| putative sugar hydrolase/beta-N-acetylhexosaminidase [Bradyrhizobium sp. BTAi1] gi|146407953|gb|ABQ36459.1| putative sugar hydrolase/Beta-N-acetylhexosaminidase [Bradyrhizobium sp. BTAi1] Length = 342 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A +L GI V+ P+ D+ + + PAK A+ + + Sbjct: 110 IADDLQQLGITVDCLPLADVPVAGADAVIG-DRAYGTTPAKVAAIARAVTDGLEQ 163 >gi|254374863|ref|ZP_04990344.1| hypothetical protein FTDG_01041 [Francisella novicida GA99-3548] gi|151572582|gb|EDN38236.1| hypothetical protein FTDG_01041 [Francisella novicida GA99-3548] Length = 347 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MAK + GIN+N +P +D+ I + FS + A LF + K Sbjct: 115 MAKTMYKVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEK 169 >gi|296453835|ref|YP_003660978.1| family 3 glycoside hydrolase domain-containing protein [Bifidobacterium longum subsp. longum JDM301] gi|296183266|gb|ADH00148.1| glycoside hydrolase, family 3 domain protein [Bifidobacterium longum subsp. longum JDM301] Length = 419 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 16/57 (28%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDL---LYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L T+GINV+ +PVL I F A E Sbjct: 196 GSQLATAGINVDLAPVLGTVVGNRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLRD 252 >gi|169797252|ref|YP_001715045.1| beta-hexosaminidase [Acinetobacter baumannii AYE] gi|213155954|ref|YP_002317999.1| N-acetyl-beta-glucosaminidase [Acinetobacter baumannii AB0057] gi|215484693|ref|YP_002326928.1| Beta-hexosaminidase(N-acetyl-beta-glucosaminidase) [Acinetobacter baumannii AB307-0294] gi|301346473|ref|ZP_07227214.1| beta-hexosaminidase [Acinetobacter baumannii AB056] gi|301510165|ref|ZP_07235402.1| beta-hexosaminidase [Acinetobacter baumannii AB058] gi|301594222|ref|ZP_07239230.1| beta-hexosaminidase [Acinetobacter baumannii AB059] gi|332851243|ref|ZP_08433316.1| beta-L-N-acetylhexosaminidase [Acinetobacter baumannii 6013150] gi|332866098|ref|ZP_08436826.1| beta-L-N-acetylhexosaminidase [Acinetobacter baumannii 6013113] gi|169150179|emb|CAM88073.1| beta-N-acetyl-D-glucosaminidase [Acinetobacter baumannii AYE] gi|213055114|gb|ACJ40016.1| N-acetyl-beta-glucosaminidase [Acinetobacter baumannii AB0057] gi|213988842|gb|ACJ59141.1| Beta-hexosaminidase(N-acetyl-beta-glucosaminidase) [Acinetobacter baumannii AB307-0294] gi|332730123|gb|EGJ61450.1| beta-L-N-acetylhexosaminidase [Acinetobacter baumannii 6013150] gi|332734844|gb|EGJ65937.1| beta-L-N-acetylhexosaminidase [Acinetobacter baumannii 6013113] Length = 339 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLDL I FS+ A F R K Sbjct: 106 MATEVLAVGIDFSFAPVLDLN-AISDVIG--DRGFSKNIEDIAPLAGAFMRGMKK 157 >gi|126640563|ref|YP_001083547.1| beta-hexosaminidase [Acinetobacter baumannii ATCC 17978] Length = 310 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLDL I FS+ A F R K Sbjct: 77 MATEVLAVGIDFSFAPVLDLN-AISDVIG--DRGFSKNIEDIAPLAGAFMRGMKK 128 >gi|300704602|ref|YP_003746205.1| beta-hexosaminidase [Ralstonia solanacearum CFBP2957] gi|299072266|emb|CBJ43599.1| Beta-hexosaminidase; N-acetyl-beta-glucosaminidase; Beta-N-acetylhexosaminidase [Ralstonia solanacearum CFBP2957] Length = 350 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQ 47 +A L I+++F+PVLDL YG + I F R P A Sbjct: 116 LAAELRACDIDLSFTPVLDLDYGTSSVIG--DRAFHRDPRVVTMLAN 160 >gi|257064936|ref|YP_003144608.1| beta-glucosidase-like glycosyl hydrolase [Slackia heliotrinireducens DSM 20476] gi|256792589|gb|ACV23259.1| beta-glucosidase-like glycosyl hydrolase [Slackia heliotrinireducens DSM 20476] Length = 412 Score = 51.3 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 20/57 (35%), Gaps = 6/57 (10%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQK--RSIFSRIPAKAEESAQLFSRTYIK 55 +A L G N++F+P D+ + F P + + +++ Sbjct: 198 IAGYLKPLGFNMDFAPCCDI----ANVEGGVMAQRSFGSDPELVSDMVEAQIEGFVE 250 >gi|332969242|gb|EGK08270.1| beta-N-acetylhexosaminidase [Kingella kingae ATCC 23330] Length = 360 Score = 51.3 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L G+N++F+PVLDL +G I F + PA + A + Sbjct: 113 LATELAACGVNLSFTPVLDLNWGQCAVIG--NRSFHKQPAIVLDLALALQKGLN 164 >gi|251782765|ref|YP_002997068.1| glycosyl hydrolase [Streptococcus dysgalactiae subsp. equisimilis GGS_124] gi|242391395|dbj|BAH81854.1| glycosyl hydrolase, family 3 [Streptococcus dysgalactiae subsp. equisimilis GGS_124] Length = 598 Score = 51.3 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N +F+P++DL I + + ++ + R +++ Sbjct: 138 EAAAVGCNASFAPIVDLTRNWRNPIIAS-RNWGSNVDQIITLSKEYMRGIMEH 189 >gi|58197418|dbj|BAD88640.1| hypothetical protein [Streptococcus suis] Length = 462 Score = 51.3 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+NVNF P +D++ I + + Sbjct: 137 AREETALGVNVNFDPCVDIVQNWRNTIVNT-RAYGTNADDVITYTSAYLEGL 187 >gi|110634161|ref|YP_674369.1| glycoside hydrolase family protein [Mesorhizobium sp. BNC1] gi|110285145|gb|ABG63204.1| glycoside hydrolase, family 3-like protein [Chelativorans sp. BNC1] Length = 343 Score = 51.3 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L + GI+ + PVLD+ + + + P + + + Sbjct: 116 AFDLASHGISADCLPVLDVPVPGAHDVIG-NRAYGQDPETVAVLGRAAADGLL 167 >gi|134095248|ref|YP_001100323.1| beta N-acetyl-glucosaminidase [Herminiimonas arsenicoxydans] gi|133739151|emb|CAL62200.1| Beta-hexosaminidase (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) [Herminiimonas arsenicoxydans] Length = 357 Score = 51.3 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L G++++F+PVLDL YG I F R A+ Sbjct: 122 LAAELRACGVDLSFTPVLDLDYGASGVIG--DRAFHRDARVVSLLAKS 167 >gi|254517755|ref|ZP_05129811.1| beta-hexosamidase A [Clostridium sp. 7_2_43FAA] gi|226911504|gb|EEH96705.1| beta-hexosamidase A [Clostridium sp. 7_2_43FAA] Length = 589 Score = 51.3 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 8/49 (16%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 G N +F+P++D+ I +S + E + + + Sbjct: 130 EASAIGCNWSFAPIVDINRNWRNPIIST-RTWSADVEQTLELSLQYMKG 177 >gi|150003325|ref|YP_001298069.1| glycoside hydrolase family beta-glycosidase [Bacteroides vulgatus ATCC 8482] gi|149931749|gb|ABR38447.1| glycoside hydrolase family 3, candidate beta-glycosidase [Bacteroides vulgatus ATCC 8482] Length = 757 Score = 51.3 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + GI+ SPV D+ + + P E F + Y K Sbjct: 152 GEEAKAIGIHQILSPVFDIARELR--WGRIEETYGEDPYLIAEMGVAFIKGYQK 203 >gi|328958402|ref|YP_004375788.1| beta-N-acetylglucosaminidase/beta-glucosidase [Carnobacterium sp. 17-4] gi|328674726|gb|AEB30772.1| beta-N-acetylglucosaminidase/beta-glucosidase [Carnobacterium sp. 17-4] Length = 573 Score = 51.3 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + V GINVNF P +D+L I + + + Sbjct: 137 GREEVAMGINVNFDPCVDILQNWRNTIVNT-RAYGTNADNVIKYTNAYLEGL 187 >gi|296119065|ref|ZP_06837637.1| glycosyl hydrolase, family 3 [Corynebacterium ammoniagenes DSM 20306] gi|295967900|gb|EFG81153.1| glycosyl hydrolase, family 3 [Corynebacterium ammoniagenes DSM 20306] Length = 335 Score = 51.3 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++L GI V+F+PV+D+ G + FS+ P A + F+R Sbjct: 117 IGQSLSAHGITVDFAPVIDVDGGGLEVVG--DRSFSQDPRLAGDYGAAFARGLQ 168 >gi|293610288|ref|ZP_06692589.1| conserved hypothetical protein [Acinetobacter sp. SH024] gi|292827520|gb|EFF85884.1| conserved hypothetical protein [Acinetobacter sp. SH024] Length = 339 Score = 51.3 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLDL I FS+ A F + K Sbjct: 106 MATEVLAVGIDFSFAPVLDLN-AISDVIG--DRGFSKTIEDIAPLAGAFMQGMKK 157 >gi|302920617|ref|XP_003053110.1| glycoside hydrolase family 3 [Nectria haematococca mpVI 77-13-4] gi|256734050|gb|EEU47397.1| glycoside hydrolase family 3 [Nectria haematococca mpVI 77-13-4] Length = 946 Score = 51.3 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A + G+N+ PVLD+L P + + R Sbjct: 129 ATEISACGVNLMLGPVLDVLNNARYQPLGV-RATGDDPQEVSQYGLAALRGIRD 181 >gi|225859880|ref|YP_002741390.1| beta-N-acetylglucosaminidase/beta-glucosidase (3-beta-N-acetyl-D-glucosaminidase/beta-D- glucosidase)(Nag3) [Streptococcus pneumoniae 70585] gi|225721249|gb|ACO17103.1| beta-N-acetylglucosaminidase/beta-glucosidase (3-beta-N-acetyl-D-glucosaminidase/beta-D- glucosidase)(Nag3) [Streptococcus pneumoniae 70585] Length = 574 Score = 51.3 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+NVNF P +D++ I + + Sbjct: 137 AREETALGVNVNFDPCVDIVQNWRNTIVNT-RAYGTNADDVIAYTSAYLEGL 187 >gi|302518381|ref|ZP_07270723.1| O-glycosyl hydrolase family 3 protein [Streptomyces sp. SPB78] gi|302427276|gb|EFK99091.1| O-glycosyl hydrolase family 3 protein [Streptomyces sp. SPB78] Length = 411 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 7/45 (15%), Positives = 15/45 (33%), Gaps = 1/45 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEES 45 +A+ + G ++ PV D+ P + + P Sbjct: 9 IAQEVRAYGADLVLGPVADVNADPANPVIGV-RSYGVDPHLVGRH 52 >gi|300691967|ref|YP_003752962.1| beta-hexosaminidase; N-acetyl-beta-glucosaminidase; beta-N-acetylhexosaminidase [Ralstonia solanacearum PSI07] gi|299079027|emb|CBJ51689.1| Beta-hexosaminidase; N-acetyl-beta-glucosaminidase; Beta-N-acetylhexosaminidase [Ralstonia solanacearum PSI07] Length = 350 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQ 47 +A L I+++F+PVLDL YG + I F R P A Sbjct: 116 LAAELRACDIDLSFTPVLDLDYGASSVIG--DRAFHRDPRVVTMLAN 160 >gi|332993554|gb|AEF03609.1| beta-hexosaminidase [Alteromonas sp. SN2] Length = 356 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L I+ +F+PVLD+ G I F+ K A Sbjct: 129 MAHELKQIDIDFSFAPVLDIN-GVSKVIG--DRAFAETAEKVIPLASALIEGLQ 179 >gi|322412072|gb|EFY02980.1| glycosyl hydrolase family protein [Streptococcus dysgalactiae subsp. dysgalactiae ATCC 27957] Length = 596 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N +F+P++DL I + + ++ + R +++ Sbjct: 133 EAAAVGCNASFAPIVDLTRNWRNPIIAS-RNWGSNVDQIITLSKEYMRGIMEH 184 >gi|319441522|ref|ZP_07990678.1| putative beta-glucosidase-related glycosidase [Corynebacterium variabile DSM 44702] Length = 429 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 5/56 (8%) Query: 2 AKNLVTSGINVNFSPVLDLLYG---PETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ L GI V+F+P +DL G + I FS PA E + + Sbjct: 192 ARKLRDLGITVDFAPDVDLDGGEAVSDNAIG--DRAFSTDPAVVVEYGRAVIDGLL 245 >gi|325566953|ref|ZP_08143731.1| beta-N-acetylglucosaminidase/beta-glucosidase [Enterococcus casseliflavus ATCC 12755] gi|325159125|gb|EGC71270.1| beta-N-acetylglucosaminidase/beta-glucosidase [Enterococcus casseliflavus ATCC 12755] Length = 568 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 GIN+ FSP++D+ Y + I F + AQ + + Sbjct: 130 EAARIGINMAFSPIVDIDYNFKNPITNT-RTFGSDQKRIIRMAQAQIDGFSE 180 >gi|323127609|gb|ADX24906.1| glycosyl hydrolase family protein [Streptococcus dysgalactiae subsp. equisimilis ATCC 12394] Length = 596 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N +F+P++DL I + + ++ + R +++ Sbjct: 133 EAAAVGCNASFAPIVDLTRNWRNPIIAS-RNWGSNVDQIITLSKEYMRGIMEH 184 >gi|296268768|ref|YP_003651400.1| family 3 glycoside hydrolase domain-containing protein [Thermobispora bispora DSM 43833] gi|296091555|gb|ADG87507.1| glycoside hydrolase family 3 domain protein [Thermobispora bispora DSM 43833] Length = 420 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L GI V+F+PV D+ + + P + + Sbjct: 174 GEELRDLGIAVDFAPVADVSAKGS---FIRSRAYGSDPKLVSAMVRAAVEGFH 223 >gi|262043195|ref|ZP_06016331.1| beta-hexosaminidase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|259039473|gb|EEW40608.1| beta-hexosaminidase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] Length = 336 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I + P KA A+ F Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHEDPQKALTMARHFIDGMH 150 >gi|238894140|ref|YP_002918874.1| beta-hexosaminidase [Klebsiella pneumoniae NTUH-K2044] gi|238546456|dbj|BAH62807.1| beta-hexosaminidase [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] Length = 340 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I + P KA A+ F Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHEDPQKALTMARHFIDGMH 154 >gi|206576496|ref|YP_002239275.1| beta-N-acetylhexosaminidase [Klebsiella pneumoniae 342] gi|226724440|sp|B5XXG4|NAGZ_KLEP3 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|206565554|gb|ACI07330.1| beta-N-acetylhexosaminidase [Klebsiella pneumoniae 342] Length = 340 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I + P KA A+ F Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHEDPQKALTMARHFIDGMH 154 >gi|152969658|ref|YP_001334767.1| beta-hexosaminidase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|329999526|ref|ZP_08303446.1| beta-L-N-acetylhexosaminidase [Klebsiella sp. MS 92-3] gi|150954507|gb|ABR76537.1| beta-hexosaminidase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|328538296|gb|EGF64436.1| beta-L-N-acetylhexosaminidase [Klebsiella sp. MS 92-3] Length = 336 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I + P KA A+ F Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHEDPQKALTMARHFIDGMH 150 >gi|118468598|ref|YP_889390.1| xylosidase/arabinosidase [Mycobacterium smegmatis str. MC2 155] gi|118169885|gb|ABK70781.1| xylosidase/arabinosidase [Mycobacterium smegmatis str. MC2 155] Length = 815 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ G++ SPVLD++ + P + Sbjct: 182 IGRDMAALGVHQGLSPVLDVVRDYR--WGRVEETMGEDPYVVSTLGAAYIEGLQ 233 >gi|167769497|ref|ZP_02441550.1| hypothetical protein ANACOL_00831 [Anaerotruncus colihominis DSM 17241] gi|167668465|gb|EDS12595.1| hypothetical protein ANACOL_00831 [Anaerotruncus colihominis DSM 17241] Length = 555 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 9/36 (25%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFS 36 + + L GIN N +PV D+ P + + Sbjct: 144 IGQELRAVGINCNLAPVADINSNPANPVIGT-RSYG 178 >gi|15601936|ref|NP_245008.1| beta-hexosaminidase [Pasteurella multocida subsp. multocida str. Pm70] gi|13959408|sp|Q9CPH0|NAGZ_PASMU RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|12720279|gb|AAK02155.1| unknown [Pasteurella multocida subsp. multocida str. Pm70] Length = 351 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + GI+++F+PVLDL + + F A F + Sbjct: 105 MAAEMTALGIDLSFAPVLDLGHQCQAI---GDRSFHSQAEMTLNLASAFIDGMHQ 156 >gi|333030627|ref|ZP_08458688.1| Beta-glucosidase [Bacteroides coprosuis DSM 18011] gi|332741224|gb|EGJ71706.1| Beta-glucosidase [Bacteroides coprosuis DSM 18011] Length = 789 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ + GI+ F+P++D+ + P A E + + Sbjct: 180 AREARSVGIHWTFAPMMDISRDAR--WGRVAESLGEDPYLAAELGLAMVKGFQD 231 >gi|323485491|ref|ZP_08090837.1| glycosyl hydrolase domain-containing protein [Clostridium symbiosum WAL-14163] gi|323401139|gb|EGA93491.1| glycosyl hydrolase domain-containing protein [Clostridium symbiosum WAL-14163] Length = 439 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L G N++F+PV D+L PE + R F A + + + Sbjct: 224 IGTYLADLGFNMDFAPVADVLTNPENTVV-ARRSFGTDGAVTAAFSNEVVKGLQAH 278 >gi|227821930|ref|YP_002825900.1| glycosyl hydrolase [Sinorhizobium fredii NGR234] gi|227340929|gb|ACP25147.1| glycosyl hydrolase [Sinorhizobium fredii NGR234] Length = 338 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ GI V+ PVLD+ + + PA + Sbjct: 112 AFDLMRFGITVDCLPVLDVPVPGSHDVIG-NRAYGHDPATVTAIGRAVGEGLK 163 >gi|302551582|ref|ZP_07303924.1| beta-N-acetylglucosaminidase [Streptomyces viridochromogenes DSM 40736] gi|302469200|gb|EFL32293.1| beta-N-acetylglucosaminidase [Streptomyces viridochromogenes DSM 40736] Length = 611 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 10/38 (26%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIP 39 L GI ++SPV D+ P + F P Sbjct: 185 GAELRAMGIRQDYSPVADVNVNPANPVIGV-RSFGADP 221 >gi|192291565|ref|YP_001992170.1| beta-N-acetylhexosaminidase [Rhodopseudomonas palustris TIE-1] gi|192285314|gb|ACF01695.1| Beta-N-acetylhexosaminidase [Rhodopseudomonas palustris TIE-1] Length = 341 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A +L GI V+ P+ D+ + + P K A+ + Sbjct: 110 IADDLAALGITVDCLPLADVPITGADAVIG-DRAYGTSPDKVAAIARAVTDGL 161 >gi|297539078|ref|YP_003674847.1| glycoside hydrolase family 3 domain-containing protein [Methylotenera sp. 301] gi|297258425|gb|ADI30270.1| glycoside hydrolase family 3 domain protein [Methylotenera sp. 301] Length = 359 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+ +F+PVLD+ YG I F P + A + K Sbjct: 119 LAAELRAHGIDFSFTPVLDMDYGDSLVIG--DRAFHLKPQAINDLAFSLMQGLKK 171 >gi|42525216|ref|NP_970596.1| Beta-hexosamidase A precursor [Bdellovibrio bacteriovorus HD100] gi|39577427|emb|CAE81250.1| Beta-hexosamidase A precursor [Bdellovibrio bacteriovorus HD100] Length = 558 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 13/51 (25%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Query: 5 LVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G N+N +PVLD++ T F P + +S+ +K Sbjct: 159 LREVGFNMNLAPVLDVVDPYSTSFIGV-RSFGSDPELVRDIGVAYSKGLLK 208 >gi|119718732|ref|YP_925697.1| glycoside hydrolase family 3 protein [Nocardioides sp. JS614] gi|119539393|gb|ABL84010.1| glycoside hydrolase, family 3 domain protein [Nocardioides sp. JS614] Length = 388 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 10/59 (16%), Positives = 18/59 (30%), Gaps = 5/59 (8%) Query: 2 AKNLVTSGINVNFSPVLDLLYGP-----ETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L +G+N++ +PV+D + I + F F Sbjct: 164 AGQLRRAGVNLDLAPVMDTVPSRRAARHNPPIGRYDREFGFTTKVVARHGVAFLNGMAD 222 >gi|325124468|gb|ADY83991.1| beta-N-acetyl-D-glucosaminidase [Acinetobacter calcoaceticus PHEA-2] Length = 339 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLDL I FS+ A F + K Sbjct: 106 MATEVLAVGIDFSFAPVLDLN-AISDVIG--DRGFSKNIDDIAPLAGAFMQGMKK 157 >gi|222085782|ref|YP_002544312.1| beta-N-acetylhexosaminidase protein [Agrobacterium radiobacter K84] gi|221723230|gb|ACM26386.1| beta-N-acetylhexosaminidase protein [Agrobacterium radiobacter K84] Length = 337 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ GIN + PVLD+ + + + P E + + Sbjct: 111 AFDLLKFGINADCLPVLDVPVEGSSNVIG-NRAYGGDPVTVTEMGRAAADGLK 162 >gi|313904834|ref|ZP_07838206.1| glycoside hydrolase family 3 domain protein [Eubacterium cellulosolvens 6] gi|313470267|gb|EFR65597.1| glycoside hydrolase family 3 domain protein [Eubacterium cellulosolvens 6] Length = 454 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN + +P D+L P + + F PA E A + + Sbjct: 226 IGTYLSELGINFDLAPCADVLVDPSNT-SMAQRSFGSDPAVVSEMAISEMQGLEE 279 >gi|268609652|ref|ZP_06143379.1| glycoside hydrolase family 3 domain protein [Ruminococcus flavefaciens FD-1] Length = 452 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A ++ G +++F+PV D P+ + +S + R + + Sbjct: 237 LAGDIGQFGFDLDFAPVADTWSNPDNKVIGT-RAYSDDFEETAMLVGAAVRGFRE 290 >gi|238789098|ref|ZP_04632887.1| Beta-hexosaminidase [Yersinia frederiksenii ATCC 33641] gi|238722862|gb|EEQ14513.1| Beta-hexosaminidase [Yersinia frederiksenii ATCC 33641] Length = 341 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA +++ I+++F+PVLD+ + I F P +A + A+ F R Sbjct: 104 MAAEMISMDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQAMKMAECFIRGMH 154 >gi|146318807|ref|YP_001198519.1| beta-glucosidase-related glycosidase [Streptococcus suis 05ZYH33] gi|146321016|ref|YP_001200727.1| Beta-glucosidase-related glycosidase [Streptococcus suis 98HAH33] gi|253751896|ref|YP_003025037.1| glycosyl hydrolase family protein [Streptococcus suis SC84] gi|253753719|ref|YP_003026860.1| glycosyl hydrolase family protein [Streptococcus suis P1/7] gi|145689613|gb|ABP90119.1| Beta-glucosidase-related glycosidase [Streptococcus suis 05ZYH33] gi|145691822|gb|ABP92327.1| Beta-glucosidase-related glycosidase [Streptococcus suis 98HAH33] gi|251816185|emb|CAZ51812.1| glycosyl hydrolase family protein [Streptococcus suis SC84] gi|251819965|emb|CAR46092.1| glycosyl hydrolase family protein [Streptococcus suis P1/7] gi|292558471|gb|ADE31472.1| Glycoside hydrolase, family 3 [Streptococcus suis GZ1] gi|319758257|gb|ADV70199.1| Beta-glucosidase-related glycosidase [Streptococcus suis JS14] Length = 574 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+NVNF P +D++ I + + Sbjct: 137 AREETALGVNVNFDPCVDIVQNWRNTIVNT-RAYGTNADDVITYTSAYLEGL 187 >gi|39935917|ref|NP_948193.1| beta-N-acetylhexosaminidase [Rhodopseudomonas palustris CGA009] gi|39649771|emb|CAE28293.1| putative sugar hydrolase [Rhodopseudomonas palustris CGA009] Length = 341 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A +L GI V+ P+ D+ + + P K A+ + Sbjct: 110 IADDLAALGITVDCLPLADVPITGADAVIG-DRAYGTSPDKVAAIARAVTDGL 161 >gi|331682613|ref|ZP_08383232.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli H299] gi|331080244|gb|EGI51423.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli H299] Length = 341 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHSDPEKALAIASRFIDGMHE 155 >gi|284039050|ref|YP_003388980.1| glycoside hydrolase [Spirosoma linguale DSM 74] gi|283818343|gb|ADB40181.1| glycoside hydrolase family 3 domain protein [Spirosoma linguale DSM 74] Length = 1002 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +AK G++VNF+P +D+ P F A + R N Sbjct: 155 LAKQARRLGMHVNFAPSVDVNNNPNNP-VINFRSFGEDKYAVARKALAYMRGMQDN 209 >gi|152979829|ref|YP_001353065.1| beta-N-acetylhexosaminidase [Janthinobacterium sp. Marseille] gi|151279906|gb|ABR88316.1| beta-N-acetylhexosaminidase [Janthinobacterium sp. Marseille] Length = 350 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 +A L G++++F+PVLDL YG I F R A+ Sbjct: 115 LAAELRACGVDLSFTPVLDLDYGESGVIG--DRAFHRDARVVTMLAKS 160 >gi|223933627|ref|ZP_03625606.1| glycoside hydrolase family 3 domain protein [Streptococcus suis 89/1591] gi|302023913|ref|ZP_07249124.1| glycosyl hydrolase family protein [Streptococcus suis 05HAS68] gi|223897701|gb|EEF64083.1| glycoside hydrolase family 3 domain protein [Streptococcus suis 89/1591] Length = 574 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+NVNF P +D++ I + + + Sbjct: 137 AREETALGVNVNFDPCVDIVQNWRNTIVNT-RAYGTNADDVIAYTSAYLKGL 187 >gi|212712817|ref|ZP_03320945.1| hypothetical protein PROVALCAL_03914 [Providencia alcalifaciens DSM 30120] gi|212684509|gb|EEB44037.1| hypothetical protein PROVALCAL_03914 [Providencia alcalifaciens DSM 30120] Length = 341 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLDL + IA F P A A+ F R Sbjct: 104 MAAEMIAMDIDISFAPVLDLGHES---IAIGERSFHADPEIAMTMAERFIRGMR 154 >gi|330955323|gb|EGH55583.1| beta-hexosaminidase [Pseudomonas syringae Cit 7] Length = 230 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 2 EVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPQRAALLAGAFIRGMN 50 >gi|316933989|ref|YP_004108971.1| glycoside hydrolase family 3 domain-containing protein [Rhodopseudomonas palustris DX-1] gi|315601703|gb|ADU44238.1| glycoside hydrolase family 3 domain protein [Rhodopseudomonas palustris DX-1] Length = 341 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A +L GI V+ P+ D+ + + P K A+ S Sbjct: 110 IADDLAALGITVDCLPLADVPVAGADAVIG-DRAYGTTPNKVATIARAVSDGL 161 >gi|163790523|ref|ZP_02184953.1| hypothetical protein CAT7_09920 [Carnobacterium sp. AT7] gi|159874276|gb|EDP68350.1| hypothetical protein CAT7_09920 [Carnobacterium sp. AT7] Length = 573 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + G+NVNF P +D+L I + + + Sbjct: 137 GREEAAMGVNVNFDPCVDILKNWRNTIVNT-RAYGTNADDVIKYTNAYLEGL 187 >gi|253755402|ref|YP_003028542.1| glycosyl hydrolase family protein [Streptococcus suis BM407] gi|251817866|emb|CAZ55620.1| glycosyl hydrolase family protein [Streptococcus suis BM407] Length = 574 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+NVNF P +D++ I + + Sbjct: 137 AREETALGVNVNFDPCVDIVQNWRNTIVNT-RAYGTNADDVITYTSAYLEGL 187 >gi|330832961|ref|YP_004401786.1| glycoside hydrolase family 3 domain-containing protein [Streptococcus suis ST3] gi|329307184|gb|AEB81600.1| glycoside hydrolase family 3 domain protein [Streptococcus suis ST3] Length = 574 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G+NVNF P +D++ I + + + Sbjct: 137 AREETALGVNVNFDPCVDIVQNWRNTIVNT-RAYGTNADDVIAYTSAYLKGL 187 >gi|153006911|ref|YP_001381236.1| glycoside hydrolase family 3 protein [Anaeromyxobacter sp. Fw109-5] gi|152030484|gb|ABS28252.1| glycoside hydrolase family 3 domain protein [Anaeromyxobacter sp. Fw109-5] Length = 455 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +++ GIN + PVLD+ P+ +++ P + ++R Sbjct: 205 DMLALGINCSLGPVLDV--SPDGLMSRTGRSLGGEPDHVARLGRAYARGLR 253 >gi|294636067|ref|ZP_06714499.1| beta-hexosaminidase [Edwardsiella tarda ATCC 23685] gi|291090623|gb|EFE23184.1| beta-hexosaminidase [Edwardsiella tarda ATCC 23685] Length = 340 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL +G F R P +A A+ F + Sbjct: 100 MACEMIAMDIDLSFAPVLDLGHGSAAI---GERAFHRQPEQAIPLAEAFIDGMHQ 151 >gi|123442008|ref|YP_001005991.1| beta-hexosaminidase [Yersinia enterocolitica subsp. enterocolitica 8081] gi|166233261|sp|A1JME4|NAGZ_YERE8 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|122088969|emb|CAL11780.1| beta-hexosaminidase [Yersinia enterocolitica subsp. enterocolitica 8081] Length = 341 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA +++ I+++F+PVLD+ + I F P +A + A+ F R Sbjct: 104 MAAEMISMDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQALKMAECFIRGMH 154 >gi|329297183|ref|ZP_08254519.1| beta-hexosaminidase [Plautia stali symbiont] Length = 338 Score = 50.5 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I F PA A + A+ F + Sbjct: 100 MAAEMIAMDIDISFAPVLDIGH-ISAAIG--DRAFHADPAIALQMARQFIHGMHE 151 >gi|237799457|ref|ZP_04587918.1| beta-hexosaminidase [Pseudomonas syringae pv. oryzae str. 1_6] gi|331022313|gb|EGI02370.1| beta-hexosaminidase [Pseudomonas syringae pv. oryzae str. 1_6] Length = 230 Score = 50.5 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 ++ G++++F+PVLDL Y + F P +A A F R Sbjct: 2 EVLAVGLDLSFAPVLDLDYQRSAVVGT--RSFEGDPERAALLAGAFIRGMN 50 >gi|261346032|ref|ZP_05973676.1| beta-hexosaminidase [Providencia rustigianii DSM 4541] gi|282565918|gb|EFB71453.1| beta-hexosaminidase [Providencia rustigianii DSM 4541] Length = 341 Score = 50.5 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLDL + IA F P A A+ F R Sbjct: 104 MASEMIAMDIDISFAPVLDLGHES---IAIGERSFHADPEIAMVMAERFIRGMH 154 >gi|90415946|ref|ZP_01223879.1| putative beta-glucosidase [marine gamma proteobacterium HTCC2207] gi|90332320|gb|EAS47517.1| putative beta-glucosidase [marine gamma proteobacterium HTCC2207] Length = 771 Score = 50.5 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ + +G + +F+P +D+ P + F P E + Sbjct: 173 AREMRATGSHWSFTPNVDIARDPR--WGRVGETFGEDPFLVAEMGVATIEGLQQ 224 >gi|290510816|ref|ZP_06550186.1| beta-hexosaminidase [Klebsiella sp. 1_1_55] gi|289777532|gb|EFD85530.1| beta-hexosaminidase [Klebsiella sp. 1_1_55] Length = 340 Score = 50.5 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I + P KA A+ F Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHEDPQKALAIARHFIDGMH 154 >gi|288936130|ref|YP_003440189.1| glycoside hydrolase [Klebsiella variicola At-22] gi|288890839|gb|ADC59157.1| glycoside hydrolase family 3 domain protein [Klebsiella variicola At-22] Length = 340 Score = 50.5 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I + P KA A+ F Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHEDPQKALAIARHFIDGMH 154 >gi|227547799|ref|ZP_03977848.1| beta-N-acetylglucosaminidase family protein [Corynebacterium lipophiloflavum DSM 44291] gi|227080092|gb|EEI18055.1| beta-N-acetylglucosaminidase family protein [Corynebacterium lipophiloflavum DSM 44291] Length = 385 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + ++L G+NV+++P+LDL I F P LFS+ I Sbjct: 161 IGRSLRERGVNVDYAPLLDLDVTGLNIIG--DRSFGAEPGDVARVGGLFSQGLID 213 >gi|296102875|ref|YP_003613021.1| beta-hexosaminidase [Enterobacter cloacae subsp. cloacae ATCC 13047] gi|295057334|gb|ADF62072.1| beta-hexosaminidase [Enterobacter cloacae subsp. cloacae ATCC 13047] Length = 337 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P A E A F Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHSDPRIALEMATRFIDGMHD 151 >gi|238910971|ref|ZP_04654808.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191] Length = 337 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + PAKA A F Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPAKALAMATRFIDGMHD 151 >gi|89068218|ref|ZP_01155628.1| Putative Glycoside hydrolase [Oceanicola granulosus HTCC2516] gi|89046135|gb|EAR52193.1| Putative Glycoside hydrolase [Oceanicola granulosus HTCC2516] Length = 329 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ L GI+VN +P+ DL+ + + R E+A++ + + Sbjct: 105 IAEELHAVGIDVNCAPLADLVEDDTHPV-LLNRLSGRDVDTVVEAARVCADALLD 158 >gi|224584285|ref|YP_002638083.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|224468812|gb|ACN46642.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|312912197|dbj|BAJ36171.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240] gi|322616584|gb|EFY13493.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 315996572] gi|322619901|gb|EFY16775.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-1] gi|322622469|gb|EFY19314.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-3] gi|322629414|gb|EFY26191.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-4] gi|322636845|gb|EFY33548.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-2] gi|322641355|gb|EFY37994.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 531954] gi|322645119|gb|EFY41648.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. NC_MB110209-0054] gi|322652284|gb|EFY48640.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. OH_2009072675] gi|322655635|gb|EFY51937.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. CASC_09SCPH15965] gi|322660940|gb|EFY57170.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 19N] gi|322665475|gb|EFY61663.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 81038-01] gi|322667548|gb|EFY63709.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. MD_MDA09249507] gi|322673657|gb|EFY69759.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 414877] gi|322677583|gb|EFY73647.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 366867] gi|322679752|gb|EFY75791.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 413180] gi|322687224|gb|EFY83196.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 446600] gi|323194011|gb|EFZ79212.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 609458-1] gi|323199420|gb|EFZ84513.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 556150-1] gi|323202435|gb|EFZ87477.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 609460] gi|323208852|gb|EFZ93790.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20] gi|323210274|gb|EFZ95171.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 556152] gi|323217826|gb|EGA02541.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. MB101509-0077] gi|323221686|gb|EGA06098.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. MB102109-0047] gi|323226290|gb|EGA10503.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. MB110209-0055] gi|323229628|gb|EGA13751.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. MB111609-0052] gi|323232853|gb|EGA16949.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 2009083312] gi|323240111|gb|EGA24155.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 2009085258] gi|323242902|gb|EGA26923.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 315731156] gi|323246817|gb|EGA30787.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2009159199] gi|323254282|gb|EGA38099.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008282] gi|323255549|gb|EGA39308.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008283] gi|323261599|gb|EGA45176.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008284] gi|323266977|gb|EGA50462.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008285] gi|323272081|gb|EGA55495.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008287] gi|326623677|gb|EGE30022.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Dublin str. 3246] Length = 337 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + PAKA A F Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPAKALAMATRFIDGMHD 151 >gi|205360757|ref|ZP_02686256.2| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|205347224|gb|EDZ33855.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] Length = 341 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + PAKA A F Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPAKALAMATRFIDGMHD 155 >gi|85716511|ref|ZP_01047482.1| glycoside hydrolase, family 3 [Nitrobacter sp. Nb-311A] gi|85696700|gb|EAQ34587.1| glycoside hydrolase, family 3 [Nitrobacter sp. Nb-311A] Length = 341 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A +L GI V+ P+ D+ + + P K A+ + Sbjct: 110 IAADLADLGITVDCLPLADVPVPGADAVIG-DRAYGADPHKVAIIARTVADGL 161 >gi|325678857|ref|ZP_08158455.1| glycosyl hydrolase family 3 N-terminal domain protein [Ruminococcus albus 8] gi|324109361|gb|EGC03579.1| glycosyl hydrolase family 3 N-terminal domain protein [Ruminococcus albus 8] Length = 440 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A ++ G N++F+PV D P + + +S ++ + + Sbjct: 222 IANDIAALGFNLDFAPVADTWSNPNNTVIGR-RAYSDSFSETATLVASAVKGFGD 275 >gi|262274214|ref|ZP_06052026.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) [Grimontia hollisae CIP 101886] gi|262222024|gb|EEY73337.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) [Grimontia hollisae CIP 101886] Length = 334 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++F+PVLD G + F + F + + Sbjct: 101 MAAELMAHDIDISFAPVLD--RGFDCKAIGS-RAFGEDNDTVIRYSTAFMKGMKE 152 >gi|195874187|ref|ZP_02701008.2| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Newport str. SL317] gi|195630428|gb|EDX49054.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Newport str. SL317] Length = 341 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + PAKA A F Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPAKALAMATRFIDGMHD 155 >gi|16764564|ref|NP_460179.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|62179729|ref|YP_216146.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|161614564|ref|YP_001588529.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|194444486|ref|YP_002040463.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194450323|ref|YP_002045208.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194470983|ref|ZP_03076967.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|194734950|ref|YP_002114214.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197248771|ref|YP_002146833.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197266052|ref|ZP_03166126.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|197301160|ref|ZP_02664170.2| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|198243937|ref|YP_002215929.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|200389418|ref|ZP_03216029.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|205353056|ref|YP_002226857.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|205357745|ref|ZP_02573106.2| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|205358661|ref|ZP_02658145.2| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|205359356|ref|ZP_02669211.2| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] gi|205360071|ref|ZP_02834312.2| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|207857284|ref|YP_002243935.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|21362701|sp|Q8ZQ06|NAGZ_SALTY RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|75483970|sp|Q57QE6|NAGZ_SALCH RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|189030784|sp|A9N5J6|NAGZ_SALPB RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724444|sp|B5F8E5|NAGZ_SALA4 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724445|sp|B5FK98|NAGZ_SALDC RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724446|sp|B5QXC7|NAGZ_SALEP RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724447|sp|B5RB93|NAGZ_SALG2 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724448|sp|B4TFI4|NAGZ_SALHS RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724449|sp|B4T3P6|NAGZ_SALNS RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724450|sp|B4TTH9|NAGZ_SALSV RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|16419726|gb|AAL20138.1| putative glycosyl hydrolase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|62127362|gb|AAX65065.1| putative glycosyl hydrolase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|161363928|gb|ABX67696.1| hypothetical protein SPAB_02313 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|194403149|gb|ACF63371.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194408627|gb|ACF68846.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194457347|gb|EDX46186.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|194710452|gb|ACF89673.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197212474|gb|ACH49871.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197244307|gb|EDY26927.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|197288110|gb|EDY27497.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|197938453|gb|ACH75786.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|199601863|gb|EDZ00409.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|205272837|emb|CAR37764.1| putative glycosyl hydrolase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|205329796|gb|EDZ16560.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|205332704|gb|EDZ19468.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|205336778|gb|EDZ23542.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] gi|205341270|gb|EDZ28034.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|206709087|emb|CAR33420.1| putative glycosyl hydrolase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|261246421|emb|CBG24230.1| Beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580] gi|267992985|gb|ACY87870.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S] gi|301157750|emb|CBW17242.1| Beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344] gi|320086351|emb|CBY96124.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1] gi|321223825|gb|EFX48888.1| Beta N-acetyl-glucosaminidase [Salmonella enterica subsp. enterica serovar Typhimurium str. TN061786] gi|322714199|gb|EFZ05770.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Choleraesuis str. A50] gi|323129478|gb|ADX16908.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhimurium str. 4/74] gi|326628135|gb|EGE34478.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Gallinarum str. 9] gi|332988100|gb|AEF07083.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1] Length = 341 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + PAKA A F Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPAKALAMATRFIDGMHD 155 >gi|317968063|ref|ZP_07969453.1| putative beta-glucosidase [Synechococcus sp. CB0205] Length = 529 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 15/53 (28%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G+N PV D+ P + + A A F R Sbjct: 124 GRQARLLGLNWVLGPVCDVNNNPSNPVINV-RAWGETARTAGALAAAFVRGCQ 175 >gi|159044275|ref|YP_001533069.1| beta-hexosamidase [Dinoroseobacter shibae DFL 12] gi|157912035|gb|ABV93468.1| beta-hexosamidase [Dinoroseobacter shibae DFL 12] Length = 328 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A +L GI+VN +P+ D+ I + + A +A+ + Sbjct: 103 IALDLAEVGIDVNCAPLADIALPETHPI-LRNRCYGTDVATVVANARAMADGLR 155 >gi|331652159|ref|ZP_08353178.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli M718] gi|331050437|gb|EGI22495.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli M718] Length = 341 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 155 >gi|312971243|ref|ZP_07785421.1| beta-hexosaminidase [Escherichia coli 1827-70] gi|310336445|gb|EFQ01631.1| beta-hexosaminidase [Escherichia coli 1827-70] Length = 336 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 99 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 150 >gi|300859355|ref|YP_003784338.1| hypothetical protein cpfrc_01938 [Corynebacterium pseudotuberculosis FRC41] gi|300686809|gb|ADK29731.1| putative secreted protein [Corynebacterium pseudotuberculosis FRC41] Length = 394 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M +L+ G+ VNF+PV D+ + FS P E A F++ + Sbjct: 178 MGDSLLAHGVTVNFAPVADID-AGLDVVG--DRAFSADPNIDAEYATAFAQGMLD 229 >gi|300918714|ref|ZP_07135292.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 115-1] gi|300414149|gb|EFJ97459.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 115-1] Length = 337 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 151 >gi|261493639|ref|ZP_05990158.1| beta-N-acetylhexosaminidase [Mannheimia haemolytica serotype A2 str. BOVINE] gi|261494409|ref|ZP_05990898.1| beta-N-acetylhexosaminidase [Mannheimia haemolytica serotype A2 str. OVINE] gi|261309935|gb|EEY11149.1| beta-N-acetylhexosaminidase [Mannheimia haemolytica serotype A2 str. OVINE] gi|261310639|gb|EEY11823.1| beta-N-acetylhexosaminidase [Mannheimia haemolytica serotype A2 str. BOVINE] Length = 345 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F + P A+ F ++ Sbjct: 103 MAAEMFALDIDLSFAPVLDLGHECKAI---GDRSFGKDPYTILPIAEAFIDGMLE 154 >gi|204930846|ref|ZP_03221719.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] gi|204320305|gb|EDZ05509.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] Length = 341 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + PAKA A F Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPAKALAMATRFIDGMHD 155 >gi|82544425|ref|YP_408372.1| beta-hexosaminidase [Shigella boydii Sb227] gi|187730351|ref|YP_001880722.1| beta-hexosaminidase [Shigella boydii CDC 3083-94] gi|97180228|sp|Q31ZG4|NAGZ_SHIBS RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724451|sp|B2U513|NAGZ_SHIB3 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|81245836|gb|ABB66544.1| conserved hypothetical protein [Shigella boydii Sb227] gi|187427343|gb|ACD06617.1| beta-N-acetylhexosaminidase [Shigella boydii CDC 3083-94] gi|320175614|gb|EFW50706.1| Beta N-acetyl-glucosaminidase [Shigella dysenteriae CDC 74-1112] gi|320184234|gb|EFW59048.1| Beta N-acetyl-glucosaminidase [Shigella flexneri CDC 796-83] gi|332094443|gb|EGI99492.1| beta-hexosaminidase [Shigella boydii 3594-74] Length = 341 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 155 >gi|56413806|ref|YP_150881.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|197362729|ref|YP_002142366.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] gi|213161674|ref|ZP_03347384.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhi str. E00-7866] gi|213420280|ref|ZP_03353346.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhi str. E01-6750] gi|213611253|ref|ZP_03370079.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhi str. E98-2068] gi|213649264|ref|ZP_03379317.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhi str. J185] gi|213857240|ref|ZP_03384211.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhi str. M223] gi|289829618|ref|ZP_06547173.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhi str. E98-3139] gi|56128063|gb|AAV77569.1| putative glycosyl hydrolase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|197094206|emb|CAR59710.1| putative glycosyl hydrolase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] Length = 337 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + PAKA A F Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPAKALAMATRFIDGMHD 151 >gi|320664506|gb|EFX31657.1| beta-hexosaminidase [Escherichia coli O157:H7 str. LSU-61] Length = 337 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 151 >gi|318606135|emb|CBY27633.1| beta N-acetyl-glucosaminidase [Yersinia enterocolitica subsp. palearctica Y11] Length = 337 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA +++ I+++F+PVLD+ + I F P +A + A+ F R Sbjct: 100 MAAEMISMDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQALKMAECFIRGMH 150 >gi|261226989|ref|ZP_05941270.1| beta-N-acetylglucosaminidase [Escherichia coli O157:H7 str. FRIK2000] gi|261256223|ref|ZP_05948756.1| beta-N-acetylglucosaminidase [Escherichia coli O157:H7 str. FRIK966] gi|320637558|gb|EFX07358.1| beta-hexosaminidase [Escherichia coli O157:H7 str. G5101] Length = 337 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 151 >gi|217077140|ref|YP_002334856.1| beta-N-acetylglucosaminidase CbsA [Thermosipho africanus TCF52B] gi|217036993|gb|ACJ75515.1| beta-N-acetylglucosaminidase CbsA [Thermosipho africanus TCF52B] Length = 444 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L G N+ F+PV+D+ + + + +S + A F R+ + Sbjct: 98 LAHMLKLHGFNMVFAPVVDVKHEKSSHVTGF-RAYSDDHEIIKMRALEFIRSLLD 151 >gi|205357397|ref|ZP_02347380.2| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|205321956|gb|EDZ09795.1| beta-N-acetylhexosaminidase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] Length = 341 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + PAKA A F Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPAKALAMATRFIDGMHD 155 >gi|170768290|ref|ZP_02902743.1| beta-N-acetylhexosaminidase [Escherichia albertii TW07627] gi|170123056|gb|EDS91987.1| beta-N-acetylhexosaminidase [Escherichia albertii TW07627] Length = 341 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 155 >gi|115377594|ref|ZP_01464791.1| beta-N-acetylhexosaminidase [Stigmatella aurantiaca DW4/3-1] gi|310820439|ref|YP_003952797.1| glycoside hydrolase [Stigmatella aurantiaca DW4/3-1] gi|115365395|gb|EAU64433.1| beta-N-acetylhexosaminidase [Stigmatella aurantiaca DW4/3-1] gi|309393511|gb|ADO70970.1| Glycoside hydrolase family 3 domain protein [Stigmatella aurantiaca DW4/3-1] Length = 368 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K + G+N+N +PV D+ P+ + + FS PA ++ A F+R K Sbjct: 149 GKAMQEVGLNMNLAPVFDV--APQGHMFRNGRAFSGDPAVVKKKATAFARGLAK 200 >gi|302207037|gb|ADL11379.1| Beta-N-acetylglucosaminidase [Corynebacterium pseudotuberculosis C231] gi|308277290|gb|ADO27189.1| Beta-N-acetylglucosaminidase [Corynebacterium pseudotuberculosis I19] Length = 427 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M +L+ G+ VNF+PV D+ + FS P E A F++ + Sbjct: 211 MGDSLLAHGVTVNFAPVADID-AGLDVVG--DRAFSADPNIDAEYATAFAQGMLD 262 >gi|213692710|ref|YP_002323296.1| glycoside hydrolase, family 3 domain protein [Bifidobacterium longum subsp. infantis ATCC 15697] gi|213524171|gb|ACJ52918.1| glycoside hydrolase, family 3 domain protein [Bifidobacterium longum subsp. infantis ATCC 15697] gi|320458866|dbj|BAJ69487.1| putative beta-hexosaminidase [Bifidobacterium longum subsp. infantis ATCC 15697] Length = 401 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 15/56 (26%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDL---LYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L +GINV+ +PVL I F A E Sbjct: 178 GSQLAAAGINVDLAPVLGTVVGDRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLR 233 >gi|320643119|gb|EFX12320.1| beta-hexosaminidase [Escherichia coli O157:H- str. 493-89] gi|320648577|gb|EFX17232.1| beta-hexosaminidase [Escherichia coli O157:H- str. H 2687] Length = 337 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 151 >gi|16760084|ref|NP_455701.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|29142145|ref|NP_805487.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|21362695|sp|Q8Z7I6|NAGZ_SALTI RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|97180219|sp|Q5PGT0|NAGZ_SALPA RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|25511790|pir||AB0644 probable glycosyl hydrolase STY1249 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gi|16502378|emb|CAD08333.1| putative glycosyl hydrolase [Salmonella enterica subsp. enterica serovar Typhi] gi|29137774|gb|AAO69336.1| putative glycosyl hydrolase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] Length = 341 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + PAKA A F Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPAKALAMATRFIDGMHD 155 >gi|330860668|emb|CBX70962.1| beta-hexosaminidase [Yersinia enterocolitica W22703] Length = 337 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA +++ I+++F+PVLD+ + I F P +A + A+ F R Sbjct: 100 MAAEMISMDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQALKMAECFIRGMH 150 >gi|293409473|ref|ZP_06653049.1| beta-hexosaminidase [Escherichia coli B354] gi|301023313|ref|ZP_07187108.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 69-1] gi|291469941|gb|EFF12425.1| beta-hexosaminidase [Escherichia coli B354] gi|300397082|gb|EFJ80620.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 69-1] Length = 337 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 151 >gi|294651539|ref|ZP_06728848.1| beta-hexosaminidase [Acinetobacter haemolyticus ATCC 19194] gi|292822562|gb|EFF81456.1| beta-hexosaminidase [Acinetobacter haemolyticus ATCC 19194] Length = 340 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLDL I F++ A F R K Sbjct: 106 MATEVLAVGIDFSFAPVLDLN-DVSDVIG--DRGFAKNMQDIVPLADAFMRGMKK 157 >gi|15801224|ref|NP_287241.1| beta-hexosaminidase [Escherichia coli O157:H7 EDL933] gi|15830739|ref|NP_309512.1| beta-hexosaminidase [Escherichia coli O157:H7 str. Sakai] gi|187776316|ref|ZP_02801805.2| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4196] gi|188025143|ref|ZP_02776366.2| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4113] gi|189010668|ref|ZP_02808484.2| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4076] gi|189402505|ref|ZP_02782828.2| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4401] gi|189403577|ref|ZP_02796339.2| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4486] gi|189404504|ref|ZP_02789904.2| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4501] gi|189405393|ref|ZP_02815092.2| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC869] gi|189406285|ref|ZP_02827516.2| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC508] gi|208808547|ref|ZP_03250884.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4206] gi|208815385|ref|ZP_03256564.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4045] gi|208822112|ref|ZP_03262431.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4042] gi|209396392|ref|YP_002269952.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4115] gi|217328050|ref|ZP_03444132.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. TW14588] gi|254792490|ref|YP_003077327.1| beta-hexosaminidase [Escherichia coli O157:H7 str. TW14359] gi|13959407|sp|P58067|NAGZ_ECO57 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724431|sp|B5YVX6|NAGZ_ECO5E RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|12514654|gb|AAG55853.1|AE005320_7 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933] gi|13360949|dbj|BAB34908.1| beta-N-acetylglucosaminedase [Escherichia coli O157:H7 str. Sakai] gi|187767887|gb|EDU31731.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4196] gi|188014595|gb|EDU52717.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4113] gi|188999176|gb|EDU68162.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4076] gi|189355245|gb|EDU73664.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4401] gi|189359836|gb|EDU78255.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4486] gi|189365189|gb|EDU83605.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4501] gi|189370378|gb|EDU88794.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC869] gi|189375518|gb|EDU93934.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC508] gi|208728348|gb|EDZ77949.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4206] gi|208732033|gb|EDZ80721.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4045] gi|208737597|gb|EDZ85280.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4042] gi|209157792|gb|ACI35225.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. EC4115] gi|209773070|gb|ACI84847.1| beta-N-acetylglucosaminedase [Escherichia coli] gi|209773072|gb|ACI84848.1| beta-N-acetylglucosaminedase [Escherichia coli] gi|209773076|gb|ACI84850.1| beta-N-acetylglucosaminedase [Escherichia coli] gi|217318477|gb|EEC26903.1| beta-N-acetylhexosaminidase [Escherichia coli O157:H7 str. TW14588] gi|254591890|gb|ACT71251.1| beta-N-acetylglucosaminidase [Escherichia coli O157:H7 str. TW14359] gi|320188114|gb|EFW62779.1| Beta N-acetyl-glucosaminidase [Escherichia coli O157:H7 str. EC1212] gi|326339330|gb|EGD63144.1| Beta N-acetyl-glucosaminidase [Escherichia coli O157:H7 str. 1125] gi|326340411|gb|EGD64214.1| Beta N-acetyl-glucosaminidase [Escherichia coli O157:H7 str. 1044] Length = 341 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 155 >gi|332162087|ref|YP_004298664.1| beta-hexosaminidase [Yersinia enterocolitica subsp. palearctica 105.5R(r)] gi|325666317|gb|ADZ42961.1| beta-hexosaminidase [Yersinia enterocolitica subsp. palearctica 105.5R(r)] Length = 341 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA +++ I+++F+PVLD+ + I F P +A + A+ F R Sbjct: 104 MAAEMISMDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQALKMAECFIRGMH 154 >gi|323976520|gb|EGB71608.1| glycosyl hydrolase 3 domain-containing protein [Escherichia coli TW10509] Length = 337 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 151 >gi|323967048|gb|EGB62474.1| glycosyl hydrolase 3 domain-containing protein [Escherichia coli M863] gi|327253506|gb|EGE65144.1| beta-hexosaminidase [Escherichia coli STEC_7v] Length = 337 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 151 >gi|254482330|ref|ZP_05095570.1| Glycosyl hydrolase family 3 N terminal domain protein [marine gamma proteobacterium HTCC2148] gi|214037335|gb|EEB78002.1| Glycosyl hydrolase family 3 N terminal domain protein [marine gamma proteobacterium HTCC2148] Length = 607 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +G++ F+P L + + +S P + F Sbjct: 127 AKEILATGVDWTFAPTLAVARN--NLWGRTYESYSEDPDIVGAYSGAFVDGLQ 177 >gi|82777280|ref|YP_403629.1| beta-hexosaminidase [Shigella dysenteriae Sd197] gi|291282127|ref|YP_003498945.1| Beta-hexosaminidase [Escherichia coli O55:H7 str. CB9615] gi|309788179|ref|ZP_07682785.1| beta-hexosaminidase [Shigella dysenteriae 1617] gi|97180234|sp|Q32EW7|NAGZ_SHIDS RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|81241428|gb|ABB62138.1| conserved hypothetical protein [Shigella dysenteriae Sd197] gi|209773068|gb|ACI84846.1| beta-N-acetylglucosaminedase [Escherichia coli] gi|209773074|gb|ACI84849.1| beta-N-acetylglucosaminedase [Escherichia coli] gi|290762000|gb|ADD55961.1| Beta-hexosaminidase [Escherichia coli O55:H7 str. CB9615] gi|308924031|gb|EFP69532.1| beta-hexosaminidase [Shigella dysenteriae 1617] gi|320659371|gb|EFX26940.1| beta-hexosaminidase [Escherichia coli O55:H7 str. USDA 5905] Length = 341 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 155 >gi|302331597|gb|ADL21791.1| Beta-N-acetylglucosaminidase [Corynebacterium pseudotuberculosis 1002] Length = 410 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M +L+ G+ VNF+PV D+ + FS P E A F++ + Sbjct: 194 MGDSLLAHGVTVNFAPVADID-AGLDVVG--DRAFSADPNIDAEYATAFAQGMLD 245 >gi|120609888|ref|YP_969566.1| holo-acyl-carrier-protein synthase [Acidovorax citrulli AAC00-1] gi|120588352|gb|ABM31792.1| holo-acyl-carrier-protein synthase [Acidovorax citrulli AAC00-1] Length = 543 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/65 (21%), Positives = 25/65 (38%), Gaps = 11/65 (16%) Query: 1 MAKNLVTSGINVNFSPVLDLLYG----------PETFIAQKRSIFSRIPAKAEESAQLFS 50 +A L G++ +F+PVLDL + + + F R P A+ + Sbjct: 284 LASELRACGVDFSFAPVLDLDWPSGGDGSAGSASASSVIG-DRAFHRDPRVVAMLAKSVA 342 Query: 51 RTYIK 55 +K Sbjct: 343 HGMLK 347 >gi|300870257|ref|YP_003785128.1| putative anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Brachyspira pilosicoli 95/1000] gi|300687956|gb|ADK30627.1| putative anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Brachyspira pilosicoli 95/1000] Length = 344 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK L GIN+ P+ D+ +++I FS + + + Sbjct: 150 AKFLKDMGINMILGPLCDVPSNKDSYI--YNRSFSTNVEMVSKMVEATIKAQKD 201 >gi|323165616|gb|EFZ51403.1| beta-hexosaminidase [Shigella sonnei 53G] Length = 337 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 151 >gi|304413318|ref|ZP_07394791.1| glycosyl hydrolase domain-containing hypothetical protein [Candidatus Regiella insecticola LSR1] gi|304284161|gb|EFL92554.1| glycosyl hydrolase domain-containing hypothetical protein [Candidatus Regiella insecticola LSR1] Length = 353 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 25/55 (45%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M + LV +G+N NF+PV+DL PETFIA FS +P + E+AQL S+ + Sbjct: 116 MTETLVDAGVNTNFAPVVDLHR-PETFIAGAERSFSALPKEVAENAQLISQAHKN 169 >gi|74311668|ref|YP_310087.1| beta-hexosaminidase [Shigella sonnei Ss046] gi|97180241|sp|Q3Z310|NAGZ_SHISS RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|73855145|gb|AAZ87852.1| conserved hypothetical protein [Shigella sonnei Ss046] Length = 341 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|226953957|ref|ZP_03824421.1| beta-N-acetyl-D-glucosaminidase [Acinetobacter sp. ATCC 27244] gi|226835311|gb|EEH67694.1| beta-N-acetyl-D-glucosaminidase [Acinetobacter sp. ATCC 27244] Length = 340 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLDL I F++ A F R K Sbjct: 106 MATEVLAVGIDFSFAPVLDLN-DVSDVIG--DRGFAKNMQDIVPLADAFMRGMKK 157 >gi|300896868|ref|ZP_07115360.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 198-1] gi|300359313|gb|EFJ75183.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 198-1] gi|323190528|gb|EFZ75801.1| beta-hexosaminidase [Escherichia coli RN587/1] Length = 337 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 151 >gi|213029621|ref|ZP_03344068.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhi str. 404ty] Length = 114 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + PAKA A F Sbjct: 32 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPAKALAMATRFIDGMHD 83 >gi|300922634|ref|ZP_07138732.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 182-1] gi|300421042|gb|EFK04353.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 182-1] Length = 337 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 151 >gi|257052681|ref|YP_003130514.1| glycoside hydrolase family 3 domain protein [Halorhabdus utahensis DSM 12940] gi|256691444|gb|ACV11781.1| glycoside hydrolase family 3 domain protein [Halorhabdus utahensis DSM 12940] Length = 760 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + L G + SP+ D+ P + F P + F Sbjct: 130 IREQLRAIGAHHALSPLFDVARDPR--WGRTEETFGEDPYLVAKMGSAFVDGLQ 181 >gi|309796549|ref|ZP_07690956.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 145-7] gi|308119861|gb|EFO57123.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 145-7] gi|323185770|gb|EFZ71131.1| beta-hexosaminidase [Escherichia coli 1357] Length = 337 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 151 >gi|332184589|gb|AEE26843.1| Beta-hexosaminidase [Francisella cf. novicida 3523] Length = 378 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA+ + GIN+N +P +D+ I + FS + A LF + K Sbjct: 146 MAETMYKVGINLNLAPCVDIHNDNCPIIGKYERSFSTDVNTIVDCANLFCKATEK 200 >gi|254519961|ref|ZP_05132017.1| beta-N-acetylhexosaminidase [Clostridium sp. 7_2_43FAA] gi|226913710|gb|EEH98911.1| beta-N-acetylhexosaminidase [Clostridium sp. 7_2_43FAA] Length = 398 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ L + GIN+N +PV D+ P FI F + + + T +N Sbjct: 185 AELLKSIGINMNLAPVCDVSVNPNDFI--YPRTFGMNALETSKYIETVVNTMNEN 237 >gi|300902499|ref|ZP_07120480.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 84-1] gi|301305657|ref|ZP_07211746.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 124-1] gi|300405435|gb|EFJ88973.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 84-1] gi|300839085|gb|EFK66845.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 124-1] gi|315253908|gb|EFU33876.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 85-1] Length = 337 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 151 >gi|256023195|ref|ZP_05437060.1| beta-hexosaminidase [Escherichia sp. 4_1_40B] gi|300948695|ref|ZP_07162774.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 116-1] gi|300956229|ref|ZP_07168539.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 175-1] gi|301644522|ref|ZP_07244516.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 146-1] gi|307137742|ref|ZP_07497098.1| beta-hexosaminidase [Escherichia coli H736] gi|300316922|gb|EFJ66706.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 175-1] gi|300451818|gb|EFK15438.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 116-1] gi|301077154|gb|EFK91960.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 146-1] gi|315618279|gb|EFU98869.1| beta-hexosaminidase [Escherichia coli 3431] gi|323937847|gb|EGB34111.1| glycosyl hydrolase 3 domain-containing protein [Escherichia coli E1520] gi|323942576|gb|EGB38743.1| glycosyl hydrolase 3 domain-containing protein [Escherichia coli E482] Length = 337 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 151 >gi|117623292|ref|YP_852205.1| beta-hexosaminidase [Escherichia coli APEC O1] gi|166233255|sp|A1AA01|NAGZ_ECOK1 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|115512416|gb|ABJ00491.1| beta N-acetyl-glucosaminidase [Escherichia coli APEC O1] Length = 341 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|110805121|ref|YP_688641.1| beta-hexosaminidase [Shigella flexneri 5 str. 8401] gi|110614669|gb|ABF03336.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] gi|307627423|gb|ADN71727.1| beta-hexosaminidase [Escherichia coli UM146] gi|315287431|gb|EFU46842.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 110-3] gi|323953206|gb|EGB49072.1| glycosyl hydrolase 3 domain-containing protein [Escherichia coli H252] gi|323957932|gb|EGB53644.1| glycosyl hydrolase 3 domain-containing protein [Escherichia coli H263] gi|332758270|gb|EGJ88593.1| beta-hexosaminidase [Shigella flexneri 4343-70] gi|332767329|gb|EGJ97523.1| beta-hexosaminidase [Shigella flexneri 2930-71] gi|333004918|gb|EGK24438.1| beta-hexosaminidase [Shigella flexneri VA-6] Length = 337 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 151 >gi|315296635|gb|EFU55930.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 16-3] Length = 337 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 151 >gi|323163651|gb|EFZ49473.1| beta-hexosaminidase [Escherichia coli E128010] Length = 337 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 151 >gi|301328521|ref|ZP_07221585.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 78-1] gi|300845067|gb|EFK72827.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 78-1] gi|323175662|gb|EFZ61256.1| beta-hexosaminidase [Escherichia coli 1180] Length = 337 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 151 >gi|254422581|ref|ZP_05036299.1| Glycosyl hydrolase family 3 N terminal domain protein [Synechococcus sp. PCC 7335] gi|196190070|gb|EDX85034.1| Glycosyl hydrolase family 3 N terminal domain protein [Synechococcus sp. PCC 7335] Length = 567 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 7/44 (15%), Positives = 13/44 (29%), Gaps = 1/44 (2%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 G+N PV+D+ + + F + F Sbjct: 139 GLNWLLGPVVDVNNNLDNPVINV-RAFGEKANVVAKLTGSFIEG 181 >gi|333008314|gb|EGK27788.1| beta-hexosaminidase [Shigella flexneri K-272] gi|333019802|gb|EGK39074.1| beta-hexosaminidase [Shigella flexneri K-227] Length = 341 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|313650437|gb|EFS14844.1| beta-hexosaminidase [Shigella flexneri 2a str. 2457T] Length = 336 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 99 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 150 >gi|294657808|ref|XP_460108.2| DEHA2E18546p [Debaryomyces hansenii CBS767] gi|199432967|emb|CAG88375.2| DEHA2E18546p [Debaryomyces hansenii] Length = 1044 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L G ++ PVLD++ + F + + +R Sbjct: 119 IAIELKHIGFSIILGPVLDVVTKLSHQLVGV-RSFGTTVEDVTKYGKACARGLKD 172 >gi|191168586|ref|ZP_03030370.1| beta-N-acetylhexosaminidase [Escherichia coli B7A] gi|190901380|gb|EDV61145.1| beta-N-acetylhexosaminidase [Escherichia coli B7A] Length = 341 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|30062640|ref|NP_836811.1| beta-hexosaminidase [Shigella flexneri 2a str. 2457T] gi|30040886|gb|AAP16617.1| hypothetical protein S1191 [Shigella flexneri 2a str. 2457T] gi|281600523|gb|ADA73507.1| Beta-hexosaminidase [Shigella flexneri 2002017] gi|332761047|gb|EGJ91334.1| beta-hexosaminidase [Shigella flexneri K-671] gi|333019374|gb|EGK38657.1| beta-hexosaminidase [Shigella flexneri K-304] Length = 341 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|170683662|ref|YP_001744071.1| beta-hexosaminidase [Escherichia coli SMS-3-5] gi|218700391|ref|YP_002408020.1| beta-hexosaminidase [Escherichia coli IAI39] gi|218704518|ref|YP_002412037.1| beta-hexosaminidase [Escherichia coli UMN026] gi|293404396|ref|ZP_06648390.1| beta-hexosaminidase [Escherichia coli FVEC1412] gi|293414400|ref|ZP_06657049.1| beta-N-acetylhexosaminidase [Escherichia coli B185] gi|298380173|ref|ZP_06989778.1| beta-N-acetylhexosaminidase [Escherichia coli FVEC1302] gi|331662516|ref|ZP_08363439.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli TA143] gi|331672622|ref|ZP_08373411.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli TA280] gi|226724432|sp|B7NKH2|NAGZ_ECO7I RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724435|sp|B7NAY5|NAGZ_ECOLU RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724437|sp|B1LI37|NAGZ_ECOSM RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|170521380|gb|ACB19558.1| beta-N-acetylhexosaminidase [Escherichia coli SMS-3-5] gi|218370377|emb|CAR18180.1| beta N-acetyl-glucosaminidase [Escherichia coli IAI39] gi|218431615|emb|CAR12494.1| beta N-acetyl-glucosaminidase [Escherichia coli UMN026] gi|291428982|gb|EFF02007.1| beta-hexosaminidase [Escherichia coli FVEC1412] gi|291434458|gb|EFF07431.1| beta-N-acetylhexosaminidase [Escherichia coli B185] gi|298279871|gb|EFI21379.1| beta-N-acetylhexosaminidase [Escherichia coli FVEC1302] gi|331060938|gb|EGI32902.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli TA143] gi|331070265|gb|EGI41631.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli TA280] Length = 341 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 155 >gi|157157822|ref|YP_001462340.1| beta-hexosaminidase [Escherichia coli E24377A] gi|167012454|sp|A7ZKL1|NAGZ_ECO24 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|157079852|gb|ABV19560.1| beta-N-acetylhexosaminidase [Escherichia coli E24377A] Length = 341 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|320653891|gb|EFX21965.1| beta-hexosaminidase [Escherichia coli O55:H7 str. 3256-97 TW 07815] Length = 337 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 151 >gi|300816808|ref|ZP_07097028.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 107-1] gi|300821113|ref|ZP_07101262.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 119-7] gi|300526412|gb|EFK47481.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 119-7] gi|300530582|gb|EFK51644.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 107-1] gi|324017481|gb|EGB86700.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 117-3] Length = 337 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 151 >gi|24112512|ref|NP_707022.1| beta-hexosaminidase [Shigella flexneri 2a str. 301] gi|91210262|ref|YP_540248.1| beta-hexosaminidase [Escherichia coli UTI89] gi|218557988|ref|YP_002390901.1| beta-hexosaminidase [Escherichia coli S88] gi|237706907|ref|ZP_04537388.1| beta-hexosaminidase [Escherichia sp. 3_2_53FAA] gi|306814044|ref|ZP_07448217.1| beta-hexosaminidase [Escherichia coli NC101] gi|331646365|ref|ZP_08347468.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli M605] gi|47605827|sp|Q7UCW4|NAGZ_SHIFL RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|122424156|sp|Q1RD47|NAGZ_ECOUT RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724430|sp|B7MJ94|NAGZ_ECO45 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|24051402|gb|AAN42729.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] gi|91071836|gb|ABE06717.1| conserved hypothetical protein [Escherichia coli UTI89] gi|218364757|emb|CAR02447.1| beta N-acetyl-glucosaminidase [Escherichia coli S88] gi|226898117|gb|EEH84376.1| beta-hexosaminidase [Escherichia sp. 3_2_53FAA] gi|294492268|gb|ADE91024.1| beta-N-acetylhexosaminidase [Escherichia coli IHE3034] gi|305852681|gb|EFM53129.1| beta-hexosaminidase [Escherichia coli NC101] gi|330910923|gb|EGH39433.1| beta N-acetyl-glucosaminidase [Escherichia coli AA86] gi|331045117|gb|EGI17244.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli M605] gi|332759286|gb|EGJ89594.1| beta-hexosaminidase [Shigella flexneri 2747-71] gi|333005442|gb|EGK24960.1| beta-hexosaminidase [Shigella flexneri K-218] Length = 341 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|300938675|ref|ZP_07153402.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 21-1] gi|300456391|gb|EFK19884.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 21-1] Length = 337 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 151 >gi|160901716|ref|YP_001567297.1| glycoside hydrolase family 3 protein [Petrotoga mobilis SJ95] gi|160359360|gb|ABX30974.1| glycoside hydrolase family 3 domain protein [Petrotoga mobilis SJ95] Length = 777 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + GI+ SPV+D+ P + F P + + + Sbjct: 136 IRNQMKALGIHQGLSPVVDVTRDPR--WGRTEETFGEDPYLIAKMGVAYVKGLQ 187 >gi|16129070|ref|NP_415625.1| beta N-acetyl-glucosaminidase [Escherichia coli str. K-12 substr. MG1655] gi|89107953|ref|AP_001733.1| beta N-acetyl-glucosaminidase [Escherichia coli str. K-12 substr. W3110] gi|170080758|ref|YP_001730078.1| beta-N-acetylglucosaminidase [Escherichia coli str. K-12 substr. DH10B] gi|238900361|ref|YP_002926157.1| beta N-acetyl-glucosaminidase [Escherichia coli BW2952] gi|331641650|ref|ZP_08342785.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli H736] gi|3025061|sp|P75949|NAGZ_ECOLI RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724434|sp|B1XA17|NAGZ_ECODH RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|259511215|sp|C4ZS47|NAGZ_ECOBW RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|1787350|gb|AAC74191.1| beta N-acetyl-glucosaminidase [Escherichia coli str. K-12 substr. MG1655] gi|4062671|dbj|BAA35914.1| beta N-acetyl-glucosaminidase [Escherichia coli str. K12 substr. W3110] gi|169888593|gb|ACB02300.1| beta-N-acetylglucosaminidase [Escherichia coli str. K-12 substr. DH10B] gi|238860056|gb|ACR62054.1| beta N-acetyl-glucosaminidase [Escherichia coli BW2952] gi|260449754|gb|ACX40176.1| glycoside hydrolase family 3 domain protein [Escherichia coli DH1] gi|260765443|gb|ACX49759.1| chitobiase [Escherichia coli] gi|315135739|dbj|BAJ42898.1| beta-hexosaminidase [Escherichia coli DH1] gi|331038448|gb|EGI10668.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli H736] gi|332342656|gb|AEE55990.1| beta-hexosaminidase NagZ [Escherichia coli UMNK88] Length = 341 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|320179191|gb|EFW54149.1| Beta N-acetyl-glucosaminidase [Shigella boydii ATCC 9905] Length = 341 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|301051106|ref|ZP_07197939.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 185-1] gi|300297232|gb|EFJ53617.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 185-1] gi|307553108|gb|ADN45883.1| beta-N-acetylhexosaminidase [Escherichia coli ABU 83972] Length = 337 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 151 >gi|301029587|ref|ZP_07192664.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 196-1] gi|299877529|gb|EFI85740.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 196-1] Length = 341 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|260854590|ref|YP_003228481.1| beta N-acetyl-glucosaminidase [Escherichia coli O26:H11 str. 11368] gi|260867470|ref|YP_003233872.1| beta N-acetyl-glucosaminidase [Escherichia coli O111:H- str. 11128] gi|257753239|dbj|BAI24741.1| beta N-acetyl-glucosaminidase [Escherichia coli O26:H11 str. 11368] gi|257763826|dbj|BAI35321.1| beta N-acetyl-glucosaminidase [Escherichia coli O111:H- str. 11128] gi|320201002|gb|EFW75586.1| Beta N-acetyl-glucosaminidase [Escherichia coli EC4100B] gi|323156776|gb|EFZ42911.1| beta-hexosaminidase [Escherichia coli EPECa14] gi|332089290|gb|EGI94396.1| beta-hexosaminidase [Shigella boydii 5216-82] gi|332092926|gb|EGI97994.1| beta-hexosaminidase [Shigella dysenteriae 155-74] Length = 341 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|193066302|ref|ZP_03047353.1| beta-N-acetylhexosaminidase [Escherichia coli E22] gi|194429803|ref|ZP_03062317.1| beta-N-acetylhexosaminidase [Escherichia coli B171] gi|260843347|ref|YP_003221125.1| beta N-acetyl-glucosaminidase [Escherichia coli O103:H2 str. 12009] gi|192926074|gb|EDV80717.1| beta-N-acetylhexosaminidase [Escherichia coli E22] gi|194412150|gb|EDX28458.1| beta-N-acetylhexosaminidase [Escherichia coli B171] gi|257758494|dbj|BAI29991.1| beta N-acetyl-glucosaminidase [Escherichia coli O103:H2 str. 12009] Length = 341 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|300928340|ref|ZP_07143874.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 187-1] gi|300463598|gb|EFK27091.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 187-1] gi|323962706|gb|EGB58284.1| glycosyl hydrolase 3 domain-containing protein [Escherichia coli H489] gi|323973303|gb|EGB68492.1| glycosyl hydrolase 3 domain-containing protein [Escherichia coli TA007] Length = 337 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 151 >gi|110641283|ref|YP_669013.1| beta-hexosaminidase [Escherichia coli 536] gi|300982475|ref|ZP_07176151.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 200-1] gi|110342875|gb|ABG69112.1| beta-hexosaminidase [Escherichia coli 536] gi|300307172|gb|EFJ61692.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 200-1] gi|312945669|gb|ADR26496.1| beta-hexosaminidase [Escherichia coli O83:H1 str. NRG 857C] gi|324013263|gb|EGB82482.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 60-1] Length = 337 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 151 >gi|119384605|ref|YP_915661.1| Beta-N-acetylhexosaminidase [Paracoccus denitrificans PD1222] gi|119374372|gb|ABL69965.1| Beta-N-acetylhexosaminidase [Paracoccus denitrificans PD1222] Length = 328 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 8/47 (17%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQ 47 +A+ L GI+ + +PVLD+ + + Sbjct: 102 LAQELRAVGIDADCAPVLDIAREDTHP-FLRNRCLGSDADTVIRLGR 147 >gi|89073714|ref|ZP_01160228.1| beta-hexosaminidase [Photobacterium sp. SKA34] gi|89050489|gb|EAR55981.1| beta-hexosaminidase [Photobacterium sp. SKA34] Length = 334 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L+ I+++F+PVLDL Y + FS P A F Sbjct: 101 MAAELLAMDIDISFAPVLDLGYDCKAI---GDRAFSNSPHDIIRYASQFINGM 150 >gi|284920932|emb|CBG33995.1| Beta-hexosaminidase [Escherichia coli 042] Length = 341 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAIASRFIDGMHE 155 >gi|315186180|gb|EFU19942.1| glycoside hydrolase family 3 domain protein [Spirochaeta thermophila DSM 6578] Length = 615 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ +V +GI+ F+P + + + F P R + Sbjct: 160 AEEVVATGIHWTFAPCVTVPQDER--WGRTYEGFGEDPELVARLGAALIRGFQ 210 >gi|255066667|ref|ZP_05318522.1| beta-N-acetylhexosaminidase [Neisseria sicca ATCC 29256] gi|255048995|gb|EET44459.1| beta-N-acetylhexosaminidase [Neisseria sicca ATCC 29256] Length = 350 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L GI+++F+PVLDL +G I F R + A + Sbjct: 103 LATELTACGIDLSFTPVLDLDWGACPVIG--NRSFHRNADTVTQLALALQKGLN 154 >gi|239831758|ref|ZP_04680087.1| Beta-hexosaminidase A precursor [Ochrobactrum intermedium LMG 3301] gi|239824025|gb|EEQ95593.1| Beta-hexosaminidase A precursor [Ochrobactrum intermedium LMG 3301] Length = 369 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+NV+ PVLD+ + +S+ P E + + + Sbjct: 142 AFDLLRVGVNVDCLPVLDVPVEGAHDVIGA-RAYSKNPHAVAEMGRAAAEGLL 193 >gi|323175262|gb|EFZ60875.1| beta-hexosaminidase [Escherichia coli LT-68] Length = 336 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 99 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 150 >gi|193070915|ref|ZP_03051846.1| beta-N-acetylhexosaminidase [Escherichia coli E110019] gi|209918363|ref|YP_002292447.1| beta-hexosaminidase [Escherichia coli SE11] gi|218553684|ref|YP_002386597.1| beta-hexosaminidase [Escherichia coli IAI1] gi|218694640|ref|YP_002402307.1| beta-hexosaminidase [Escherichia coli 55989] gi|256018637|ref|ZP_05432502.1| beta-hexosaminidase [Shigella sp. D9] gi|293433396|ref|ZP_06661824.1| beta-N-acetylhexosaminidase [Escherichia coli B088] gi|307310116|ref|ZP_07589766.1| glycoside hydrolase family 3 domain protein [Escherichia coli W] gi|331667507|ref|ZP_08368371.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli TA271] gi|331676898|ref|ZP_08377594.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli H591] gi|332279705|ref|ZP_08392118.1| beta N-acetyl-glucosaminidase [Shigella sp. D9] gi|226724433|sp|B7LX41|NAGZ_ECO8A RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724436|sp|B6I9I5|NAGZ_ECOSE RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|254766760|sp|B7LG40|NAGZ_ECO55 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|192955769|gb|EDV86241.1| beta-N-acetylhexosaminidase [Escherichia coli E110019] gi|209911622|dbj|BAG76696.1| putative beta-hexosaminidase [Escherichia coli SE11] gi|218351372|emb|CAU97078.1| beta N-acetyl-glucosaminidase [Escherichia coli 55989] gi|218360452|emb|CAQ98006.1| beta N-acetyl-glucosaminidase [Escherichia coli IAI1] gi|291324215|gb|EFE63637.1| beta-N-acetylhexosaminidase [Escherichia coli B088] gi|306909834|gb|EFN40328.1| glycoside hydrolase family 3 domain protein [Escherichia coli W] gi|315060384|gb|ADT74711.1| beta N-acetyl-glucosaminidase [Escherichia coli W] gi|323379056|gb|ADX51324.1| glycoside hydrolase family 3 domain protein [Escherichia coli KO11] gi|323947589|gb|EGB43593.1| glycosyl hydrolase 3 domain-containing protein [Escherichia coli H120] gi|324117322|gb|EGC11229.1| glycosyl hydrolase 3 domain-containing protein [Escherichia coli E1167] gi|331065092|gb|EGI36987.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli TA271] gi|331075587|gb|EGI46885.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli H591] gi|332102057|gb|EGJ05403.1| beta N-acetyl-glucosaminidase [Shigella sp. D9] Length = 341 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|146311278|ref|YP_001176352.1| beta-hexosaminidase [Enterobacter sp. 638] gi|145318154|gb|ABP60301.1| beta-N-acetylhexosaminidase [Enterobacter sp. 638] Length = 337 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P A A F Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHEDPNIALAMATRFIDGMHD 151 >gi|309701378|emb|CBJ00679.1| Beta-hexosaminidase [Escherichia coli ETEC H10407] Length = 341 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|320197566|gb|EFW72179.1| Beta N-acetyl-glucosaminidase [Escherichia coli WV_060327] Length = 341 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|227886536|ref|ZP_04004341.1| beta-hexosaminidase [Escherichia coli 83972] gi|227836740|gb|EEJ47206.1| beta-hexosaminidase [Escherichia coli 83972] Length = 341 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|191173048|ref|ZP_03034581.1| beta-N-acetylhexosaminidase [Escherichia coli F11] gi|215486318|ref|YP_002328749.1| beta-hexosaminidase [Escherichia coli O127:H6 str. E2348/69] gi|218689059|ref|YP_002397271.1| beta-hexosaminidase [Escherichia coli ED1a] gi|312968814|ref|ZP_07783021.1| beta-hexosaminidase [Escherichia coli 2362-75] gi|331657170|ref|ZP_08358132.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli TA206] gi|254766759|sp|B7UPC3|NAGZ_ECO27 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|254766761|sp|B7MTN7|NAGZ_ECO81 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|190906593|gb|EDV66199.1| beta-N-acetylhexosaminidase [Escherichia coli F11] gi|215264390|emb|CAS08747.1| beta N-acetyl-glucosaminidase [Escherichia coli O127:H6 str. E2348/69] gi|218426623|emb|CAR07451.1| beta N-acetyl-glucosaminidase [Escherichia coli ED1a] gi|222032860|emb|CAP75599.1| Beta-hexosaminidase [Escherichia coli LF82] gi|281178217|dbj|BAI54547.1| putative beta-hexosaminidase [Escherichia coli SE15] gi|312286216|gb|EFR14129.1| beta-hexosaminidase [Escherichia coli 2362-75] gi|331055418|gb|EGI27427.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Escherichia coli TA206] Length = 341 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|29831525|ref|NP_826159.1| xylan 1,4-beta-xylosidase [Streptomyces avermitilis MA-4680] gi|29608641|dbj|BAC72694.1| putative xylan 1,4-beta-xylosidase [Streptomyces avermitilis MA-4680] Length = 742 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ G++ +PVLD++ P + P + + Sbjct: 146 IGASMRAVGVHQGLAPVLDVVRDPR--WGRTEESIGEDPYLVATVGTAYVQGLQ 197 >gi|300974503|ref|ZP_07172624.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 45-1] gi|300410560|gb|EFJ94098.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 45-1] gi|315291036|gb|EFU50399.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 153-1] Length = 337 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 151 >gi|157160634|ref|YP_001457952.1| beta-hexosaminidase [Escherichia coli HS] gi|170020498|ref|YP_001725452.1| beta-hexosaminidase [Escherichia coli ATCC 8739] gi|188495187|ref|ZP_03002457.1| beta-hexosaminidase [Escherichia coli 53638] gi|194439714|ref|ZP_03071783.1| beta-N-acetylhexosaminidase [Escherichia coli 101-1] gi|167012455|sp|A7ZZ65|NAGZ_ECOHS RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|189030781|sp|B1IUF8|NAGZ_ECOLC RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|157066314|gb|ABV05569.1| beta-N-acetylhexosaminidase [Escherichia coli HS] gi|169755426|gb|ACA78125.1| glycoside hydrolase family 3 domain protein [Escherichia coli ATCC 8739] gi|188490386|gb|EDU65489.1| beta-hexosaminidase [Escherichia coli 53638] gi|194421333|gb|EDX37351.1| beta-N-acetylhexosaminidase [Escherichia coli 101-1] Length = 341 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|119718705|ref|YP_925670.1| glycoside hydrolase family 3 protein [Nocardioides sp. JS614] gi|119539366|gb|ABL83983.1| glycoside hydrolase, family 3 domain protein [Nocardioides sp. JS614] Length = 468 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 8/38 (21%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRI 38 + L +GI+++ PV D+ P+ + F Sbjct: 119 IGTELAAAGIDLDLGPVADVNSDPDNPVIGT-RSFGTD 155 >gi|26247250|ref|NP_753290.1| beta-hexosaminidase [Escherichia coli CFT073] gi|34222677|sp|Q8FIN2|NAGZ_ECOL6 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|26107651|gb|AAN79850.1|AE016759_124 Beta-hexosaminidase [Escherichia coli CFT073] Length = 341 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|322515716|ref|ZP_08068684.1| beta-hexosaminidase [Actinobacillus ureae ATCC 25976] gi|322118206|gb|EFX90508.1| beta-hexosaminidase [Actinobacillus ureae ATCC 25976] Length = 345 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F P A+ F + Sbjct: 103 MAAEMFALDIDLSFAPVLDLGHQCKAI---GDRSFGENPDMILPIAEAFIDGMRE 154 >gi|90577725|ref|ZP_01233536.1| beta-hexosaminidase [Vibrio angustum S14] gi|90440811|gb|EAS65991.1| beta-hexosaminidase [Vibrio angustum S14] Length = 334 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 MA L+ I+++F+PVLDL Y + FS P A F Sbjct: 101 MAAELLAMDIDISFAPVLDLGYDCKAI---GDRAFSNSPQDIIRYASQFITGM 150 >gi|238022068|ref|ZP_04602494.1| hypothetical protein GCWU000324_01973 [Kingella oralis ATCC 51147] gi|237866682|gb|EEP67724.1| hypothetical protein GCWU000324_01973 [Kingella oralis ATCC 51147] Length = 359 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A LV G++++F+PVLDL + I R P A R Sbjct: 113 LATELVACGVDLSFTPVLDLDWERCPVIG--NRSLHRQPETVTALALALQRGLN 164 >gi|254419458|ref|ZP_05033182.1| Glycosyl hydrolase family 3 N terminal domain protein [Brevundimonas sp. BAL3] gi|196185635|gb|EDX80611.1| Glycosyl hydrolase family 3 N terminal domain protein [Brevundimonas sp. BAL3] Length = 652 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ + +GI F+P L + + +S P E + R N Sbjct: 171 ARQVRATGITWVFAPTLAVGENRR--WGRTYESYSSDPQLVAEYGEALVRGLQGN 223 >gi|288549500|ref|ZP_05967266.2| beta-hexosaminidase [Enterobacter cancerogenus ATCC 35316] gi|288318211|gb|EFC57149.1| beta-hexosaminidase [Enterobacter cancerogenus ATCC 35316] Length = 337 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P A A F Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHEDPRIALAIATQFIDGMHD 151 >gi|188026127|ref|ZP_02960972.2| hypothetical protein PROSTU_02958 [Providencia stuartii ATCC 25827] gi|188021726|gb|EDU59766.1| hypothetical protein PROSTU_02958 [Providencia stuartii ATCC 25827] Length = 339 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLDL + IA F P A A+ F + Sbjct: 104 MASEMIAMDIDISFAPVLDLGHQS---IAIGERSFHEDPEIAMIMAERFIKGMR 154 >gi|238749653|ref|ZP_04611158.1| Beta-hexosaminidase [Yersinia rohdei ATCC 43380] gi|238712308|gb|EEQ04521.1| Beta-hexosaminidase [Yersinia rohdei ATCC 43380] Length = 342 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA +V I+++F+PVLD+ + I F P +A A+ F R Sbjct: 104 MAAEMVAMDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQALNMAECFIRGMH 154 >gi|297521224|ref|ZP_06939610.1| beta-hexosaminidase [Escherichia coli OP50] Length = 286 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 49 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 100 >gi|253773870|ref|YP_003036701.1| beta-hexosaminidase [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|254161213|ref|YP_003044321.1| beta-hexosaminidase [Escherichia coli B str. REL606] gi|242376910|emb|CAQ31628.1| beta-N-acetylhexosaminidase [Escherichia coli BL21(DE3)] gi|253324914|gb|ACT29516.1| glycoside hydrolase family 3 domain protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|253973114|gb|ACT38785.1| beta-hexosaminidase [Escherichia coli B str. REL606] gi|253977328|gb|ACT42998.1| beta-hexosaminidase [Escherichia coli BL21(DE3)] Length = 341 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 155 >gi|329122981|ref|ZP_08251552.1| beta-hexosaminidase [Haemophilus aegyptius ATCC 11116] gi|327471912|gb|EGF17352.1| beta-hexosaminidase [Haemophilus aegyptius ATCC 11116] Length = 350 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + FS A A F + Sbjct: 104 MAAEMIALDIDLSFAPVLDLGHECRAI---GDRSFSSDVKSAVNLATAFIDGMHQ 155 >gi|319775105|ref|YP_004137593.1| beta N-acetyl-glucosaminidase [Haemophilus influenzae F3047] gi|317449696|emb|CBY85903.1| beta N-acetyl-glucosaminidase [Haemophilus influenzae F3047] Length = 350 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + FS A A F + Sbjct: 104 MAAEMIALDIDLSFAPVLDLGHECRAI---GDRSFSSDVKSAVNLATAFIDGMHQ 155 >gi|301169684|emb|CBW29285.1| beta N-acetyl-glucosaminidase [Haemophilus influenzae 10810] Length = 347 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + FS A A F + Sbjct: 101 MAAEMIALDIDLSFAPVLDLGHECRAI---GDRSFSSDVKSAVNLATAFIDGMHQ 152 >gi|148828136|ref|YP_001292889.1| beta-hexosaminidase [Haemophilus influenzae PittGG] gi|148719378|gb|ABR00506.1| beta-hexosaminidase [Haemophilus influenzae PittGG] Length = 347 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + FS A A F + Sbjct: 101 MAAEMIALDIDLSFAPVLDLGHECRAI---GDRSFSSDVKSAVNLATAFIDGMHQ 152 >gi|145640628|ref|ZP_01796211.1| beta-hexosaminidase [Haemophilus influenzae R3021] gi|145274554|gb|EDK14417.1| beta-hexosaminidase [Haemophilus influenzae 22.4-21] Length = 348 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + FS A A F + Sbjct: 101 MAAEMIALDIDLSFAPVLDLGHECRAI---GDRSFSSDVKSAVNLATAFIDGMHQ 152 >gi|145632345|ref|ZP_01788080.1| beta-hexosaminidase [Haemophilus influenzae 3655] gi|145634136|ref|ZP_01789847.1| beta-hexosaminidase [Haemophilus influenzae PittAA] gi|144987252|gb|EDJ93782.1| beta-hexosaminidase [Haemophilus influenzae 3655] gi|145268580|gb|EDK08573.1| beta-hexosaminidase [Haemophilus influenzae PittAA] Length = 348 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + FS A A F + Sbjct: 101 MAAEMIALDIDLSFAPVLDLGHECRAI---GDRSFSSDVKSAVNLATAFIDGMHQ 152 >gi|145630055|ref|ZP_01785837.1| beta-hexosaminidase [Haemophilus influenzae R3021] gi|144984336|gb|EDJ91759.1| beta-hexosaminidase [Haemophilus influenzae R3021] Length = 347 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + FS A A F + Sbjct: 101 MAAEMIALDIDLSFAPVLDLGHECRAI---GDRSFSSDVKSAVNLATAFIDGMHQ 152 >gi|16272897|ref|NP_439120.1| beta-hexosaminidase [Haemophilus influenzae Rd KW20] gi|260580049|ref|ZP_05847879.1| beta-hexosaminidase [Haemophilus influenzae RdAW] gi|1175341|sp|P44955|NAGZ_HAEIN RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|1573985|gb|AAC22620.1| beta-hexosaminidase (exoII) [Haemophilus influenzae Rd KW20] gi|260093333|gb|EEW77266.1| beta-hexosaminidase [Haemophilus influenzae RdAW] Length = 351 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + FS A A F + Sbjct: 104 MAAEMIALDIDLSFAPVLDLGHECRAI---GDRSFSSDVKSAVNLATAFIDGMHQ 155 >gi|213585106|ref|ZP_03366932.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhi str. E98-0664] Length = 177 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + PAKA A F Sbjct: 77 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPAKALAMATRFIDGMHD 128 >gi|225164471|ref|ZP_03726727.1| putative periplasmic beta-glucosidase [Opitutaceae bacterium TAV2] gi|224800912|gb|EEG19252.1| putative periplasmic beta-glucosidase [Opitutaceae bacterium TAV2] Length = 749 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ G++ +F+P++DL P + + P + R Y Sbjct: 148 AREARAQGVHWSFAPMIDLSRDPR--WGRIVEGYGEDPLLIARCGEAVIRGYQ 198 >gi|85707715|ref|ZP_01038781.1| glycosyl hydrolase [Erythrobacter sp. NAP1] gi|85689249|gb|EAQ29252.1| glycosyl hydrolase [Erythrobacter sp. NAP1] Length = 340 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 9/50 (18%), Positives = 14/50 (28%), Gaps = 1/50 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 L GI V++ P LDL + P + + Sbjct: 111 ELSAMGITVDYHPPLDLRQSGAHDVIG-DRSLGADPMQVAAIGRAILDGL 159 >gi|261868604|ref|YP_003256526.1| beta-hexosaminidase [Aggregatibacter actinomycetemcomitans D11S-1] gi|261413936|gb|ACX83307.1| beta-hexosaminidase [Aggregatibacter actinomycetemcomitans D11S-1] Length = 348 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F A + A F R + Sbjct: 105 MAAEMTALDIDLSFAPVLDLGHQCKAI---GDRSFGDDVKSAVDLAANFIRGMHQ 156 >gi|167623540|ref|YP_001673834.1| beta-hexosaminidase [Shewanella halifaxensis HAW-EB4] gi|167353562|gb|ABZ76175.1| glycoside hydrolase family 3 domain protein [Shewanella halifaxensis HAW-EB4] Length = 335 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++F+PVLDL G I FS + E A F + Sbjct: 105 MAIELLAVDIDLSFAPVLDLN-GVSQVIGT--RSFSPDKTEVVELAGAFIDGMEQ 156 >gi|163759453|ref|ZP_02166538.1| glycoside hydrolase, family 3-like protein [Hoeflea phototrophica DFL-43] gi|162283050|gb|EDQ33336.1| glycoside hydrolase, family 3-like protein [Hoeflea phototrophica DFL-43] Length = 338 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ GI VN PVLD+ + + P + Sbjct: 112 AFDLLPLGITVNCLPVLDVPSPGGHEVIGS-RAYGMTPEIVAAMGKAACDGLK 163 >gi|94990676|ref|YP_598776.1| Beta-N-acetylhexosaminidase [Streptococcus pyogenes MGAS10270] gi|94544184|gb|ABF34232.1| Beta-N-acetylhexosaminidase [Streptococcus pyogenes MGAS10270] Length = 216 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G N +F+P++DL I + + ++ + R +++ Sbjct: 138 EAAAVGCNASFAPIVDLTRNWRNPIIAS-RNWGSNVDQIITLSKEYMRGIMEH 189 >gi|299067036|emb|CBJ38231.1| Beta-hexosaminidase; N-acetyl-beta-glucosaminidase; Beta-N-acetylhexosaminidase [Ralstonia solanacearum CMR15] Length = 350 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQ 47 +A L I+++F+PVLDL YG I F R P A Sbjct: 116 LAAELRACDIDLSFTPVLDLDYGTSGVIG--DRAFHRDPRVVTMLAN 160 >gi|325981704|ref|YP_004294106.1| glycoside hydrolase family 3 domain-containing protein [Nitrosomonas sp. AL212] gi|325531223|gb|ADZ25944.1| glycoside hydrolase family 3 domain protein [Nitrosomonas sp. AL212] Length = 350 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+ +F+PVLDL YG I F + A K Sbjct: 108 LAAELNVCGIDFSFTPVLDLDYGKNFVIG--DRAFHHEAEVVSDLAYNLMLGLKK 160 >gi|317492274|ref|ZP_07950703.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Enterobacteriaceae bacterium 9_2_54FAA] gi|316919613|gb|EFV40943.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Enterobacteriaceae bacterium 9_2_54FAA] Length = 339 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL +G F P A A+ F + Sbjct: 104 MACEMIAMDIDISFAPVLDLGHGSAAI---GERSFHEKPEIAVRMAESFIDGMHE 155 >gi|268589228|ref|ZP_06123449.1| beta-hexosaminidase [Providencia rettgeri DSM 1131] gi|291315484|gb|EFE55937.1| beta-hexosaminidase [Providencia rettgeri DSM 1131] Length = 339 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLDL + IA F P A A+ F + Sbjct: 104 MASEMIAMDIDISFAPVLDLGHQS---IAIGERSFHEDPEIAMVMAERFIKGMR 154 >gi|163751448|ref|ZP_02158672.1| beta-hexosaminidase [Shewanella benthica KT99] gi|161328662|gb|EDP99811.1| beta-hexosaminidase [Shewanella benthica KT99] Length = 332 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 MA L+ I+++F+PVLDL I + F P A+ F Sbjct: 101 MAIELLACDIDLSFAPVLDLDR-VSRVIGK--RAFGSEPEIVTSLAERFISG 149 >gi|109898036|ref|YP_661291.1| beta-hexosaminidase [Pseudoalteromonas atlantica T6c] gi|109700317|gb|ABG40237.1| beta-N-acetylhexosaminidase [Pseudoalteromonas atlantica T6c] Length = 332 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + I+++F+PVLDL G I F P + A F + Sbjct: 102 MAAECLAFDIDLSFAPVLDLN-GVSDVIG--DRSFHTQPEPLIQLASEFIKGMH 152 >gi|93005139|ref|YP_579576.1| beta-hexosaminidase [Psychrobacter cryohalolentis K5] gi|92392817|gb|ABE74092.1| glycoside hydrolase, family 3-like [Psychrobacter cryohalolentis K5] Length = 360 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ +GI+++F+PVLD G I F P A F R Sbjct: 106 MASEVLAAGIDLSFAPVLDRD-GISQVIG--DRSFHHEPQAITALAAQFMRGMK 156 >gi|119499830|ref|XP_001266672.1| glycosyl hydrolase, putative [Neosartorya fischeri NRRL 181] gi|119414837|gb|EAW24775.1| glycosyl hydrolase, putative [Neosartorya fischeri NRRL 181] Length = 353 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A L G+N N +PVL + F+ + + A+ F R+ Sbjct: 131 ATTLAKYGVNANLAPVLGVYRSAGDFLDEYGRSYGNTSELVASCAEAFIRSQQ 183 >gi|307719143|ref|YP_003874675.1| glycosyl hydrolase [Spirochaeta thermophila DSM 6192] gi|306532868|gb|ADN02402.1| putative glycosyl hydrolase [Spirochaeta thermophila DSM 6192] Length = 560 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G NV FSPV+D+ Y + I F ++++ R + Sbjct: 133 AREGRALGYNVTFSPVVDINYNFRSTITGT-RTFGSDADMVRRLSEVYVRVLQE 185 >gi|302670276|ref|YP_003830236.1| beta-N-acetylhexosaminidase Bhx3A [Butyrivibrio proteoclasticus B316] gi|302394749|gb|ADL33654.1| beta-N-acetylhexosaminidase Bhx3A [Butyrivibrio proteoclasticus B316] Length = 586 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 12/51 (23%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 K G+N +F+P++D+ I F P K E A + Sbjct: 131 CKEGAALGLNWSFAPIVDINREFHNPITNV-RTFGDDPKKIEAFASRYMDG 180 >gi|148978978|ref|ZP_01815268.1| putative glycosyl hydrolase [Vibrionales bacterium SWAT-3] gi|145962067|gb|EDK27354.1| putative glycosyl hydrolase [Vibrionales bacterium SWAT-3] Length = 716 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + GIN F+P+LD++ P + P + A+ + + Sbjct: 132 IAAEAASLGINWTFAPMLDIVRDPR--WGRVIESSGEDPYLTSQFAKSVVKGFQ 183 >gi|325978825|ref|YP_004288541.1| beta-N-acetylhexosaminidase [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069] gi|325178753|emb|CBZ48797.1| beta-N-acetylhexosaminidase [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069] Length = 558 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ G +++F PV+D+ + I + + + A + + N Sbjct: 126 LAREASALGCHMSFGPVVDMTIDWRSAITSTN-TYGADADQVLKYASANMQGQMDN 180 >gi|288905790|ref|YP_003431012.1| beta-hexosamidase (glycosyl hydrolase, family 3) [Streptococcus gallolyticus UCN34] gi|288732516|emb|CBI14088.1| Putative beta-hexosamidase (glycosyl hydrolase, family 3) [Streptococcus gallolyticus UCN34] Length = 558 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ G +++F PV+D+ + I + + + A + + N Sbjct: 126 LAREASALGCHMSFGPVVDMTIDWRSAITSTN-TYGADADQVLKYASANMQGQMDN 180 >gi|225868874|ref|YP_002744822.1| glycosyl hydrolase family protein [Streptococcus equi subsp. zooepidemicus] gi|225702150|emb|CAW99842.1| glycosyl hydrolase family protein [Streptococcus equi subsp. zooepidemicus] Length = 596 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 8/49 (16%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 G N +F+P++DL I + + E ++ + + Sbjct: 133 EASAVGCNASFAPIVDLTRNWRNPII-ANRNWGANVDQIIELSKEYMKG 180 >gi|116671436|ref|YP_832369.1| Beta-N-acetylhexosaminidase [Arthrobacter sp. FB24] gi|116611545|gb|ABK04269.1| Beta-N-acetylhexosaminidase [Arthrobacter sp. FB24] Length = 553 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L G +F+P D+ GP+ S P A F++ + Sbjct: 195 LAAELAGLGFTADFAPDTDVTAGPQDPTIGA-RAMSGDPDAAASLGVGFAQGML 247 >gi|225023412|ref|ZP_03712604.1| hypothetical protein EIKCOROL_00270 [Eikenella corrodens ATCC 23834] gi|224943761|gb|EEG24970.1| hypothetical protein EIKCOROL_00270 [Eikenella corrodens ATCC 23834] Length = 350 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L G++++F+PVLDL +G I F A R + Sbjct: 103 LAAELRACGVDLSFTPVLDLDWGQCAVIG--NRSFHCQADTVTALALALQRGLNQ 155 >gi|257056346|ref|YP_003134178.1| beta-glucosidase-like glycosyl hydrolase [Saccharomonospora viridis DSM 43017] gi|256586218|gb|ACU97351.1| beta-glucosidase-like glycosyl hydrolase [Saccharomonospora viridis DSM 43017] Length = 773 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + ++ G++ SPVLD++ + + P + R + Sbjct: 147 IGADMRAVGVHQGLSPVLDVVR--DHRWGRVEETMGEDPYLVGMLGSAYVRGLQQ 199 >gi|297564174|ref|YP_003683147.1| glycoside hydrolase family 3 domain protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] gi|296848623|gb|ADH70641.1| glycoside hydrolase family 3 domain protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] Length = 806 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ G++ +PVLD+ P + P + R Sbjct: 159 IGASMRRVGVHQGLAPVLDVSRDPR--WGRTEETIGEDPHLVATVGTAYVRGLQ 210 >gi|319408331|emb|CBI81984.1| Glycoside hydrolase, family 3-like (fragment) [Bartonella schoenbuchensis R1] Length = 238 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A +L+ GIN N P+LD+ + +++ P + +R + Sbjct: 6 AFDLMKLGINANCLPLLDVPVVGAHDVIGT-RAYAQEPETVTALGRAAARGLLD 58 >gi|116071461|ref|ZP_01468729.1| putative beta-glucosidase [Synechococcus sp. BL107] gi|116065084|gb|EAU70842.1| putative beta-glucosidase [Synechococcus sp. BL107] Length = 428 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 6/37 (16%), Positives = 10/37 (27%), Gaps = 1/37 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRI 38 G+N PV D+ P + + Sbjct: 127 GNQARRCGLNWVLGPVCDVNNNPANPVINV-RAWGED 162 >gi|27379865|ref|NP_771394.1| glycosyl hydrolase [Bradyrhizobium japonicum USDA 110] gi|27353018|dbj|BAC50019.1| glycosyl hydrolase [Bradyrhizobium japonicum USDA 110] Length = 342 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A +L GI V+ P+ D+ + + P K A+ + + Sbjct: 110 IAADLADLGITVDCLPLADVPVQGADAVIG-NRAYGTEPGKVAAIARAVTEGLEQ 163 >gi|328947706|ref|YP_004365043.1| glycoside hydrolase family 3 domain protein [Treponema succinifaciens DSM 2489] gi|328448030|gb|AEB13746.1| glycoside hydrolase family 3 domain protein [Treponema succinifaciens DSM 2489] Length = 561 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + + GIN+NF+P +DL + + F P + + F+ + Sbjct: 155 INREIRALGINMNFAPTVDLYTNLNSSVIGP-RSFGSDPVDSGILGEAFAAGSMD 208 >gi|238795987|ref|ZP_04639499.1| Beta-hexosaminidase [Yersinia mollaretii ATCC 43969] gi|238720192|gb|EEQ11996.1| Beta-hexosaminidase [Yersinia mollaretii ATCC 43969] Length = 339 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA +++ I+++F+PVLD+ + I F P +A A+ F R Sbjct: 100 MAAEMISMDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQALNMAECFIRGMH 150 >gi|319897527|ref|YP_004135724.1| beta n-acetyl-glucosaminidase [Haemophilus influenzae F3031] gi|317433033|emb|CBY81404.1| beta N-acetyl-glucosaminidase [Haemophilus influenzae F3031] Length = 351 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + FS A A F + Sbjct: 104 MAAEMIALDIDLSFAPVLDLGHECRAI---GDRSFSSDIKSAVNLATAFIDGMHQ 155 >gi|260581960|ref|ZP_05849756.1| beta-hexosaminidase [Haemophilus influenzae NT127] gi|260095153|gb|EEW79045.1| beta-hexosaminidase [Haemophilus influenzae NT127] Length = 351 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + FS A A F + Sbjct: 104 MAAEMIALDIDLSFAPVLDLGHECRAI---GDRSFSSDIKSAVNLATAFIDGMHQ 155 >gi|229843980|ref|ZP_04464121.1| beta-hexosaminidase [Haemophilus influenzae 6P18H1] gi|229812974|gb|EEP48662.1| beta-hexosaminidase [Haemophilus influenzae 6P18H1] Length = 351 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + FS A A F + Sbjct: 104 MAAEMIALDIDLSFAPVLDLGHECRAI---GDRSFSSDIKSAVNLATAFIDGMHQ 155 >gi|146340979|ref|YP_001206027.1| putative sugar hydrolase/beta-N-acetylhexosaminidase [Bradyrhizobium sp. ORS278] gi|146193785|emb|CAL77802.1| putative sugar hydrolase/Beta-N-acetylhexosaminidase [Bradyrhizobium sp. ORS278] Length = 342 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A +L GI V+ P+ D+ + + P K A+ + + Sbjct: 110 IADDLTQLGITVDCLPLADVPIAGADAVIG-DRAYGTTPHKVAAIARAVTEGLAE 163 >gi|145637264|ref|ZP_01792925.1| beta-hexosaminidase [Haemophilus influenzae PittHH] gi|145269516|gb|EDK09458.1| beta-hexosaminidase [Haemophilus influenzae PittHH] Length = 347 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + FS A A F + Sbjct: 101 MAAEMIALDIDLSFAPVLDLGHECRAI---GDRSFSSDIKSAVNLATAFIDGMHQ 152 >gi|90424010|ref|YP_532380.1| Beta-N-acetylhexosaminidase [Rhodopseudomonas palustris BisB18] gi|90106024|gb|ABD88061.1| Beta-N-acetylhexosaminidase [Rhodopseudomonas palustris BisB18] Length = 342 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A +L+ GI V+ P+ D+ + + P K A+ + Sbjct: 111 IAADLIDLGITVDCLPLADVPVAGADAVIG-NRAYGNEPGKVAAIARAVTDGL 162 >gi|306840371|ref|ZP_07473138.1| beta-hexosaminidase A [Brucella sp. BO2] gi|306289656|gb|EFM60856.1| beta-hexosaminidase A [Brucella sp. BO2] Length = 339 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+NV+ PVLD+ + +S+ P E + + + Sbjct: 112 AFDLLKVGVNVDCLPVLDVPVEGAHDVIGM-RAYSKNPHAVAEMGRAAAEGLL 163 >gi|254706912|ref|ZP_05168740.1| beta-hexosaminidase A [Brucella pinnipedialis M163/99/10] gi|261314375|ref|ZP_05953572.1| beta-N-acetylhexosaminidase [Brucella pinnipedialis M163/99/10] gi|261303401|gb|EEY06898.1| beta-N-acetylhexosaminidase [Brucella pinnipedialis M163/99/10] Length = 339 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+N + PVLD+ + +S+ P E + + ++ Sbjct: 112 AFDLLKVGVNADCLPVLDVPVEGAHDVIGM-RAYSKNPHAVAEMGRAAAEGFL 163 >gi|224368469|ref|YP_002602632.1| NagZ [Desulfobacterium autotrophicum HRM2] gi|223691185|gb|ACN14468.1| NagZ [Desulfobacterium autotrophicum HRM2] Length = 337 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA+ L G+N+N +PVLD++ I P + + T Sbjct: 114 MAEELALVGVNLNLAPVLDVVPDGFDSI-MASRALPGGPERVADLGACIIETLQ 166 >gi|197284758|ref|YP_002150630.1| beta-hexosaminidase [Proteus mirabilis HI4320] gi|227357763|ref|ZP_03842112.1| beta-hexosaminidase [Proteus mirabilis ATCC 29906] gi|226724442|sp|B4EVE7|NAGZ_PROMH RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|194682245|emb|CAR41971.1| beta-hexosaminidase [Proteus mirabilis HI4320] gi|227162092|gb|EEI47106.1| beta-hexosaminidase [Proteus mirabilis ATCC 29906] Length = 339 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLDL + IA F P A + A+ F + Sbjct: 104 MASEMIAMDIDISFAPVLDLGHDC---IAIGERSFHECPEIAMDMAESFIKGMR 154 >gi|220913345|ref|YP_002488654.1| beta-N-acetylhexosaminidase [Arthrobacter chlorophenolicus A6] gi|219860223|gb|ACL40565.1| Beta-N-acetylhexosaminidase [Arthrobacter chlorophenolicus A6] Length = 575 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A L G N++F+P D+ GP+ S PA A + F++ + Sbjct: 218 AGELAPLGFNLDFAPDADVTIGPKDPTIGA-RSMSGDPAAAATQSVSFAQGML 269 >gi|78183921|ref|YP_376356.1| putative beta-glucosidase [Synechococcus sp. CC9902] gi|78168215|gb|ABB25312.1| putative beta-glucosidase [Synechococcus sp. CC9902] Length = 538 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 6/37 (16%), Positives = 10/37 (27%), Gaps = 1/37 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRI 38 G+N PV D+ P + + Sbjct: 127 GDQARRCGLNWVLGPVCDVNNNPANPVINV-RAWGED 162 >gi|115524699|ref|YP_781610.1| Beta-N-acetylhexosaminidase [Rhodopseudomonas palustris BisA53] gi|115518646|gb|ABJ06630.1| Beta-N-acetylhexosaminidase [Rhodopseudomonas palustris BisA53] Length = 342 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A +L GI V+ P+ D+ + + AK AQ + + Sbjct: 111 IAADLAELGITVDCLPLADVPVAGADAVIG-DRAYGTDQAKVAAIAQSVADGLTQ 164 >gi|23007603|ref|ZP_00049401.1| COG1472: Beta-glucosidase-related glycosidases [Magnetospirillum magnetotacticum MS-1] Length = 373 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 11/59 (18%), Positives = 20/59 (33%), Gaps = 6/59 (10%) Query: 1 MAKN----LVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA+ + T G++ +PVLD++ P + P + R Sbjct: 97 MAREVGESMRTLGVHQGLAPVLDVVRDPR--WGRVDECVGEDPYLVGTVGTAYVRGLQD 153 >gi|322633914|gb|EFY30652.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-1] Length = 238 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + PAKA A F Sbjct: 1 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPAKALAMATRFIDGMHD 52 >gi|85703268|ref|ZP_01034372.1| beta-N-acetylhexosaminidase, putative [Roseovarius sp. 217] gi|85672196|gb|EAQ27053.1| beta-N-acetylhexosaminidase, putative [Roseovarius sp. 217] Length = 342 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+ N +P++D+ GP T + + + + + Sbjct: 114 IAAELHALGIDSNCAPLVDVA-GPATHPFLRNRCYGFEAHTVATLGRAVAGGLLD 167 >gi|297160711|gb|ADI10423.1| xylan 1,4-beta-xylosidase [Streptomyces bingchenggensis BCW-1] Length = 786 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ GI+ SPVLD++ P + P + R Sbjct: 146 IGASMRAVGIHQGLSPVLDVVRDPR--WGRTEESIGEDPYLVGTIGTAYVRGLQ 197 >gi|256392352|ref|YP_003113916.1| beta-N-acetylhexosaminidase [Catenulispora acidiphila DSM 44928] gi|256358578|gb|ACU72075.1| Beta-N-acetylhexosaminidase [Catenulispora acidiphila DSM 44928] Length = 438 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 13/51 (25%), Positives = 22/51 (43%) Query: 5 LVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + G+N+N +PVLD+ P F+ + FS+ P + F Sbjct: 219 MAGVGMNLNLAPVLDVYRTPGNFLDAAQRSFSQNPNTVSQLGSNFIVAQQN 269 >gi|145638218|ref|ZP_01793828.1| beta-hexosaminidase [Haemophilus influenzae PittII] gi|145272547|gb|EDK12454.1| beta-hexosaminidase [Haemophilus influenzae PittII] Length = 347 Score = 49.4 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + + FS A A F + Sbjct: 101 MAAEMIALDIDLSFAPVLDLGHECQAI---GDRSFSSDIKSAVNLATAFIDGMHQ 152 >gi|145628104|ref|ZP_01783905.1| beta-hexosaminidase [Haemophilus influenzae 22.1-21] gi|144979879|gb|EDJ89538.1| beta-hexosaminidase [Haemophilus influenzae 22.1-21] Length = 348 Score = 49.4 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + + FS A A F + Sbjct: 101 MAAEMIALDIDLSFAPVLDLGHECQAI---GDRSFSSDIKSAVNLATAFIDGMHQ 152 >gi|114563571|ref|YP_751084.1| beta-hexosaminidase [Shewanella frigidimarina NCIMB 400] gi|122299434|sp|Q080R9|NAGZ_SHEFN RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|114334864|gb|ABI72246.1| glycoside hydrolase, family 3 domain protein [Shewanella frigidimarina NCIMB 400] Length = 341 Score = 49.4 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++F+PVLD+ G I + FS +P + AQ F + Sbjct: 105 MAVELLACDIDLSFAPVLDVN-GISEVIGK--RSFSAVPDEVSALAQQFIIGMNE 156 >gi|309751373|gb|ADO81357.1| Beta-hexosaminidase [Haemophilus influenzae R2866] Length = 350 Score = 49.4 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + + FS A A F + Sbjct: 104 MAAEMIALDIDLSFAPVLDLGHECQAI---GDRSFSSDIKSAVNLATAFIDGMHQ 155 >gi|257454905|ref|ZP_05620153.1| beta-hexosaminidase [Enhydrobacter aerosaccus SK60] gi|257447615|gb|EEV22610.1| beta-hexosaminidase [Enhydrobacter aerosaccus SK60] Length = 346 Score = 49.4 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ GI+ +F+PVLD+ G I F P + F R Sbjct: 108 MASEVLAVGIDFSFAPVLDIN-GVSRVIG--DRAFHVHPIAITALSAEFMRGMK 158 >gi|324113901|gb|EGC07875.1| glycosyl hydrolase 3 domain-containing protein [Escherichia fergusonii B253] gi|325497588|gb|EGC95447.1| beta-hexosaminidase [Escherichia fergusonii ECD227] Length = 337 Score = 49.4 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASKFIDGMHE 151 >gi|218549167|ref|YP_002382958.1| beta-hexosaminidase [Escherichia fergusonii ATCC 35469] gi|226724439|sp|B7LT32|NAGZ_ESCF3 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|218356708|emb|CAQ89336.1| beta N-acetyl-glucosaminidase [Escherichia fergusonii ATCC 35469] Length = 341 Score = 49.4 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASKFIDGMHE 155 >gi|315179269|gb|ADT86183.1| Beta-hexosaminidase (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) [Vibrio furnissii NCTC 11218] Length = 336 Score = 49.4 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + F + + R Sbjct: 108 MAAELIAHDIDLSFAPVLDKGFDCRAI---GNRAFGDDVQTVLTYSSAYMRGMK 158 >gi|307719400|ref|YP_003874932.1| glycoside hydrolase [Spirochaeta thermophila DSM 6192] gi|306533125|gb|ADN02659.1| glycoside hydrolase [Spirochaeta thermophila DSM 6192] Length = 615 Score = 49.4 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ +V +GI+ F+P + + + FS P R + Sbjct: 160 AEEVVATGIHWTFAPCVTVPQDER--WGRTYEGFSEDPELVARLGAALIRGFQ 210 >gi|260771125|ref|ZP_05880052.1| beta N-acetyl-glucosaminidase [Vibrio furnissii CIP 102972] gi|260613722|gb|EEX38914.1| beta N-acetyl-glucosaminidase [Vibrio furnissii CIP 102972] Length = 329 Score = 49.4 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + F + + R Sbjct: 101 MAAELIAHDIDLSFAPVLDKGFDCRAI---GNRAFGDDVQTVLTYSSAYMRGMK 151 >gi|6226631|sp|P96157|NAGZ_VIBFU RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|4263874|gb|AAC44686.2| N-Acetyl-beta-glucosaminidase [Vibrio furnissii] Length = 329 Score = 49.4 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + F + + R Sbjct: 101 MAAELIAHDIDLSFAPVLDKGFDCRAI---GNRAFGDDVQTVLTYSSAYMRGMK 151 >gi|315185694|gb|EFU19461.1| glycoside hydrolase family 3 domain protein [Spirochaeta thermophila DSM 6578] Length = 560 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G NV FSPV+D+ Y + I F ++++ R + Sbjct: 133 AREGRALGYNVTFSPVVDINYNFRSTITGA-RTFGSDADMVRRLSEVYVRVLQE 185 >gi|225870122|ref|YP_002746069.1| glycosyl hydrolase family protein [Streptococcus equi subsp. equi 4047] gi|225699526|emb|CAW93096.1| glycosyl hydrolase family protein [Streptococcus equi subsp. equi 4047] Length = 596 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 8/49 (16%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 G N +F+P++DL I + + E ++ + + Sbjct: 133 EASAVGCNASFAPIVDLTRNWRNPII-ANRNWGVNVDQIIELSKEYMKG 180 >gi|110597288|ref|ZP_01385576.1| Beta-N-acetylhexosaminidase [Chlorobium ferrooxidans DSM 13031] gi|110341124|gb|EAT59592.1| Beta-N-acetylhexosaminidase [Chlorobium ferrooxidans DSM 13031] Length = 389 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Query: 6 VTSGINVNFSPVLDLLYGPETFIAQK-RSIFSRIPAKAEESAQLFSRTYI 54 I +NF+PV DL P+ + K FS P A + +L +T+ Sbjct: 167 QAMHIGLNFAPVADLNVNPDNPVIGKLGRSFSGDPEIAVPNIRLTVKTFN 216 >gi|262373443|ref|ZP_06066721.1| beta-N-acetyl-D-glucosaminidase [Acinetobacter junii SH205] gi|262311196|gb|EEY92282.1| beta-N-acetyl-D-glucosaminidase [Acinetobacter junii SH205] Length = 339 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ GI+ +F+PVLDL I F++ A F R K Sbjct: 106 MATEVLAVGIDFSFAPVLDLN-DISDVIG--DRGFAKNIQDIVPLAAAFMRGMKK 157 >gi|327393501|dbj|BAK10923.1| beta-hexosaminidase NagZ [Pantoea ananatis AJ13355] Length = 346 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I F PA A A+ F + Sbjct: 109 MAAEMIALDIDISFAPVLDIGH-ISAAIG--DRAFHEDPAIALAMARRFIAGMHE 160 >gi|291617050|ref|YP_003519792.1| NagZ [Pantoea ananatis LMG 20103] gi|291152080|gb|ADD76664.1| NagZ [Pantoea ananatis LMG 20103] Length = 346 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I F PA A A+ F + Sbjct: 109 MAAEMIALDIDISFAPVLDIGH-ISAAIG--DRAFHEDPAIALAMARRFIAGMHE 160 >gi|326388875|ref|ZP_08210457.1| Beta-N-acetylhexosaminidase [Novosphingobium nitrogenifigens DSM 19370] gi|326206475|gb|EGD57310.1| Beta-N-acetylhexosaminidase [Novosphingobium nitrogenifigens DSM 19370] Length = 338 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +L +GI V+ P+LD+ + P + + Sbjct: 108 LGLDLARAGITVDCLPLLDVRVPGADDVIG-DRALGSEPMRVAALGRAVVDGL 159 >gi|260428308|ref|ZP_05782287.1| beta-hexosaminidase [Citreicella sp. SE45] gi|260422800|gb|EEX16051.1| beta-hexosaminidase [Citreicella sp. SE45] Length = 334 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L + GI+ N +P+LD+ + + P + E +R ++ Sbjct: 109 ALELRSYGIDGNCAPMLDVARAETHA-FLRNRCYGETPDRVSEIGLAVARGLMQ 161 >gi|162419939|ref|YP_001607203.1| beta-hexosaminidase [Yersinia pestis Angola] gi|165925500|ref|ZP_02221332.1| beta-hexosaminidase [Yersinia pestis biovar Orientalis str. F1991016] gi|165940143|ref|ZP_02228675.1| beta-hexosaminidase [Yersinia pestis biovar Orientalis str. IP275] gi|166008598|ref|ZP_02229496.1| beta-hexosaminidase [Yersinia pestis biovar Antiqua str. E1979001] gi|166211048|ref|ZP_02237083.1| beta-hexosaminidase [Yersinia pestis biovar Antiqua str. B42003004] gi|167401731|ref|ZP_02307222.1| beta-hexosaminidase [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167421734|ref|ZP_02313487.1| beta-hexosaminidase [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167427085|ref|ZP_02318838.1| beta-hexosaminidase [Yersinia pestis biovar Mediaevalis str. K1973002] gi|294504184|ref|YP_003568246.1| beta-hexosaminidase [Yersinia pestis Z176003] gi|162352754|gb|ABX86702.1| beta-hexosaminidase [Yersinia pestis Angola] gi|165911889|gb|EDR30534.1| beta-hexosaminidase [Yersinia pestis biovar Orientalis str. IP275] gi|165922609|gb|EDR39760.1| beta-hexosaminidase [Yersinia pestis biovar Orientalis str. F1991016] gi|165992980|gb|EDR45281.1| beta-hexosaminidase [Yersinia pestis biovar Antiqua str. E1979001] gi|166208228|gb|EDR52708.1| beta-hexosaminidase [Yersinia pestis biovar Antiqua str. B42003004] gi|166960219|gb|EDR56240.1| beta-hexosaminidase [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167048836|gb|EDR60244.1| beta-hexosaminidase [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167053929|gb|EDR63761.1| beta-hexosaminidase [Yersinia pestis biovar Mediaevalis str. K1973002] gi|262362301|gb|ACY59022.1| beta-hexosaminidase [Yersinia pestis D106004] gi|262366235|gb|ACY62792.1| beta-hexosaminidase [Yersinia pestis D182038] gi|294354643|gb|ADE64984.1| beta-hexosaminidase [Yersinia pestis Z176003] Length = 340 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I F P +A A+ F R Sbjct: 101 MAAEMMAMDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQARIMAECFIRGMH 151 >gi|153948161|ref|YP_001400569.1| beta-hexosaminidase [Yersinia pseudotuberculosis IP 31758] gi|170023941|ref|YP_001720446.1| beta-hexosaminidase [Yersinia pseudotuberculosis YPIII] gi|167012456|sp|A7FH41|NAGZ_YERP3 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724458|sp|B1JI47|NAGZ_YERPY RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|152959656|gb|ABS47117.1| beta-hexosaminidase [Yersinia pseudotuberculosis IP 31758] gi|169750475|gb|ACA67993.1| glycoside hydrolase family 3 domain protein [Yersinia pseudotuberculosis YPIII] Length = 343 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I F P +A A+ F R Sbjct: 104 MAAEMMAMDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQARIMAECFIRGMH 154 >gi|108807902|ref|YP_651818.1| beta-hexosaminidase [Yersinia pestis Antiqua] gi|108812176|ref|YP_647943.1| beta-hexosaminidase [Yersinia pestis Nepal516] gi|145599114|ref|YP_001163190.1| beta-hexosaminidase [Yersinia pestis Pestoides F] gi|167468519|ref|ZP_02333223.1| beta-hexosaminidase [Yersinia pestis FV-1] gi|108775824|gb|ABG18343.1| beta-N-acetylhexosaminidase. Glycosyl Hydrolase family 3 [Yersinia pestis Nepal516] gi|108779815|gb|ABG13873.1| beta-N-acetylhexosaminidase. Glycosyl Hydrolase family 3 [Yersinia pestis Antiqua] gi|145210810|gb|ABP40217.1| beta-N-acetylhexosaminidase. Glycosyl Hydrolase family 3 [Yersinia pestis Pestoides F] Length = 339 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I F P +A A+ F R Sbjct: 100 MAAEMMAMDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQARIMAECFIRGMH 150 >gi|51596771|ref|YP_070962.1| beta-hexosaminidase [Yersinia pseudotuberculosis IP 32953] gi|186895839|ref|YP_001872951.1| beta-hexosaminidase [Yersinia pseudotuberculosis PB1/+] gi|81639153|sp|Q669N5|NAGZ_YERPS RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724457|sp|B2K731|NAGZ_YERPB RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|51590053|emb|CAH21687.1| beta-hexosaminidase [Yersinia pseudotuberculosis IP 32953] gi|186698865|gb|ACC89494.1| glycoside hydrolase family 3 domain protein [Yersinia pseudotuberculosis PB1/+] Length = 343 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I F P +A A+ F R Sbjct: 104 MAAEMMAMDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQARIMAECFIRGMH 154 >gi|149366531|ref|ZP_01888565.1| beta-hexosaminidase [Yersinia pestis CA88-4125] gi|218928751|ref|YP_002346626.1| beta-hexosaminidase [Yersinia pestis CO92] gi|229841600|ref|ZP_04461758.1| beta-N-acetylglucosaminidase [Yersinia pestis biovar Orientalis str. PEXU2] gi|229843716|ref|ZP_04463859.1| beta-N-acetylglucosaminidase [Yersinia pestis biovar Orientalis str. India 195] gi|229894460|ref|ZP_04509642.1| beta-N-acetylglucosaminidase [Yersinia pestis Pestoides A] gi|229902500|ref|ZP_04517619.1| beta-N-acetylglucosaminidase [Yersinia pestis Nepal516] gi|21362698|sp|Q8ZFS3|NAGZ_YERPE RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|115347362|emb|CAL20260.1| beta-hexosaminidase [Yersinia pestis CO92] gi|149290905|gb|EDM40980.1| beta-hexosaminidase [Yersinia pestis CA88-4125] gi|229680546|gb|EEO76643.1| beta-N-acetylglucosaminidase [Yersinia pestis Nepal516] gi|229689324|gb|EEO81387.1| beta-N-acetylglucosaminidase [Yersinia pestis biovar Orientalis str. India 195] gi|229694063|gb|EEO84111.1| beta-N-acetylglucosaminidase [Yersinia pestis biovar Orientalis str. PEXU2] gi|229703479|gb|EEO90496.1| beta-N-acetylglucosaminidase [Yersinia pestis Pestoides A] gi|320014756|gb|ADV98327.1| beta-N-acetylglucosaminidase [Yersinia pestis biovar Medievalis str. Harbin 35] Length = 343 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I F P +A A+ F R Sbjct: 104 MAAEMMAMDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQARIMAECFIRGMH 154 >gi|22125668|ref|NP_669091.1| beta-hexosaminidase [Yersinia pestis KIM 10] gi|45442029|ref|NP_993568.1| beta-hexosaminidase [Yersinia pestis biovar Microtus str. 91001] gi|270490322|ref|ZP_06207396.1| glycosyl hydrolase family 3 N-terminal domain protein [Yersinia pestis KIM D27] gi|21958581|gb|AAM85342.1|AE013780_6 hypothetical protein y1775 [Yersinia pestis KIM 10] gi|45436892|gb|AAS62445.1| beta-hexosaminidase [Yersinia pestis biovar Microtus str. 91001] gi|270338826|gb|EFA49603.1| glycosyl hydrolase family 3 N-terminal domain protein [Yersinia pestis KIM D27] Length = 345 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I F P +A A+ F R Sbjct: 106 MAAEMMAMDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQARIMAECFIRGMH 156 >gi|288575523|ref|ZP_05977115.2| beta-N-acetylhexosaminidase [Neisseria mucosa ATCC 25996] gi|288567848|gb|EFC89408.1| beta-N-acetylhexosaminidase [Neisseria mucosa ATCC 25996] Length = 350 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L GI+++F+PVLDL +G I F R + A + Sbjct: 103 LATELTACGIDLSFTPVLDLDWGTCPVIG--NRSFHRNVDTVTQLALALQKGLN 154 >gi|146306621|ref|YP_001187086.1| beta-hexosaminidase [Pseudomonas mendocina ymp] gi|145574822|gb|ABP84354.1| glycoside hydrolase, family 3 domain protein [Pseudomonas mendocina ymp] Length = 336 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ G++++F+PVLDL + + F P +A A F R + Sbjct: 105 MATEVMAVGLDLSFAPVLDLDHQRSAVVGS--RAFEGDPQRAAALAAAFIRGMHQ 157 >gi|212634580|ref|YP_002311105.1| beta-hexosaminidase [Shewanella piezotolerans WP3] gi|212556064|gb|ACJ28518.1| Beta-hexosaminidase [Shewanella piezotolerans WP3] Length = 331 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++F+PVLDL G I + FS A+ E+ A F + + Sbjct: 101 MAIELLAVDIDLSFAPVLDLN-GISQVIGK--RSFSCDKAEVEQLATAFIKGMEQ 152 >gi|195938866|ref|ZP_03084248.1| beta-hexosaminidase [Escherichia coli O157:H7 str. EC4024] Length = 337 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA + F + Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPEKALAISSRFIDGMHE 151 >gi|238758403|ref|ZP_04619580.1| Beta-hexosaminidase [Yersinia aldovae ATCC 35236] gi|238703307|gb|EEP95847.1| Beta-hexosaminidase [Yersinia aldovae ATCC 35236] Length = 338 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I F P +A A+ F R Sbjct: 100 MAAEMMAMDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQALVMAECFIRGMH 150 >gi|293391859|ref|ZP_06636193.1| beta-hexosaminidase [Aggregatibacter actinomycetemcomitans D7S-1] gi|290952393|gb|EFE02512.1| beta-hexosaminidase [Aggregatibacter actinomycetemcomitans D7S-1] Length = 348 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F A + A F R + Sbjct: 105 MAAEMTALDIDLSFAPVLDLGHQCKAI---GDRSFGGDVKSAVDLAANFIRGMHQ 156 >gi|170287924|ref|YP_001738162.1| glycoside hydrolase family 3 protein [Thermotoga sp. RQ2] gi|170175427|gb|ACB08479.1| glycoside hydrolase family 3 domain protein [Thermotoga sp. RQ2] Length = 465 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K + G N+ F+PVLDLL + + + P E Y++ Sbjct: 98 GKIMEIVGFNMVFAPVLDLLSEESSSVIDM-RSYGSDPKIVAEHGAKACEGYLE 150 >gi|281411560|ref|YP_003345639.1| glycoside hydrolase family 3 domain protein [Thermotoga naphthophila RKU-10] gi|281372663|gb|ADA66225.1| glycoside hydrolase family 3 domain protein [Thermotoga naphthophila RKU-10] Length = 465 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K + G N+ F+PVLDLL + + + P E Y++ Sbjct: 98 GKIMEIVGFNMVFAPVLDLLSEESSSVIDM-RSYGSDPKIVAEHGAKACEGYLE 150 >gi|148269264|ref|YP_001243724.1| glycoside hydrolase family 3 protein [Thermotoga petrophila RKU-1] gi|147734808|gb|ABQ46148.1| glycoside hydrolase, family 3 domain protein [Thermotoga petrophila RKU-1] Length = 467 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K + G N+ F+PVLDLL + + + P E Y++ Sbjct: 100 GKIMEIVGFNMVFAPVLDLLSEESSSVIDM-RSYGSDPKIVAEHGAKACEGYLE 152 >gi|84500945|ref|ZP_00999180.1| beta-N-acetylhexosaminidase, putative [Oceanicola batsensis HTCC2597] gi|84391012|gb|EAQ03430.1| beta-N-acetylhexosaminidase, putative [Oceanicola batsensis HTCC2597] Length = 334 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A L + GI+VN +P++D+ + PA+A + + Sbjct: 107 ALELRSYGIDVNCAPMVDVPRPETHD-FLTDRCYGTTPAEAAGLGRAVAMGLQ 158 >gi|239618351|ref|YP_002941673.1| Beta-N-acetylhexosaminidase [Kosmotoga olearia TBF 19.5.1] gi|239507182|gb|ACR80669.1| Beta-N-acetylhexosaminidase [Kosmotoga olearia TBF 19.5.1] Length = 504 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +AK + GI+ + +PV+D+ P FS E + F++ +N Sbjct: 107 LAKEMRAVGIDWDLAPVVDINNNPNNPGIGV-RSFSSDVNTVVEFGRKFTKGLQEN 161 >gi|227326866|ref|ZP_03830890.1| beta-hexosaminidase [Pectobacterium carotovorum subsp. carotovorum WPP14] Length = 335 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + F P A AQ F R Sbjct: 100 MAAEMIAMDIDISFAPVLDIGHQSAAI---GERSFHANPETALAVAQSFIRGMH 150 >gi|38234715|ref|NP_940482.1| putative secreted glycosyl hydrolase [Corynebacterium diphtheriae NCTC 13129] gi|38200979|emb|CAE50699.1| Putative secreted glycosyl hydrolase [Corynebacterium diphtheriae] Length = 387 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M ++L GINVNF+PV+D+ + FS P A F++ Sbjct: 174 MGRSLFAHGINVNFAPVVDIE-AGLEVVG--DRAFSPDPLIDATYATAFAQGMAD 225 >gi|260944894|ref|XP_002616745.1| hypothetical protein CLUG_03986 [Clavispora lusitaniae ATCC 42720] gi|238850394|gb|EEQ39858.1| hypothetical protein CLUG_03986 [Clavispora lusitaniae ATCC 42720] Length = 985 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G +V PVLD++ + F + +R Sbjct: 115 ARELRHIGFSVILGPVLDVVTKMSAQLVSV-RSFGSSVEDVARYGRACARGLRD 167 >gi|239993077|ref|ZP_04713601.1| beta-hexosaminidase [Alteromonas macleodii ATCC 27126] Length = 336 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L T I+ +F+PVLD+ G I FS A + Sbjct: 101 LAYELKTLDIDFSFAPVLDIN-GVSQVIG--DRAFSDNADDVIRLAAHLIQGLK 151 >gi|159184881|ref|NP_354697.2| glycosyl hydrolase [Agrobacterium tumefaciens str. C58] gi|159140161|gb|AAK87482.2| glycosyl hydrolase [Agrobacterium tumefaciens str. C58] Length = 338 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L GINV+ PVLD+ + + + P E Q + Sbjct: 112 AFDLTKFGINVDCLPVLDVPVEGASNVIG-NRAYGYTPTMVAEMGQAAADGLK 163 >gi|37526712|ref|NP_930056.1| beta-hexosaminidase [Photorhabdus luminescens subsp. laumondii TTO1] gi|47605817|sp|Q7N397|NAGZ_PHOLL RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|36786144|emb|CAE15196.1| Beta-hexosaminidase (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) [Photorhabdus luminescens subsp. laumondii TTO1] Length = 340 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLDL + F P +A+ A+ F + Sbjct: 104 MASEMIAMDIDISFAPVLDLGHQCAAI---GERSFHEDPEQAKMMAEHFIKGMH 154 >gi|238783782|ref|ZP_04627801.1| Beta-hexosaminidase [Yersinia bercovieri ATCC 43970] gi|238715333|gb|EEQ07326.1| Beta-hexosaminidase [Yersinia bercovieri ATCC 43970] Length = 315 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + + I+++F+PVLD+ + I F P +A A+ F R Sbjct: 79 MAAEMTSMDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQALHMAECFIRGMH 129 >gi|146329366|ref|YP_001208959.1| beta-hexosaminidase [Dichelobacter nodosus VCS1703A] gi|146232836|gb|ABQ13814.1| beta-hexosaminidase [Dichelobacter nodosus VCS1703A] Length = 334 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L I+ +F+PVLDL T I F PA + R Sbjct: 104 LAYELRAQSIDFSFAPVLDLYDPKSTVIG--DRAFHENPAIVSVLSCSMRRGMK 155 >gi|328543809|ref|YP_004303918.1| glycoside hydrolase, family 3-like protein [polymorphum gilvum SL003B-26A1] gi|326413553|gb|ADZ70616.1| Glycoside hydrolase, family 3-like protein [Polymorphum gilvum SL003B-26A1] Length = 341 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A +L GI V+ P+LD+ +S PA + Sbjct: 109 IADDLHDLGITVDCLPLLDVGRPETVDAIG-DRAYSPDPAAVAALGRATCDGL 160 >gi|294794281|ref|ZP_06759417.1| beta-N-acetylhexosaminidase (beta-hexosaminidase) [Veillonella sp. 3_1_44] gi|294454611|gb|EFG22984.1| beta-N-acetylhexosaminidase (beta-hexosaminidase) [Veillonella sp. 3_1_44] Length = 381 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 20/54 (37%), Gaps = 7/54 (12%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G N+NF+PV DL +S P + A S+ Y + Sbjct: 166 GAELKDLGFNINFAPVADLGL-------TYGRSYSTNPDEVVRYAGAVSKAYDE 212 >gi|88857190|ref|ZP_01131833.1| Beta-glucosidase-related glycosidase [Pseudoalteromonas tunicata D2] gi|88820387|gb|EAR30199.1| Beta-glucosidase-related glycosidase [Pseudoalteromonas tunicata D2] Length = 538 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 9/51 (17%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 A+ + + G N SP D+ P+ I + F + Sbjct: 124 AQQMQSIGYNTLLSPCADVNADPKNPIIG-QRAFGETAEHVASHVAAAVKG 173 >gi|325577785|ref|ZP_08148060.1| beta-hexosaminidase [Haemophilus parainfluenzae ATCC 33392] gi|325160530|gb|EGC72656.1| beta-hexosaminidase [Haemophilus parainfluenzae ATCC 33392] Length = 347 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA +V I+++F+PVLDL + F A A F + Sbjct: 105 MAAEMVALDIDLSFAPVLDLGHECRAI---GDRSFGCDVKSAVNLAAAFIDGMHQ 156 >gi|301154692|emb|CBW14155.1| beta N-acetyl-glucosaminidase [Haemophilus parainfluenzae T3T1] Length = 347 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA +V I+++F+PVLDL + F A A F + Sbjct: 105 MAAEMVALDIDLSFAPVLDLGHECRAI---GDRSFGCDVKSAVNLAAAFIDGMHQ 156 >gi|317484721|ref|ZP_07943622.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bilophila wadsworthia 3_1_6] gi|316924077|gb|EFV45262.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bilophila wadsworthia 3_1_6] Length = 379 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETF-IAQKRSIFSRIPA 40 M + L G+N+NF+PVLD+ P + I + FS P Sbjct: 156 MGRMLRELGVNLNFAPVLDVNVYPASPAIGRLGRSFSAAPQ 196 >gi|254294991|ref|YP_003061014.1| glycoside hydrolase [Hirschia baltica ATCC 49814] gi|254043522|gb|ACT60317.1| glycoside hydrolase family 3 domain protein [Hirschia baltica ATCC 49814] Length = 564 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A G + F+PV+DL + + K E A+++ R ++ Sbjct: 132 ALESRALGYDWTFTPVVDLNVAFRNAVVGT-RSYGSDVEKVREQARVYVRVLQEH 185 >gi|269794479|ref|YP_003313934.1| beta-glucosidase-like glycosyl hydrolase [Sanguibacter keddieii DSM 10542] gi|269096664|gb|ACZ21100.1| beta-glucosidase-like glycosyl hydrolase [Sanguibacter keddieii DSM 10542] Length = 785 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ T GI+ +PVLD++ P + + P + + Sbjct: 147 IGTSMRTLGIHQGLAPVLDVIRDPR--WGRVDECIAEDPYVVGTIGTAYVQGLQ 198 >gi|148978547|ref|ZP_01814999.1| beta-hexosaminidase [Vibrionales bacterium SWAT-3] gi|145962336|gb|EDK27617.1| beta-hexosaminidase [Vibrionales bacterium SWAT-3] Length = 329 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + F + Sbjct: 101 MAAELIAHDIDLSFAPVLDKGHQCKAI---GNRAFGEDIDTIVRHSSAFIKGMK 151 >gi|52424451|ref|YP_087588.1| beta-hexosaminidase [Mannheimia succiniciproducens MBEL55E] gi|81387535|sp|Q65VK7|NAGZ_MANSM RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|52306503|gb|AAU37003.1| BglX protein [Mannheimia succiniciproducens MBEL55E] Length = 347 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F A A F + Sbjct: 105 MAAEMTALDIDLSFAPVLDLGHECKAI---GDRSFCEEVEPAVRLASAFIDGMHQ 156 >gi|163741409|ref|ZP_02148800.1| beta-N-acetylhexosaminidase, putative [Phaeobacter gallaeciensis 2.10] gi|161385143|gb|EDQ09521.1| beta-N-acetylhexosaminidase, putative [Phaeobacter gallaeciensis 2.10] Length = 352 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+ N +P+ D+ K + A+ + + Sbjct: 124 IADELRDLGIDSNCAPLADVAGEGTHP-FLKNRCYGTDLTTVVTRARATAEGLLD 177 >gi|307263782|ref|ZP_07545388.1| Beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 13 str. N273] gi|306870903|gb|EFN02641.1| Beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 13 str. N273] Length = 353 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F P A+ F + Sbjct: 111 MAAEMFALDIDLSFAPVLDLGHQCKAI---GDRSFGENPDAMLPIAEAFIDGMRE 162 >gi|307257164|ref|ZP_07538936.1| Beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 10 str. D13039] gi|306864326|gb|EFM96237.1| Beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 10 str. D13039] Length = 353 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F P A+ F + Sbjct: 111 MAAEMFALDIDLSFAPVLDLGHQCKAI---GDRSFGENPDAMLPIAEAFIDGMRE 162 >gi|307252749|ref|ZP_07534640.1| Beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306859781|gb|EFM91803.1| Beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 6 str. Femo] Length = 353 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F P A+ F + Sbjct: 111 MAAEMFALDIDLSFAPVLDLGHQCKAI---GDRSFGENPDAMLPIAEAFIDGMRE 162 >gi|307250367|ref|ZP_07532315.1| Beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|306857577|gb|EFM89685.1| Beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 4 str. M62] Length = 353 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F P A+ F + Sbjct: 111 MAAEMFALDIDLSFAPVLDLGHQCKAI---GDRSFGENPDAMLPIAEAFIDGMRE 162 >gi|303250140|ref|ZP_07336342.1| beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|302651203|gb|EFL81357.1| beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 6 str. Femo] Length = 345 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F P A+ F + Sbjct: 103 MAAEMFALDIDLSFAPVLDLGHQCKAI---GDRSFGENPDAMLPIAEAFIDGMRE 154 >gi|303253314|ref|ZP_07339463.1| beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|307248134|ref|ZP_07530162.1| Beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|302647996|gb|EFL78203.1| beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|306855311|gb|EFM87486.1| Beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 2 str. S1536] Length = 345 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F P A+ F + Sbjct: 103 MAAEMFALDIDLSFAPVLDLGHQCKAI---GDRSFGENPDAMLPIAEAFIDGMRE 154 >gi|165976537|ref|YP_001652130.1| beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] gi|226724429|sp|B0BQ51|NAGZ_ACTPJ RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|165876638|gb|ABY69686.1| beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] Length = 345 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F P A+ F + Sbjct: 103 MAAEMFALDIDLSFAPVLDLGHQCKAI---GDRSFGENPDAMLPIAEAFIDGMRE 154 >gi|126208583|ref|YP_001053808.1| beta-hexosaminidase [Actinobacillus pleuropneumoniae L20] gi|190150437|ref|YP_001968962.1| beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|166233254|sp|A3N1B7|NAGZ_ACTP2 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|226724428|sp|B3GXZ7|NAGZ_ACTP7 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|126097375|gb|ABN74203.1| beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 5b str. L20] gi|189915568|gb|ACE61820.1| beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] Length = 345 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F P A+ F + Sbjct: 103 MAAEMFALDIDLSFAPVLDLGHQCKAI---GDRSFGENPDAMLPIAEAFIDGMRE 154 >gi|32035523|ref|ZP_00135466.1| COG1472: Beta-glucosidase-related glycosidases [Actinobacillus pleuropneumoniae serovar 1 str. 4074] Length = 161 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F P A+ F + Sbjct: 103 MAAEMFALDIDLSFAPVLDLGHQCKAI---GDRSFGENPDAMLPIAEAFIDGMRE 154 >gi|317047722|ref|YP_004115370.1| glycoside hydrolase family 3 domain-containing protein [Pantoea sp. At-9b] gi|316949339|gb|ADU68814.1| glycoside hydrolase family 3 domain protein [Pantoea sp. At-9b] Length = 347 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I F P A + A+ F + Sbjct: 109 MAAEMIALDIDISFAPVLDIGH-ISAAIG--DRSFHADPQIALQVARRFIAGMHE 160 >gi|238762208|ref|ZP_04623180.1| Beta-hexosaminidase [Yersinia kristensenii ATCC 33638] gi|238699555|gb|EEP92300.1| Beta-hexosaminidase [Yersinia kristensenii ATCC 33638] Length = 338 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA +++ I+++F+PVLD+ + I F P +A+ A+ F R Sbjct: 100 MAAEMISMDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQAQNMAECFIRGMH 150 >gi|324007842|gb|EGB77061.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 57-2] Length = 337 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I + P KA A F + Sbjct: 100 MASEIIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPQKALAIASRFIDGMHE 151 >gi|308176002|ref|YP_003915408.1| xylan 1,4-beta-xylosidase [Arthrobacter arilaitensis Re117] gi|307743465|emb|CBT74437.1| xylan 1,4-beta-xylosidase [Arthrobacter arilaitensis Re117] Length = 776 Score = 48.6 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + +++ G++ SPVLD+ + P E A + R Sbjct: 152 IGADMLKMGVHQGLSPVLDVTRDYR--WGRVEETMGEDPHLVGELAVAYVRGLQD 204 >gi|218708580|ref|YP_002416201.1| beta-hexosaminidase [Vibrio splendidus LGP32] gi|218321599|emb|CAV17551.1| Beta-hexosaminidase (N-acetyl-beta-glucosaminidase) [Vibrio splendidus LGP32] Length = 325 Score = 48.6 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + F + Sbjct: 101 MAAELIAHDIDLSFAPVLDKGHDCKAI---GSRAFGEDIDTIVRHSSAFIKGMK 151 >gi|291456460|ref|ZP_06595850.1| putative beta-N-acetylhexosaminidase [Bifidobacterium breve DSM 20213] gi|291381737|gb|EFE89255.1| putative beta-N-acetylhexosaminidase [Bifidobacterium breve DSM 20213] Length = 246 Score = 48.6 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 17/55 (30%), Gaps = 3/55 (5%) Query: 2 AKNLVTSGINVNFSPVLD---LLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 L +GINV+ +PVL + I F A F + Sbjct: 23 GSQLAAAGINVDLAPVLGTVVVNRAANAPIGALYRDFGLDTAGNAAHGTAFVQGM 77 >gi|15643572|ref|NP_228618.1| hydrolase, putative [Thermotoga maritima MSB8] gi|4981339|gb|AAD35891.1|AE001748_7 hydrolase, putative [Thermotoga maritima MSB8] gi|206598087|gb|ACI15900.1| beta-N-acetylglucosaminidase [Thermotoga maritima MSB8] Length = 467 Score = 48.6 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K + G+N+ F+PVLDLL + + + P E Y++ Sbjct: 100 GKIMEIVGLNMVFAPVLDLLSEESSSVI-DIRSYGSDPKIVAEHGARACEGYLE 152 >gi|190345281|gb|EDK37143.2| hypothetical protein PGUG_01241 [Meyerozyma guilliermondii ATCC 6260] Length = 990 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 16/55 (29%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L G ++ PVLD++ + F +R Sbjct: 111 LATELKHIGFSMILGPVLDVVTKLSHQLVGV-RSFGTTLESVTRYGMACARGLQD 164 >gi|150864611|ref|XP_001383504.2| glycosyl hyrolase, family 3-like protein [Scheffersomyces stipitis CBS 6054] gi|149385867|gb|ABN65475.2| glycosyl hyrolase, family 3-like protein [Scheffersomyces stipitis CBS 6054] Length = 1010 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L G ++ PVLD++ + F + +Q ++ + Sbjct: 119 IAIELKNIGFSIILGPVLDVVTKLSHQLVGV-RSFGTTIEDVSKYSQACAKGLQE 172 >gi|90419382|ref|ZP_01227292.1| beta-hexosaminidase [Aurantimonas manganoxydans SI85-9A1] gi|90336319|gb|EAS50060.1| beta-hexosaminidase [Aurantimonas manganoxydans SI85-9A1] Length = 398 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A +++ GIN + P LD+ + + Q + + Sbjct: 170 LAADIMVYGINADCVPCLDVPVQGANSVIG-DRAYGLDGDTVAALGQAVADGF 221 >gi|238791846|ref|ZP_04635483.1| Beta-hexosaminidase [Yersinia intermedia ATCC 29909] gi|238728950|gb|EEQ20467.1| Beta-hexosaminidase [Yersinia intermedia ATCC 29909] Length = 338 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I F P +A A+ F R Sbjct: 100 MAAEMIAMDIDISFAPVLDIGH-VSAAIG--ERSFHSEPQQALAMAECFIRGMH 150 >gi|320535800|ref|ZP_08035881.1| glycosyl hydrolase family 3 protein [Treponema phagedenis F0421] gi|320147348|gb|EFW38883.1| glycosyl hydrolase family 3 protein [Treponema phagedenis F0421] Length = 576 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 14/54 (25%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 V G N NF P D+L I + + + + Sbjct: 130 GAEAVALGCNWNFDPCADILTNWRNTIVNT-RAYGTNADTVLRYILPYVKGLRQ 182 >gi|262401610|ref|ZP_06078176.1| beta N-acetyl-glucosaminidase [Vibrio sp. RC586] gi|262352027|gb|EEZ01157.1| beta N-acetyl-glucosaminidase [Vibrio sp. RC586] Length = 330 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLKHSSAFLRGMK 151 >gi|262191821|ref|ZP_06049992.1| beta N-acetyl-glucosaminidase [Vibrio cholerae CT 5369-93] gi|262032308|gb|EEY50875.1| beta N-acetyl-glucosaminidase [Vibrio cholerae CT 5369-93] Length = 330 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLKHSSAFLRGMK 151 >gi|242556560|pdb|3GS6|A Chain A, Vibrio Cholerea Family 3 Glycoside Hydrolase (Nagz)in Complex With N-Butyryl-Pugnac gi|242556562|pdb|3GSM|A Chain A, Vibrio Cholerae Family 3 Glycoside Hydrolase (Nagz) Bound To N-Valeryl-Pugnac Length = 340 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLKHSSAFLRGMK 151 >gi|229512418|ref|ZP_04401892.1| beta N-acetyl-glucosaminidase [Vibrio cholerae TMA 21] gi|229350568|gb|EEO15514.1| beta N-acetyl-glucosaminidase [Vibrio cholerae TMA 21] Length = 330 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLKHSSAFLRGMK 151 >gi|229519964|ref|ZP_04409394.1| beta N-acetyl-glucosaminidase [Vibrio cholerae TM 11079-80] gi|229343016|gb|EEO08004.1| beta N-acetyl-glucosaminidase [Vibrio cholerae TM 11079-80] Length = 330 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLKHSSAFLRGMK 151 >gi|229525343|ref|ZP_04414748.1| beta N-acetyl-glucosaminidase [Vibrio cholerae bv. albensis VL426] gi|229338924|gb|EEO03941.1| beta N-acetyl-glucosaminidase [Vibrio cholerae bv. albensis VL426] Length = 330 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLKHSSAFLRGMK 151 >gi|254291969|ref|ZP_04962749.1| beta-N-acetylhexosaminidase [Vibrio cholerae AM-19226] gi|150422108|gb|EDN14075.1| beta-N-acetylhexosaminidase [Vibrio cholerae AM-19226] Length = 330 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLKHSSAFLRGMK 151 >gi|153826758|ref|ZP_01979425.1| beta-N-acetylhexosaminidase [Vibrio cholerae MZO-2] gi|149739409|gb|EDM53649.1| beta-N-acetylhexosaminidase [Vibrio cholerae MZO-2] Length = 330 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLKHSSAFLRGMK 151 >gi|149242757|pdb|2OXN|A Chain A, Vibrio Cholerae Family 3 Glycoside Hydrolase (Nagz) In Complex With Pugnac Length = 340 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLKHSSAFLRGMK 151 >gi|153829365|ref|ZP_01982032.1| beta-N-acetylhexosaminidase [Vibrio cholerae 623-39] gi|261212200|ref|ZP_05926486.1| beta N-acetyl-glucosaminidase [Vibrio sp. RC341] gi|148875148|gb|EDL73283.1| beta-N-acetylhexosaminidase [Vibrio cholerae 623-39] gi|260838808|gb|EEX65459.1| beta N-acetyl-glucosaminidase [Vibrio sp. RC341] Length = 330 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLKHSSAFLRGMK 151 >gi|153801888|ref|ZP_01956474.1| beta-N-acetylhexosaminidase [Vibrio cholerae MZO-3] gi|124122599|gb|EAY41342.1| beta-N-acetylhexosaminidase [Vibrio cholerae MZO-3] Length = 330 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLKHSSAFLRGMK 151 >gi|153215127|ref|ZP_01949834.1| beta-N-acetylhexosaminidase [Vibrio cholerae 1587] gi|124114918|gb|EAY33738.1| beta-N-acetylhexosaminidase [Vibrio cholerae 1587] Length = 330 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLKHSSAFLRGMK 151 >gi|60594517|pdb|1Y65|A Chain A, Crystal Structure Of Beta-Hexosaminidase From Vibrio Cholerae In Complex With N-Acetyl-D-Glucosamine To A Resolution Of 1.85 Length = 342 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 103 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLKHSSAFLRGMK 153 >gi|121728791|ref|ZP_01681804.1| beta-N-acetylhexosaminidase [Vibrio cholerae V52] gi|147673776|ref|YP_001216186.1| beta-hexosaminidase [Vibrio cholerae O395] gi|262169990|ref|ZP_06037680.1| beta N-acetyl-glucosaminidase [Vibrio cholerae RC27] gi|172047691|sp|A5F8Y1|NAGZ_VIBC3 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|121628924|gb|EAX61378.1| beta-N-acetylhexosaminidase [Vibrio cholerae V52] gi|146315659|gb|ABQ20198.1| beta-N-acetylhexosaminidase [Vibrio cholerae O395] gi|227012517|gb|ACP08727.1| beta-hexosaminidase [Vibrio cholerae O395] gi|262021724|gb|EEY40435.1| beta N-acetyl-glucosaminidase [Vibrio cholerae RC27] Length = 330 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLKHSSAFLRGMK 151 >gi|15640711|ref|NP_230341.1| beta-hexosaminidase [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121587762|ref|ZP_01677522.1| beta-N-acetylhexosaminidase [Vibrio cholerae 2740-80] gi|153818707|ref|ZP_01971374.1| beta-N-acetylhexosaminidase [Vibrio cholerae NCTC 8457] gi|153822755|ref|ZP_01975422.1| beta-N-acetylhexosaminidase [Vibrio cholerae B33] gi|227080873|ref|YP_002809424.1| beta-hexosaminidase [Vibrio cholerae M66-2] gi|229505688|ref|ZP_04395198.1| beta N-acetyl-glucosaminidase [Vibrio cholerae BX 330286] gi|229508738|ref|ZP_04398231.1| beta N-acetyl-glucosaminidase [Vibrio cholerae B33] gi|229519512|ref|ZP_04408955.1| beta N-acetyl-glucosaminidase [Vibrio cholerae RC9] gi|229608707|ref|YP_002879355.1| beta-hexosaminidase [Vibrio cholerae MJ-1236] gi|254851023|ref|ZP_05240373.1| beta-hexosaminidase [Vibrio cholerae MO10] gi|255743850|ref|ZP_05417806.1| beta N-acetyl-glucosaminidase [Vibrio cholera CIRS 101] gi|262156069|ref|ZP_06029188.1| beta N-acetyl-glucosaminidase [Vibrio cholerae INDRE 91/1] gi|298500805|ref|ZP_07010608.1| beta-N-acetylhexosaminidase [Vibrio cholerae MAK 757] gi|13959412|sp|Q9KU37|NAGZ_VIBCH RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|254766764|sp|C3LSU7|NAGZ_VIBCM RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|9655132|gb|AAF93857.1| beta-hexosaminidase [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121547989|gb|EAX58069.1| beta-N-acetylhexosaminidase [Vibrio cholerae 2740-80] gi|126510729|gb|EAZ73323.1| beta-N-acetylhexosaminidase [Vibrio cholerae NCTC 8457] gi|126519738|gb|EAZ76961.1| beta-N-acetylhexosaminidase [Vibrio cholerae B33] gi|227008761|gb|ACP04973.1| beta-hexosaminidase [Vibrio cholerae M66-2] gi|229344201|gb|EEO09176.1| beta N-acetyl-glucosaminidase [Vibrio cholerae RC9] gi|229354262|gb|EEO19192.1| beta N-acetyl-glucosaminidase [Vibrio cholerae B33] gi|229357911|gb|EEO22828.1| beta N-acetyl-glucosaminidase [Vibrio cholerae BX 330286] gi|229371362|gb|ACQ61785.1| beta N-acetyl-glucosaminidase [Vibrio cholerae MJ-1236] gi|254846728|gb|EET25142.1| beta-hexosaminidase [Vibrio cholerae MO10] gi|255738481|gb|EET93870.1| beta N-acetyl-glucosaminidase [Vibrio cholera CIRS 101] gi|262030105|gb|EEY48750.1| beta N-acetyl-glucosaminidase [Vibrio cholerae INDRE 91/1] gi|297540586|gb|EFH76644.1| beta-N-acetylhexosaminidase [Vibrio cholerae MAK 757] Length = 330 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLKHSSAFLRGMK 151 >gi|325261635|ref|ZP_08128373.1| beta-glucosidase [Clostridium sp. D5] gi|324033089|gb|EGB94366.1| beta-glucosidase [Clostridium sp. D5] Length = 731 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ GIN NF+P++D+ + P A A+ R Sbjct: 145 AEESRAYGINWNFAPMIDVARDAR--WGRVSEGPGEDPCLASAFARAKVRGLQD 196 >gi|308270553|emb|CBX27165.1| hypothetical protein N47_A11940 [uncultured Desulfobacterium sp.] Length = 360 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK L+ GIN++ +PV+D+ + F P + Sbjct: 141 AKELLGIGINMDMAPVIDVAPEGINSV-MAGRSFGCDPNWVSKMGVAVIENMQ 192 >gi|283784896|ref|YP_003364761.1| Beta-hexosaminidase [Citrobacter rodentium ICC168] gi|282948350|emb|CBG87935.1| Beta-hexosaminidase [Citrobacter rodentium ICC168] Length = 341 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I + PAKA A F Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERAYHADPAKALAMATRFIDGMH 154 >gi|163735839|ref|ZP_02143268.1| beta-hexosaminidase, putative [Roseobacter litoralis Och 149] gi|161390925|gb|EDQ15265.1| beta-hexosaminidase, putative [Roseobacter litoralis Och 149] Length = 332 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L GI+ N +P++D+ + + + + + Sbjct: 107 IAAELHDLGIDCNCAPMVDIASADTHD-FLRNRCYGTDANSVAMLGRAAAEGML 159 >gi|169350057|ref|ZP_02866995.1| hypothetical protein CLOSPI_00797 [Clostridium spiroforme DSM 1552] gi|169293270|gb|EDS75403.1| hypothetical protein CLOSPI_00797 [Clostridium spiroforme DSM 1552] Length = 1164 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L + G+N NF+P D+ P + FS P A + + Sbjct: 184 IGSELSSVGVNTNFAPDADVNNNPNNPVIGL-RSFSSDPQLAAKFTTAYIEGVQ 236 >gi|161503698|ref|YP_001570810.1| beta-hexosaminidase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980] gi|160865045|gb|ABX21668.1| hypothetical protein SARI_01782 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] Length = 337 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + + PAKA A F Sbjct: 100 MASEMIAMDIDISFAPVLDVGHICAAI---GERSYHADPAKALAVATRFIDGMHD 151 >gi|114327922|ref|YP_745079.1| anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Granulibacter bethesdensis CGDNIH1] gi|114316096|gb|ABI62156.1| anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Granulibacter bethesdensis CGDNIH1] Length = 348 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + +G +V +PVLDLL I + P + Sbjct: 107 IGLDCMGAGFDVVCAPVLDLLVPGAHDIVG-DRAYGTDPGTVTLLGGAVMEGLL 159 >gi|326561529|gb|EGE11872.1| beta-hexosaminidase [Moraxella catarrhalis 7169] gi|326563594|gb|EGE13847.1| beta-hexosaminidase [Moraxella catarrhalis 12P80B1] gi|326566143|gb|EGE16299.1| beta-hexosaminidase [Moraxella catarrhalis 103P14B1] gi|326567999|gb|EGE18091.1| beta-hexosaminidase [Moraxella catarrhalis BC7] gi|326570698|gb|EGE20732.1| beta-hexosaminidase [Moraxella catarrhalis BC1] gi|326571254|gb|EGE21277.1| beta-hexosaminidase [Moraxella catarrhalis BC8] gi|326573064|gb|EGE23037.1| beta-hexosaminidase [Moraxella catarrhalis CO72] gi|326577238|gb|EGE27131.1| beta-hexosaminidase [Moraxella catarrhalis 101P30B1] gi|326577823|gb|EGE27691.1| beta-hexosaminidase [Moraxella catarrhalis O35E] Length = 357 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ G++ +F+PVLD+ ++ + F P ++ F Sbjct: 107 MACEVLAVGVDFSFAPVLDID--GKSLVIG-DRAFHANPDAIITLSRQFMDGMKN 158 >gi|240143765|ref|ZP_04742366.1| glycosyl hydrolase domain protein [Roseburia intestinalis L1-82] gi|257204234|gb|EEV02519.1| glycosyl hydrolase domain protein [Roseburia intestinalis L1-82] Length = 430 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 10/45 (22%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEES 45 + L G NV+++PV D+L P F + + Sbjct: 213 IGTYLKQLGFNVDYAPVADVLTNPGNTAIGT-RSFGSDASVVADM 256 >gi|325293094|ref|YP_004278958.1| glycosyl hydrolase [Agrobacterium sp. H13-3] gi|325060947|gb|ADY64638.1| glycosyl hydrolase [Agrobacterium sp. H13-3] Length = 338 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ GIN++ PVLD+ + + + P E Q + Sbjct: 112 AFDLMKFGINIDCLPVLDVPVEGASNVIG-NRAYGYSPTMVAEMGQAAADGLK 163 >gi|320538791|ref|ZP_08038468.1| putative beta N-acetyl-glucosaminidase [Serratia symbiotica str. Tucson] gi|320031136|gb|EFW13138.1| putative beta N-acetyl-glucosaminidase [Serratia symbiotica str. Tucson] Length = 346 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ +G F P +A A+ F + Sbjct: 104 MAAEMIAQDIDISFAPVLDIGHGSAAI---GERAFHSDPQQALAMAEYFIQGMR 154 >gi|197106387|ref|YP_002131764.1| 1,4-beta-D-glucan glucohydrolase D [Phenylobacterium zucineum HLK1] gi|196479807|gb|ACG79335.1| 1,4-beta-D-glucan glucohydrolase D [Phenylobacterium zucineum HLK1] Length = 828 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 17/57 (29%), Gaps = 2/57 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 A GI+ F P + ++ + +S P A+ P+ Sbjct: 174 AVEAAAVGIDWAFGPTVAVVRDDR--WGRTYESYSEDPQLVATYARALVEGLQGAPR 228 >gi|330469491|ref|YP_004407234.1| glycoside hydrolase family 3 domain-containing protein [Verrucosispora maris AB-18-032] gi|328812462|gb|AEB46634.1| glycoside hydrolase family 3 domain protein [Verrucosispora maris AB-18-032] Length = 582 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GINV+F+PV D+L I F P +A + R Sbjct: 214 GTELAAMGINVDFAPVADVLVTRSAVIGS--RSFGADPQRAGQQVGGAVRGLQ 264 >gi|70993214|ref|XP_751454.1| glycosyl hydrolase [Aspergillus fumigatus Af293] gi|66849088|gb|EAL89416.1| glycosyl hydrolase, putative [Aspergillus fumigatus Af293] gi|159125614|gb|EDP50731.1| glycosyl hydrolase, putative [Aspergillus fumigatus A1163] Length = 354 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 19/53 (35%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A L G+N N +PVL + F+ + + A+ F R Sbjct: 132 ATTLAQYGVNANLAPVLGVYRSAGDFLDEYGRSYGNSSELVASCAEAFIRNQQ 184 >gi|307261593|ref|ZP_07543261.1| Beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 12 str. 1096] gi|306868716|gb|EFN00525.1| Beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 12 str. 1096] Length = 353 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F P A+ F + Sbjct: 111 MAAEMFALDIDLSFAPVLDLGHQCKAI---GDRSFGENPDSMLPIAEAFIDGMRE 162 >gi|307259444|ref|ZP_07541169.1| Beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 11 str. 56153] gi|306866380|gb|EFM98243.1| Beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 11 str. 56153] Length = 353 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F P A+ F + Sbjct: 111 MAAEMFALDIDLSFAPVLDLGHQCKAI---GDRSFGENPDSMLPIAEAFIDGMRE 162 >gi|307255008|ref|ZP_07536826.1| Beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|306861881|gb|EFM93857.1| Beta-hexosaminidase [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] Length = 357 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F P A+ F + Sbjct: 115 MAAEMFALDIDLSFAPVLDLGHQCKAI---GDRSFGENPDSMLPIAEAFIDGMRE 166 >gi|254283994|ref|ZP_04958962.1| hypothetical protein NOR51B_2498 [gamma proteobacterium NOR51-B] gi|219680197|gb|EED36546.1| hypothetical protein NOR51B_2498 [gamma proteobacterium NOR51-B] Length = 341 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + +L GI+V+ +PVLD+ + P + Sbjct: 108 LGLDLAEVGISVDCAPVLDVPAAGAHSVIG-DRALGTTPEQIGLLGGAVLEGLAD 161 >gi|330468743|ref|YP_004406486.1| glycoside hydrolase family 3 domain-containing protein [Verrucosispora maris AB-18-032] gi|328811714|gb|AEB45886.1| glycoside hydrolase family 3 domain-containing protein [Verrucosispora maris AB-18-032] Length = 771 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + T GI+ +PVLD++ P + + P + R Sbjct: 156 IGAVMRTLGIHQGLAPVLDVIRDPR--WGRVDECIAEDPYLVGTLGTSYVRGLQ 207 >gi|322711050|gb|EFZ02624.1| beta-N-acetylglucosaminidase [Metarhizium anisopliae ARSEF 23] Length = 909 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A + G+N+ PVLD+L P +A + Sbjct: 141 ASEISACGVNLMLGPVLDVLNNARYQPLGV-RSTGDDPQEASQYGLAALNGIRD 193 >gi|251789248|ref|YP_003003969.1| beta-hexosaminidase [Dickeya zeae Ech1591] gi|247537869|gb|ACT06490.1| glycoside hydrolase family 3 domain protein [Dickeya zeae Ech1591] Length = 365 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + I+++F+PVLD+ + F P A+ F Sbjct: 128 MAAEMTALDIDISFAPVLDVGHQSAAI---GDRAFHDDPDTLLAVAERFITGMR 178 >gi|254508955|ref|ZP_05121062.1| beta-hexosaminidase [Vibrio parahaemolyticus 16] gi|219548130|gb|EED25148.1| beta-hexosaminidase [Vibrio parahaemolyticus 16] Length = 328 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + + + Sbjct: 101 MAAELIAHDIDLSFAPVLDKGHQCKAI---GNRAFGDDVESIVRHSTAYMQGMK 151 >gi|83942559|ref|ZP_00955020.1| beta-N-acetylhexosaminidase, putative [Sulfitobacter sp. EE-36] gi|83846652|gb|EAP84528.1| beta-N-acetylhexosaminidase, putative [Sulfitobacter sp. EE-36] Length = 334 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L GI+ N +P++D+ + + P + + + Sbjct: 106 IADELHRVGIDSNCAPMVDVAGAQTHA-FLRNRCYGTTPDAVATLGRAAADGML 158 >gi|153000924|ref|YP_001366605.1| beta-hexosaminidase [Shewanella baltica OS185] gi|151365542|gb|ABS08542.1| glycoside hydrolase family 3 domain protein [Shewanella baltica OS185] Length = 342 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 MA L+ I+++F+PVLDL G I + FS PA+ A+ F Sbjct: 105 MAIELLACDIDLSFAPVLDLN-GVSQVIGK--RSFSPEPAEVITLAESFI 151 >gi|217973120|ref|YP_002357871.1| beta-hexosaminidase [Shewanella baltica OS223] gi|217498255|gb|ACK46448.1| glycoside hydrolase family 3 domain protein [Shewanella baltica OS223] Length = 342 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 MA L+ I+++F+PVLDL G I + FS PA+ A+ F Sbjct: 105 MAIELLACDIDLSFAPVLDLN-GVSQVIGK--RSFSPEPAEVITLAESFI 151 >gi|126174629|ref|YP_001050778.1| beta-hexosaminidase [Shewanella baltica OS155] gi|160875635|ref|YP_001554951.1| beta-hexosaminidase [Shewanella baltica OS195] gi|304409004|ref|ZP_07390625.1| glycoside hydrolase family 3 domain protein [Shewanella baltica OS183] gi|307303007|ref|ZP_07582762.1| glycoside hydrolase family 3 domain protein [Shewanella baltica BA175] gi|125997834|gb|ABN61909.1| glycoside hydrolase, family 3 domain protein [Shewanella baltica OS155] gi|160861157|gb|ABX49691.1| glycoside hydrolase family 3 domain protein [Shewanella baltica OS195] gi|304352825|gb|EFM17222.1| glycoside hydrolase family 3 domain protein [Shewanella baltica OS183] gi|306913367|gb|EFN43789.1| glycoside hydrolase family 3 domain protein [Shewanella baltica BA175] gi|315267824|gb|ADT94677.1| glycoside hydrolase family 3 domain protein [Shewanella baltica OS678] Length = 342 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 MA L+ I+++F+PVLDL G I + FS PA+ A+ F Sbjct: 105 MAIELLACDIDLSFAPVLDLN-GVSQVIGK--RSFSPEPAEVITLAESFI 151 >gi|302337731|ref|YP_003802937.1| glycoside hydrolase [Spirochaeta smaragdinae DSM 11293] gi|301634916|gb|ADK80343.1| glycoside hydrolase family 3 domain protein [Spirochaeta smaragdinae DSM 11293] Length = 784 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 17/56 (30%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L + G +PVLD+ + P A + R + N Sbjct: 140 IGDELYSVGSRQGLAPVLDVSRDAR--WGRTEESMGEDPYLVGTLATAYVRGFQGN 193 >gi|229821197|ref|YP_002882723.1| glycoside hydrolase family 3 domain protein [Beutenbergia cavernae DSM 12333] gi|229567110|gb|ACQ80961.1| glycoside hydrolase family 3 domain protein [Beutenbergia cavernae DSM 12333] Length = 768 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ G++ +PVLD++ P + P + R Sbjct: 145 IGTSMRELGVHQGLAPVLDVVRDPR--WGRVEECLGEDPFLVGTLGTAYVRGLQ 196 >gi|253688865|ref|YP_003018055.1| glycoside hydrolase family 3 domain protein [Pectobacterium carotovorum subsp. carotovorum PC1] gi|259511217|sp|C6DKR8|NAGZ_PECCP RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|251755443|gb|ACT13519.1| glycoside hydrolase family 3 domain protein [Pectobacterium carotovorum subsp. carotovorum PC1] Length = 342 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA +++ I+++F+PVLD+ + F P A AQ F R Sbjct: 104 MAAEMISMDIDISFAPVLDIGHQSAAI---GERSFHANPETALAVAQSFIRGMH 154 >gi|108804815|ref|YP_644752.1| glycoside hydrolase family protein [Rubrobacter xylanophilus DSM 9941] gi|108766058|gb|ABG04940.1| glycoside hydrolase, family 3-like protein [Rubrobacter xylanophilus DSM 9941] Length = 386 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 4/55 (7%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L+ +G+N + +PV+D +G I + P + + Sbjct: 166 IGSELLEAGVNTDLAPVVDTGFGAA--IGS--RSYGENPELVSRMGSAAVEGFRE 216 >gi|315045946|ref|XP_003172348.1| beta-hexosaminidase A [Arthroderma gypseum CBS 118893] gi|311342734|gb|EFR01937.1| beta-hexosaminidase A [Arthroderma gypseum CBS 118893] Length = 353 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 17/49 (34%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 A L IN N +PVLD+ FI + F F+ Sbjct: 130 AAALKAQHINGNLAPVLDIYREKGNFIDEFGRSFGNNTEIVTSCGSAFA 178 >gi|323358669|ref|YP_004225065.1| beta-glucosidase-related glycosidase [Microbacterium testaceum StLB037] gi|323275040|dbj|BAJ75185.1| beta-glucosidase-related glycosidase [Microbacterium testaceum StLB037] Length = 804 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ G++ SPVLD++ P + + P + R Sbjct: 147 IGRSMRDLGVHQGLSPVLDVVRDPR--WGRVDECIAEDPYVVGTIGTAYVRGLQ 198 >gi|307294516|ref|ZP_07574358.1| Beta-N-acetylhexosaminidase [Sphingobium chlorophenolicum L-1] gi|306878990|gb|EFN10208.1| Beta-N-acetylhexosaminidase [Sphingobium chlorophenolicum L-1] Length = 337 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L GI+V+ P+LD+ + I P + + Sbjct: 111 TLAEVGISVDALPLLDVRREGASDIMG-DRTLGAEPMRVAALGRAVIEGLAD 161 >gi|293402355|ref|ZP_06646492.1| beta-N-acetylhexosaminidase [Erysipelotrichaceae bacterium 5_2_54FAA] gi|291304202|gb|EFE45454.1| beta-N-acetylhexosaminidase [Erysipelotrichaceae bacterium 5_2_54FAA] Length = 458 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ L GINVN +PV D+ E FI F + + + T KN Sbjct: 244 AELLKNMGINVNLAPVADVSTHTEDFI--YARSFGKNAHETANYVKTVVHTMKKN 296 >gi|86148426|ref|ZP_01066717.1| beta-hexosaminidase [Vibrio sp. MED222] gi|85833780|gb|EAQ51947.1| beta-hexosaminidase [Vibrio sp. MED222] Length = 329 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + F + Sbjct: 101 MAAELIAHDIDLSFAPVLDKGHDCKAI---GSRAFGEDIDTIVRHSSAFIKGMK 151 >gi|83953780|ref|ZP_00962501.1| beta-N-acetylhexosaminidase, putative [Sulfitobacter sp. NAS-14.1] gi|83841725|gb|EAP80894.1| beta-N-acetylhexosaminidase, putative [Sulfitobacter sp. NAS-14.1] Length = 334 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L GI+ N +P++D+ + + P + + + Sbjct: 106 IADELHRVGIDSNCAPMVDVAGAQTHA-FLRNRCYGTTPDAVATLGRAAADGML 158 >gi|315505498|ref|YP_004084385.1| glycoside hydrolase family 3 domain protein [Micromonospora sp. L5] gi|315412117|gb|ADU10234.1| glycoside hydrolase family 3 domain protein [Micromonospora sp. L5] Length = 774 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ GI+ SPVLD++ P + + P + R Sbjct: 159 IGASMRALGIHQGLSPVLDVIRDPR--WGRVDECIAEDPYLVGTIGTSYVRGLQ 210 >gi|302868105|ref|YP_003836742.1| glycoside hydrolase family 3 domain-containing protein [Micromonospora aurantiaca ATCC 27029] gi|302570964|gb|ADL47166.1| glycoside hydrolase family 3 domain protein [Micromonospora aurantiaca ATCC 27029] Length = 774 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ GI+ SPVLD++ P + + P + R Sbjct: 159 IGASMRALGIHQGLSPVLDVIRDPR--WGRVDECIAEDPYLVGTIGTSYVRGLQ 210 >gi|84393582|ref|ZP_00992335.1| beta-hexosaminidase [Vibrio splendidus 12B01] gi|84375791|gb|EAP92685.1| beta-hexosaminidase [Vibrio splendidus 12B01] Length = 329 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + F + Sbjct: 101 MAAELIAHDIDLSFAPVLDKGHDCKAI---GSRAFGEDIDTIVRHSSAFIKGMK 151 >gi|307131520|ref|YP_003883536.1| beta-N-acetylglucosaminidase [Dickeya dadantii 3937] gi|306529049|gb|ADM98979.1| beta-N-acetylglucosaminidase [Dickeya dadantii 3937] Length = 341 Score = 48.2 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + F P A+ F Sbjct: 104 MAAEMIALDIDISFAPVLDVGHQSTAI---GDRSFHDDPDTLLAVAERFIAGMR 154 >gi|296130881|ref|YP_003638131.1| glycoside hydrolase family 3 domain protein [Cellulomonas flavigena DSM 20109] gi|296022696|gb|ADG75932.1| glycoside hydrolase family 3 domain protein [Cellulomonas flavigena DSM 20109] Length = 809 Score = 48.2 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + ++ GI+ +PVLD++ P + P + R + Sbjct: 159 IGDSMRELGIHQGLAPVLDVVGDPR--WGRVDECIGEDPYLVGTVGTAYVRGLQE 211 >gi|262374970|ref|ZP_06068204.1| beta-hexosaminidase(N-acetyl-beta-glucosaminidase) [Acinetobacter lwoffii SH145] gi|262309983|gb|EEY91112.1| beta-hexosaminidase(N-acetyl-beta-glucosaminidase) [Acinetobacter lwoffii SH145] Length = 340 Score = 48.2 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ GI+ +F+PVLDL I F++ A F + Sbjct: 106 MATEVLAVGIDFSFAPVLDLN-DISDVIG--DRSFAQNIQDIIPLASAFLKGMK 156 >gi|302527577|ref|ZP_07279919.1| sugar hydrolase [Streptomyces sp. AA4] gi|302436472|gb|EFL08288.1| sugar hydrolase [Streptomyces sp. AA4] Length = 483 Score = 48.2 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + L G+ VN +P DL E F P A F K Sbjct: 109 LGERLAACGVTVNLAPCADLTLAAEDPGIGV-RAFGSDPVAASPHVAAFVTGMQK 162 >gi|327483490|gb|AEA77897.1| Beta N-acetyl-glucosaminidase [Vibrio cholerae LMA3894-4] Length = 330 Score = 48.2 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDIQTVLKHSSAFLRGMK 151 >gi|260775141|ref|ZP_05884039.1| beta N-acetyl-glucosaminidase [Vibrio coralliilyticus ATCC BAA-450] gi|260608842|gb|EEX35004.1| beta N-acetyl-glucosaminidase [Vibrio coralliilyticus ATCC BAA-450] Length = 327 Score = 48.2 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + + R Sbjct: 101 MAAELIAHDIDLSFAPVLDKGHECKAI---GSRSFGEDVDTIIRHSNAYMRGMK 151 >gi|256113417|ref|ZP_05454266.1| beta-hexosaminidase A [Brucella melitensis bv. 3 str. Ether] Length = 331 Score = 48.2 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+N + PVLD+ + +S+ P E + + + Sbjct: 112 AFDLLKVGVNADCLPVLDVPVEGAHDVIGM-RAYSKNPHAVAEMGRAAAEGLL 163 >gi|229530497|ref|ZP_04419885.1| beta N-acetyl-glucosaminidase [Vibrio cholerae 12129(1)] gi|229332270|gb|EEN97758.1| beta N-acetyl-glucosaminidase [Vibrio cholerae 12129(1)] Length = 330 Score = 48.2 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDIQTVLKHSSAFLRGMK 151 >gi|87199736|ref|YP_496993.1| glycoside hydrolase family protein [Novosphingobium aromaticivorans DSM 12444] gi|87135417|gb|ABD26159.1| glycoside hydrolase, family 3-like protein [Novosphingobium aromaticivorans DSM 12444] Length = 640 Score = 48.2 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI + SP DL P F PA A + R + Sbjct: 185 AAEYRAVGIQMALSPQADLYTEPRWPRGNA--TFGSDPATVSRLAGAYVRGFQ 235 >gi|296112490|ref|YP_003626428.1| beta-N-acetylhexosaminidase [Moraxella catarrhalis RH4] gi|295920184|gb|ADG60535.1| beta-N-acetylhexosaminidase [Moraxella catarrhalis RH4] Length = 361 Score = 48.2 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ G++ +F+PVLD+ ++ + F P + F Sbjct: 111 MACEVLAVGVDFSFAPVLDID--GKSLVIG-DRAFHANPDAIITLSSQFMDGMKN 162 >gi|291537261|emb|CBL10373.1| Beta-glucosidase-related glycosidases [Roseburia intestinalis M50/1] Length = 430 Score = 48.2 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 10/45 (22%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEES 45 + L G NV+++PV D+L P F + + Sbjct: 213 IGTYLKQLGFNVDYAPVADVLTNPGNTAIGT-RSFGSDASMVADM 256 >gi|262277229|ref|ZP_06055022.1| beta-hexosaminidase [alpha proteobacterium HIMB114] gi|262224332|gb|EEY74791.1| beta-hexosaminidase [alpha proteobacterium HIMB114] Length = 306 Score = 48.2 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 12/50 (24%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Query: 6 VTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 GI+ PV DL Y + FS+ P + + F + Y Sbjct: 119 KFLGIDTVAYPVADLKYKKTHKVIG-DRSFSKNPKIVNKLCEYFIQKYQD 167 >gi|254456145|ref|ZP_05069574.1| hypothetical protein PB7211_896 [Candidatus Pelagibacter sp. HTCC7211] gi|207083147|gb|EDZ60573.1| hypothetical protein PB7211_896 [Candidatus Pelagibacter sp. HTCC7211] Length = 316 Score = 48.2 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L G N+N P+LDL + I FS+ + L + + KN Sbjct: 113 SYLLKLIGSNINTVPILDLRVKGASNIIG-DRSFSKNRNTVSKIGDLCIKLFHKN 166 >gi|291539206|emb|CBL12317.1| Beta-glucosidase-related glycosidases [Roseburia intestinalis XB6B4] Length = 430 Score = 48.2 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 10/45 (22%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEES 45 + L G NV+++PV D+L P F + + Sbjct: 213 IGTYLKQLGFNVDYAPVADVLTNPGNTAIGT-RSFGSDASMVADM 256 >gi|331087100|ref|ZP_08336173.1| hypothetical protein HMPREF0987_02476 [Lachnospiraceae bacterium 9_1_43BFAA] gi|330409189|gb|EGG88640.1| hypothetical protein HMPREF0987_02476 [Lachnospiraceae bacterium 9_1_43BFAA] Length = 588 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 1 MA-KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + G N+ F+PV D+LY E F + ++ + Sbjct: 126 MANEQAAAIGCNMAFAPVADILYNWENTEI-VTRAFGGDAERVATMSKAYLNGAH 179 >gi|238060440|ref|ZP_04605149.1| glycoside hydrolase family 3 [Micromonospora sp. ATCC 39149] gi|237882251|gb|EEP71079.1| glycoside hydrolase family 3 [Micromonospora sp. ATCC 39149] Length = 575 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L GIN++F+PV D+L T I F P +A R Sbjct: 208 GAELAAMGINLDFAPVADVLVTRSTVIGS--RSFGADPKRASAQVAGAVRGLQ 258 >gi|284928792|ref|YP_003421314.1| beta-glucosidase-like glycosyl hydrolase [cyanobacterium UCYN-A] gi|284809251|gb|ADB94956.1| beta-glucosidase-like glycosyl hydrolase [cyanobacterium UCYN-A] Length = 521 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 +A+ ++ GIN +P++D+ P F P + A+ F + +P Sbjct: 112 IAEEALSIGINWMLAPIVDINNNPNNP-VINIRSFGETPDVVSQLAKAFIKGAKNHP 167 >gi|156740905|ref|YP_001431034.1| glycoside hydrolase family 3 protein [Roseiflexus castenholzii DSM 13941] gi|156232233|gb|ABU57016.1| glycoside hydrolase family 3 domain protein [Roseiflexus castenholzii DSM 13941] Length = 790 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G++ +PVLD+ P + F P + R Sbjct: 142 IRQQMRAVGVHHGLAPVLDIARDPR--WGRTEETFGEDPYLTSVMGAAYIRGLQ 193 >gi|325663590|ref|ZP_08151997.1| hypothetical protein HMPREF0490_02738 [Lachnospiraceae bacterium 4_1_37FAA] gi|325470276|gb|EGC73508.1| hypothetical protein HMPREF0490_02738 [Lachnospiraceae bacterium 4_1_37FAA] Length = 588 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 1 MA-KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA + G N+ F+PV D+LY E F + ++ + Sbjct: 126 MANEQAAAIGCNMAFAPVADILYNWENTEI-VTRAFGGDAERVATMSKAYLNGAH 179 >gi|306843776|ref|ZP_07476374.1| beta-hexosaminidase A [Brucella sp. BO1] gi|306275854|gb|EFM57570.1| beta-hexosaminidase A [Brucella sp. BO1] Length = 339 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+N + PVLD+ + +S+ P E + + + Sbjct: 112 AFDLLKVGVNADCLPVLDVPVEGAHDVIGM-RAYSKNPHAVAEMGRAAAEGLL 163 >gi|265994815|ref|ZP_06107372.1| beta-N-acetylhexosaminidase [Brucella melitensis bv. 3 str. Ether] gi|262765928|gb|EEZ11717.1| beta-N-acetylhexosaminidase [Brucella melitensis bv. 3 str. Ether] Length = 342 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+N + PVLD+ + +S+ P E + + + Sbjct: 123 AFDLLKVGVNADCLPVLDVPVEGAHDVIGM-RAYSKNPHAVAEMGRAAAEGLL 174 >gi|17545787|ref|NP_519189.1| beta-hexosaminidase [Ralstonia solanacearum GMI1000] gi|17428081|emb|CAD14770.1| putative hexosaminidase protein [Ralstonia solanacearum GMI1000] Length = 350 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQ 47 +A L I+++F+PVLDL YG I F R P A Sbjct: 116 LAAELRGCDIDLSFTPVLDLDYGTSGVIG--DRAFHRDPRVVTMLAN 160 >gi|254718983|ref|ZP_05180794.1| beta-hexosaminidase A [Brucella sp. 83/13] gi|265983973|ref|ZP_06096708.1| beta-N-acetylhexosaminidase [Brucella sp. 83/13] gi|306837331|ref|ZP_07470212.1| beta-hexosaminidase A [Brucella sp. NF 2653] gi|264662565|gb|EEZ32826.1| beta-N-acetylhexosaminidase [Brucella sp. 83/13] gi|306407583|gb|EFM63781.1| beta-hexosaminidase A [Brucella sp. NF 2653] Length = 339 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+N + PVLD+ + +S+ P E + + + Sbjct: 112 AFDLLKVGVNADCLPVLDVPVEGAHDVIGM-RAYSKNPHAVAEMGRAAAEGLL 163 >gi|253989196|ref|YP_003040552.1| beta-hexosaminidase [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949] gi|253780646|emb|CAQ83808.1| beta-hexosaminidase [Photorhabdus asymbiotica] Length = 340 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLDL + +A F P +A A+ F + Sbjct: 104 MASEMIAMDIDISFAPVLDLGHQC---VAIGERSFHENPEQAMIMAEHFIKGMH 154 >gi|163739605|ref|ZP_02147014.1| beta-N-acetylhexosaminidase, putative [Phaeobacter gallaeciensis BS107] gi|161387064|gb|EDQ11424.1| beta-N-acetylhexosaminidase, putative [Phaeobacter gallaeciensis BS107] Length = 334 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GI+ N +P+ D+ K + A+ + + Sbjct: 106 IADELRGLGIDSNCAPLADVAGEGTHP-FLKNRCYGTDLTTVVTRARATAEGLLD 159 >gi|110680349|ref|YP_683356.1| beta-hexosaminidase, putative [Roseobacter denitrificans OCh 114] gi|109456465|gb|ABG32670.1| beta-hexosaminidase, putative [Roseobacter denitrificans OCh 114] Length = 332 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L GI+ N +P++D+ + + + + + Sbjct: 107 IAAELHDLGIDCNCAPMVDIASADTHE-FLRNRCYGTDADSVAMLGRAAADGML 159 >gi|261822048|ref|YP_003260154.1| beta-hexosaminidase [Pectobacterium wasabiae WPP163] gi|261606061|gb|ACX88547.1| glycoside hydrolase family 3 domain protein [Pectobacterium wasabiae WPP163] Length = 342 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + F P A AQ F R Sbjct: 104 MAAEMIAMDIDISFAPVLDIGHQSAAI---GERSFHEQPETALAVAQSFIRGMH 154 >gi|145593750|ref|YP_001158047.1| glycoside hydrolase family 3 protein [Salinispora tropica CNB-440] gi|145303087|gb|ABP53669.1| glycoside hydrolase, family 3 domain protein [Salinispora tropica CNB-440] Length = 483 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 10/41 (24%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAK 41 + L GI VN +P +D+ E + F P + Sbjct: 110 IGAELAALGITVNLAPAVDVNSADENPVIGT-RSFGHNPDR 149 >gi|302865736|ref|YP_003834373.1| glycoside hydrolase family 3 domain-containing protein [Micromonospora aurantiaca ATCC 27029] gi|315502292|ref|YP_004081179.1| glycoside hydrolase family 3 domain protein [Micromonospora sp. L5] gi|302568595|gb|ADL44797.1| glycoside hydrolase family 3 domain protein [Micromonospora aurantiaca ATCC 27029] gi|315408911|gb|ADU07028.1| glycoside hydrolase family 3 domain protein [Micromonospora sp. L5] Length = 484 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAK 41 + L GI V+ +P +D+ E + F P + Sbjct: 110 IGAELAALGITVDLAPTVDVNTADENPVIGT-RSFGADPKR 149 >gi|260578567|ref|ZP_05846477.1| lipoprotein [Corynebacterium jeikeium ATCC 43734] gi|258603282|gb|EEW16549.1| lipoprotein [Corynebacterium jeikeium ATCC 43734] Length = 334 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 5/57 (8%) Query: 2 AKNLVTSGINVNFSPVLDLLYG---PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K + GI V+F+PV+DL G + I FS P A + A+ +S + Sbjct: 111 GKKVRDLGITVDFAPVVDLAGGQEVSDNAIGS--RSFSADPKVAADYARAYSEGLQQ 165 >gi|297580815|ref|ZP_06942741.1| beta-N-acetylhexosaminidase [Vibrio cholerae RC385] gi|297535231|gb|EFH74066.1| beta-N-acetylhexosaminidase [Vibrio cholerae RC385] Length = 330 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLKYSSAFLRGMK 151 >gi|161618839|ref|YP_001592726.1| Beta-hexosaminidase [Brucella canis ATCC 23365] gi|225852391|ref|YP_002732624.1| beta-hexosaminidase A [Brucella melitensis ATCC 23457] gi|254701643|ref|ZP_05163471.1| beta-hexosaminidase A [Brucella suis bv. 5 str. 513] gi|254704186|ref|ZP_05166014.1| beta-hexosaminidase A [Brucella suis bv. 3 str. 686] gi|254709981|ref|ZP_05171792.1| beta-hexosaminidase A [Brucella pinnipedialis B2/94] gi|254713981|ref|ZP_05175792.1| beta-hexosaminidase A [Brucella ceti M644/93/1] gi|254716960|ref|ZP_05178771.1| beta-hexosaminidase A [Brucella ceti M13/05/1] gi|256031474|ref|ZP_05445088.1| beta-hexosaminidase A [Brucella pinnipedialis M292/94/1] gi|256044552|ref|ZP_05447456.1| beta-hexosaminidase A [Brucella melitensis bv. 1 str. Rev.1] gi|256060984|ref|ZP_05451142.1| beta-hexosaminidase A [Brucella neotomae 5K33] gi|256159600|ref|ZP_05457362.1| beta-hexosaminidase A [Brucella ceti M490/95/1] gi|256254880|ref|ZP_05460416.1| beta-hexosaminidase A [Brucella ceti B1/94] gi|256264111|ref|ZP_05466643.1| glycoside hydrolase [Brucella melitensis bv. 2 str. 63/9] gi|260168608|ref|ZP_05755419.1| beta-hexosaminidase A [Brucella sp. F5/99] gi|260563905|ref|ZP_05834391.1| glycoside hydrolase, family 3 [Brucella melitensis bv. 1 str. 16M] gi|260566564|ref|ZP_05837034.1| glycoside hydrolase, family 3 [Brucella suis bv. 4 str. 40] gi|261218765|ref|ZP_05933046.1| beta-N-acetylhexosaminidase [Brucella ceti M13/05/1] gi|261222064|ref|ZP_05936345.1| beta-N-acetylhexosaminidase [Brucella ceti B1/94] gi|261317529|ref|ZP_05956726.1| beta-N-acetylhexosaminidase [Brucella pinnipedialis B2/94] gi|261321736|ref|ZP_05960933.1| beta-N-acetylhexosaminidase [Brucella ceti M644/93/1] gi|261324986|ref|ZP_05964183.1| beta-N-acetylhexosaminidase [Brucella neotomae 5K33] gi|261752196|ref|ZP_05995905.1| beta-N-acetylhexosaminidase [Brucella suis bv. 5 str. 513] gi|261754855|ref|ZP_05998564.1| beta-N-acetylhexosaminidase [Brucella suis bv. 3 str. 686] gi|261758082|ref|ZP_06001791.1| glycoside hydrolase [Brucella sp. F5/99] gi|265988564|ref|ZP_06101121.1| beta-N-acetylhexosaminidase [Brucella pinnipedialis M292/94/1] gi|265990978|ref|ZP_06103535.1| beta-N-acetylhexosaminidase [Brucella melitensis bv. 1 str. Rev.1] gi|265998029|ref|ZP_06110586.1| beta-N-acetylhexosaminidase [Brucella ceti M490/95/1] gi|161335650|gb|ABX61955.1| Beta-hexosaminidase [Brucella canis ATCC 23365] gi|225640756|gb|ACO00670.1| Beta-hexosaminidase A precursor [Brucella melitensis ATCC 23457] gi|260153921|gb|EEW89013.1| glycoside hydrolase, family 3 [Brucella melitensis bv. 1 str. 16M] gi|260156082|gb|EEW91162.1| glycoside hydrolase, family 3 [Brucella suis bv. 4 str. 40] gi|260920648|gb|EEX87301.1| beta-N-acetylhexosaminidase [Brucella ceti B1/94] gi|260923854|gb|EEX90422.1| beta-N-acetylhexosaminidase [Brucella ceti M13/05/1] gi|261294426|gb|EEX97922.1| beta-N-acetylhexosaminidase [Brucella ceti M644/93/1] gi|261296752|gb|EEY00249.1| beta-N-acetylhexosaminidase [Brucella pinnipedialis B2/94] gi|261300966|gb|EEY04463.1| beta-N-acetylhexosaminidase [Brucella neotomae 5K33] gi|261738066|gb|EEY26062.1| glycoside hydrolase [Brucella sp. F5/99] gi|261741949|gb|EEY29875.1| beta-N-acetylhexosaminidase [Brucella suis bv. 5 str. 513] gi|261744608|gb|EEY32534.1| beta-N-acetylhexosaminidase [Brucella suis bv. 3 str. 686] gi|262552497|gb|EEZ08487.1| beta-N-acetylhexosaminidase [Brucella ceti M490/95/1] gi|263001762|gb|EEZ14337.1| beta-N-acetylhexosaminidase [Brucella melitensis bv. 1 str. Rev.1] gi|263094329|gb|EEZ18174.1| glycoside hydrolase [Brucella melitensis bv. 2 str. 63/9] gi|264660761|gb|EEZ31022.1| beta-N-acetylhexosaminidase [Brucella pinnipedialis M292/94/1] gi|326408897|gb|ADZ65962.1| beta-hexosaminidase A [Brucella melitensis M28] gi|326538615|gb|ADZ86830.1| beta-hexosaminidase A precursor [Brucella melitensis M5-90] Length = 339 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+N + PVLD+ + +S+ P E + + + Sbjct: 112 AFDLLKVGVNADCLPVLDVPVEGAHDVIGM-RAYSKNPHAVAEMGRAAAEGLL 163 >gi|76788176|ref|YP_329453.1| glycosy hydrolase family protein [Streptococcus agalactiae A909] gi|76563233|gb|ABA45817.1| glycosyl hydrolase, family 3 [Streptococcus agalactiae A909] Length = 596 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 7/51 (13%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 G N +F+P++DL I + + ++ + + Sbjct: 131 GMEASAVGCNASFAPIVDLTRNWRNPIIAS-RNWGANVDQIISLSKEYMKG 180 >gi|227496931|ref|ZP_03927186.1| glycoside hydrolase family 3 protein [Actinomyces urogenitalis DSM 15434] gi|226833579|gb|EEH65962.1| glycoside hydrolase family 3 protein [Actinomyces urogenitalis DSM 15434] Length = 414 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/58 (18%), Positives = 18/58 (31%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDL----LYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L +G+ +N +PV DL I + E F+ + Sbjct: 193 ATELAAAGVTMNLAPVADLVDIADPSSNAPIGHWDRQYGSEAGSVAEHVVAFNAGMTQ 250 >gi|254361847|ref|ZP_04977982.1| beta-N-acetylhexosaminidase [Mannheimia haemolytica PHL213] gi|153093382|gb|EDN74378.1| beta-N-acetylhexosaminidase [Mannheimia haemolytica PHL213] Length = 345 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F + PA A+ F + Sbjct: 103 MAAEMFALDIDLSFAPVLDLGHECKAI---GDRSFGQEPAAILPVAEAFIDGMRE 154 >gi|23501765|ref|NP_697892.1| glycosyl hydrolase family protein [Brucella suis 1330] gi|23347694|gb|AAN29807.1| glycosyl hydrolase, family 3 [Brucella suis 1330] Length = 337 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+N + PVLD+ + +S+ P E + + + Sbjct: 112 AFDLLKVGVNADCLPVLDVPVEGAHDVIGM-RAYSKNPHAVAEMGRAAAEGLL 163 >gi|71275771|ref|ZP_00652055.1| Glycoside hydrolase, family 3, N-terminal [Xylella fastidiosa Dixon] gi|71900034|ref|ZP_00682178.1| Glycoside hydrolase, family 3, N-terminal [Xylella fastidiosa Ann-1] gi|170730123|ref|YP_001775556.1| putative beta-hexosaminidase [Xylella fastidiosa M12] gi|71163349|gb|EAO13067.1| Glycoside hydrolase, family 3, N-terminal [Xylella fastidiosa Dixon] gi|71730177|gb|EAO32264.1| Glycoside hydrolase, family 3, N-terminal [Xylella fastidiosa Ann-1] gi|167964916|gb|ACA11926.1| putative beta-hexosaminidase [Xylella fastidiosa M12] Length = 688 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A +++ IN F+PV D+ P + FS A + + Sbjct: 222 LAHDMLALKINTTFAPVADVNTNPFNPVINV-RAFSDSANVVSFLAGKIAGGMEQ 275 >gi|254820647|ref|ZP_05225648.1| glycosyl hydrolase family protein 3 [Mycobacterium intracellulare ATCC 13950] Length = 383 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI V+F+PV+D+ + + F P + A +++ Sbjct: 158 GRKMRDLGITVDFAPVVDVSDEDDDAVIG-NRSFGADPQTVTDYAGAYAQGLRD 210 >gi|158316428|ref|YP_001508936.1| glycoside hydrolase family 3 protein [Frankia sp. EAN1pec] gi|158111833|gb|ABW14030.1| glycoside hydrolase family 3 domain protein [Frankia sp. EAN1pec] Length = 793 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A ++ +GI++ FSPV+DL P + + P A + + F R Sbjct: 140 AAHMRQTGIHLAFSPVMDLARDPR--WGRVHETYGEDPELAAQFSVAFVRGIQ 190 >gi|294852231|ref|ZP_06792904.1| beta-N-acetylhexosaminidase [Brucella sp. NVSL 07-0026] gi|294820820|gb|EFG37819.1| beta-N-acetylhexosaminidase [Brucella sp. NVSL 07-0026] Length = 339 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+N + PVLD+ + +S+ P E + + + Sbjct: 112 AFDLLKVGVNADCLPVLDVPVEGAHDVIGM-RAYSKNPHAVAEMGRAAAEGLL 163 >gi|254693612|ref|ZP_05155440.1| beta-hexosaminidase A [Brucella abortus bv. 3 str. Tulya] gi|261213878|ref|ZP_05928159.1| beta-N-acetylhexosaminidase [Brucella abortus bv. 3 str. Tulya] gi|260915485|gb|EEX82346.1| beta-N-acetylhexosaminidase [Brucella abortus bv. 3 str. Tulya] Length = 339 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+N + PVLD+ + +S+ P E + + + Sbjct: 112 AFDLLKVGVNADCLPVLDVPVEGAHDVIGM-RAYSKNPHAVAEMGRAAAEGLL 163 >gi|254689129|ref|ZP_05152383.1| Glycoside hydrolase, family 3, N-terminal [Brucella abortus bv. 6 str. 870] gi|260754628|ref|ZP_05866976.1| beta-N-acetylhexosaminidase [Brucella abortus bv. 6 str. 870] gi|260674736|gb|EEX61557.1| beta-N-acetylhexosaminidase [Brucella abortus bv. 6 str. 870] Length = 339 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+N + PVLD+ + +S+ P E + + + Sbjct: 112 AFDLLKVGVNADCLPVLDVPVEGAHDVIGM-RAYSKNPHAVAEMGRAAAEGLL 163 >gi|332141061|ref|YP_004426799.1| beta-hexosaminidase [Alteromonas macleodii str. 'Deep ecotype'] gi|327551083|gb|AEA97801.1| beta-hexosaminidase [Alteromonas macleodii str. 'Deep ecotype'] Length = 340 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L T I+ +F+PVLD+ G I FS + A + Sbjct: 105 LAYELKTLDIDFSFAPVLDIN-GVSQVIG--DRAFSNNADEVIRLATQLIQGLK 155 >gi|163843150|ref|YP_001627554.1| Beta-hexosaminidase [Brucella suis ATCC 23445] gi|163673873|gb|ABY37984.1| Beta-hexosaminidase [Brucella suis ATCC 23445] Length = 339 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+N + PVLD+ + +S+ P E + + + Sbjct: 112 AFDLLKVGVNADCLPVLDVPVEGAHDVIGM-RAYSKNPHAVAEMGRAAAEGLL 163 >gi|148560158|ref|YP_001258853.1| glycosyl hydrolase family protein [Brucella ovis ATCC 25840] gi|148371415|gb|ABQ61394.1| glycosyl hydrolase, family 3 [Brucella ovis ATCC 25840] Length = 339 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+N + PVLD+ + +S+ P E + + + Sbjct: 112 AFDLLKVGVNADCLPVLDVPVEGAHDVIGM-RAYSKNPHAVAEMGRAAAEGLL 163 >gi|126348231|emb|CAJ89952.1| putative beta-D-xylosidase [Streptomyces ambofaciens ATCC 23877] Length = 793 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 7/55 (12%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + +++ + G++ +PVLD++ + P + R Sbjct: 156 IGRDMRSVGVHQGLAPVLDVVRDAR--WGRVEETIGEDPYLVGTIGTAYVRGLED 208 >gi|148652126|ref|YP_001279219.1| beta-hexosaminidase [Psychrobacter sp. PRwf-1] gi|148571210|gb|ABQ93269.1| Beta-N-acetylhexosaminidase [Psychrobacter sp. PRwf-1] Length = 356 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ GI+++F+PVLD+ G I F + F R Sbjct: 106 MAAEVMAVGIDISFAPVLDIN-GVSQVIG--DRSFHARTEAIVALSSQFMRGMK 156 >gi|62289824|ref|YP_221617.1| glycosyl hydrolase family protein [Brucella abortus bv. 1 str. 9-941] gi|82699749|ref|YP_414323.1| glycoside hydrolase family protein [Brucella melitensis biovar Abortus 2308] gi|189024065|ref|YP_001934833.1| glycoside hydrolase, family 3, N-terminal [Brucella abortus S19] gi|254697262|ref|ZP_05159090.1| Glycoside hydrolase, family 3, N-terminal [Brucella abortus bv. 2 str. 86/8/59] gi|254730161|ref|ZP_05188739.1| Glycoside hydrolase, family 3, N-terminal [Brucella abortus bv. 4 str. 292] gi|256257378|ref|ZP_05462914.1| Glycoside hydrolase, family 3, N-terminal [Brucella abortus bv. 9 str. C68] gi|260545429|ref|ZP_05821170.1| glycoside hydrolase, family 3 [Brucella abortus NCTC 8038] gi|260757851|ref|ZP_05870199.1| beta-N-acetylhexosaminidase [Brucella abortus bv. 4 str. 292] gi|260761674|ref|ZP_05874017.1| beta-N-acetylhexosaminidase [Brucella abortus bv. 2 str. 86/8/59] gi|260883655|ref|ZP_05895269.1| beta-N-acetylhexosaminidase [Brucella abortus bv. 9 str. C68] gi|297248229|ref|ZP_06931947.1| beta-N-acetylhexosaminidase [Brucella abortus bv. 5 str. B3196] gi|62195956|gb|AAX74256.1| glycosyl hydrolase, family 3 [Brucella abortus bv. 1 str. 9-941] gi|82615850|emb|CAJ10854.1| Glycoside hydrolase, family 3, N-terminal [Brucella melitensis biovar Abortus 2308] gi|189019637|gb|ACD72359.1| Glycoside hydrolase, family 3, N-terminal [Brucella abortus S19] gi|260096836|gb|EEW80711.1| glycoside hydrolase, family 3 [Brucella abortus NCTC 8038] gi|260668169|gb|EEX55109.1| beta-N-acetylhexosaminidase [Brucella abortus bv. 4 str. 292] gi|260672106|gb|EEX58927.1| beta-N-acetylhexosaminidase [Brucella abortus bv. 2 str. 86/8/59] gi|260873183|gb|EEX80252.1| beta-N-acetylhexosaminidase [Brucella abortus bv. 9 str. C68] gi|297175398|gb|EFH34745.1| beta-N-acetylhexosaminidase [Brucella abortus bv. 5 str. B3196] Length = 339 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+N + PVLD+ + +S+ P E + + + Sbjct: 112 AFDLLKVGVNADCLPVLDVPVEGAHDVIGM-RAYSKNPHAVAEMGRAAAEGLL 163 >gi|326329842|ref|ZP_08196162.1| beta-D-xylosidase [Nocardioidaceae bacterium Broad-1] gi|325952428|gb|EGD44448.1| beta-D-xylosidase [Nocardioidaceae bacterium Broad-1] Length = 777 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ G++ +PVLD++ + P A + R Sbjct: 126 IGADMRALGVHQGLAPVLDVIRDAR--WGRCEEAIGEDPYLVGTVATAYVRGLQ 177 >gi|17987370|ref|NP_540004.1| beta-hexosaminidase A [Brucella melitensis bv. 1 str. 16M] gi|225627367|ref|ZP_03785404.1| Beta-hexosaminidase A precursor [Brucella ceti str. Cudo] gi|17983056|gb|AAL52268.1| beta-hexosaminidase a [Brucella melitensis bv. 1 str. 16M] gi|225617372|gb|EEH14417.1| Beta-hexosaminidase A precursor [Brucella ceti str. Cudo] Length = 350 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+N + PVLD+ + +S+ P E + + + Sbjct: 123 AFDLLKVGVNADCLPVLDVPVEGAHDVIGM-RAYSKNPHAVAEMGRAAAEGLL 174 >gi|323492582|ref|ZP_08097728.1| beta-hexosaminidase [Vibrio brasiliensis LMG 20546] gi|323313184|gb|EGA66302.1| beta-hexosaminidase [Vibrio brasiliensis LMG 20546] Length = 328 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + + + Sbjct: 101 MAAELIAHDIDLSFAPVLDQGHECKAI---GDRAFGEDKETILRHSLAYMKGMK 151 >gi|87199113|ref|YP_496370.1| Beta-N-acetylhexosaminidase [Novosphingobium aromaticivorans DSM 12444] gi|87134794|gb|ABD25536.1| Beta-N-acetylhexosaminidase [Novosphingobium aromaticivorans DSM 12444] Length = 355 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +L +GI+V+ P+LD+ + P + + Sbjct: 125 LGLDLAEAGISVDCLPLLDVRQPGAHDVIG-DRALGSEPMRVAALGRATLDGL 176 >gi|237815309|ref|ZP_04594307.1| Beta-hexosaminidase A precursor [Brucella abortus str. 2308 A] gi|237790146|gb|EEP64356.1| Beta-hexosaminidase A precursor [Brucella abortus str. 2308 A] Length = 350 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ G+N + PVLD+ + +S+ P E + + + Sbjct: 123 AFDLLKVGVNADCLPVLDVPVEGAHDVIGM-RAYSKNPHAVAEMGRAAAEGLL 174 >gi|86360607|ref|YP_472495.1| putative beta-N-acetylhexosaminidase protein [Rhizobium etli CFN 42] gi|86284709|gb|ABC93768.1| putative beta-N-acetylhexosaminidase protein [Rhizobium etli CFN 42] Length = 340 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + G++ SPVLDL++ + + F P + ++ Sbjct: 112 MAAMMTELGLSSGCSPVLDLVFETTSAVIGA-RSFGSDPDVIAALGREVVDGLLE 165 >gi|319744723|gb|EFV97066.1| beta-N-acetylhexosaminidase [Streptococcus agalactiae ATCC 13813] Length = 596 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 7/51 (13%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 G N +F+P++DL I + + ++ + + Sbjct: 131 GMEASAVGCNASFAPIVDLTRNWRNPIIAS-RNWGANVDQIISLSKEYMKG 180 >gi|125623361|ref|YP_001031844.1| putative beta-N-acetylglucosaminidase [Lactococcus lactis subsp. cremoris MG1363] gi|124492169|emb|CAL97098.1| putative beta-N-acetylglucosaminidase [Lactococcus lactis subsp. cremoris MG1363] gi|300070109|gb|ADJ59509.1| putative beta-N-acetylglucosaminidase [Lactococcus lactis subsp. cremoris NZ9000] Length = 406 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Query: 2 AKNLVTSGINVNFSPVLD----LLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L +GIN + +PV D + P+ I ++ A A FS+ Sbjct: 181 GSELSAAGINFDLAPVADQVLSADFAPQNAPIGYWSRQYAYDKANIVSHADAFSKGMK 238 >gi|77413488|ref|ZP_00789678.1| glycosyl hydrolase, family 3 [Streptococcus agalactiae 515] gi|77160432|gb|EAO71553.1| glycosyl hydrolase, family 3 [Streptococcus agalactiae 515] Length = 596 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 7/51 (13%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 G N +F+P++DL I + + ++ + + Sbjct: 131 GMEASAVGCNASFAPIVDLTRNWRNPIIAS-RNWGANVDQIISLSKEYMKG 180 >gi|77405938|ref|ZP_00783018.1| glycosyl hydrolase, family 3 [Streptococcus agalactiae H36B] gi|77175449|gb|EAO78238.1| glycosyl hydrolase, family 3 [Streptococcus agalactiae H36B] Length = 596 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 7/51 (13%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 G N +F+P++DL I + + ++ + + Sbjct: 131 GMEASAVGCNASFAPIVDLTRNWRNPIIAS-RNWGANVDQIISLSKEYMKG 180 >gi|25010733|ref|NP_735128.1| glycosyl hydrolase, family 3 [Streptococcus agalactiae NEM316] gi|77410755|ref|ZP_00787113.1| glycosyl hydrolase, family 3 [Streptococcus agalactiae CJB111] gi|23095087|emb|CAD46322.1| Unknown [Streptococcus agalactiae NEM316] gi|77163134|gb|EAO74087.1| glycosyl hydrolase, family 3 [Streptococcus agalactiae CJB111] Length = 596 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 7/51 (13%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 G N +F+P++DL I + + ++ + + Sbjct: 131 GMEASAVGCNASFAPIVDLTRNWRNPIIAS-RNWGANVDQIISLSKEYMKG 180 >gi|237735009|ref|ZP_04565490.1| beta-N-acetylhexosaminidase [Mollicutes bacterium D7] gi|229381785|gb|EEO31876.1| beta-N-acetylhexosaminidase [Coprobacillus sp. D7] Length = 431 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++ L GINVN PV D+ + FI + F P + E + + Sbjct: 218 SEFLKEFGINVNIGPVADVAMSKDDFI--YQRSFGTDPNETAEFVKNVVKAMND 269 >gi|291533554|emb|CBL06667.1| Beta-glucosidase-related glycosidases [Megamonas hypermegale ART12/1] Length = 385 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 7/54 (12%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK+L GINVNF+PV D+ + +S + + ++ Y + Sbjct: 168 AKSLKDMGINVNFAPVADVGSNDK-------RSYSTDANTVIDFVRAATKGYQQ 214 >gi|189218191|ref|YP_001938833.1| Periplasmic beta-glucosidase [Methylacidiphilum infernorum V4] gi|189185049|gb|ACD82234.1| Periplasmic beta-glucosidase [Methylacidiphilum infernorum V4] Length = 612 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ + GI+ F+P+LD+ P + P A + + + N Sbjct: 14 AQEARSYGIHWTFAPMLDITRDPR--WGRVAECPGEDPYLASLLCAGWIKGFQGN 66 >gi|300723619|ref|YP_003712924.1| beta N-acetyl-glucosaminidase [Xenorhabdus nematophila ATCC 19061] gi|297630141|emb|CBJ90778.1| beta N-acetyl-glucosaminidase [Xenorhabdus nematophila ATCC 19061] Length = 339 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLDL + F P A A+ F + Sbjct: 104 MASEMIVMDIDISFAPVLDLGHKCTAI---GERSFHEEPELAIAMAERFIKGMH 154 >gi|170288303|ref|YP_001738541.1| glycoside hydrolase family 3 protein [Thermotoga sp. RQ2] gi|170175806|gb|ACB08858.1| glycoside hydrolase family 3 domain protein [Thermotoga sp. RQ2] Length = 772 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 11/58 (18%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 + +++ G + +PVLD+ P + F P + R N K Sbjct: 129 IREDMRKIGAHQGLAPVLDVARDPR--WGRTEETFGESPYLVARMGVSYVRGLQGNIK 184 >gi|311899321|dbj|BAJ31729.1| putative beta-xylosidase [Kitasatospora setae KM-6054] Length = 804 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + ++L G++ +PVLD++ + P A + R Sbjct: 172 IGRDLRAVGVHQGLAPVLDVVRDAR--WGRVEETIGEDPYLVGTVAAAYVRGL 222 >gi|167755261|ref|ZP_02427388.1| hypothetical protein CLORAM_00766 [Clostridium ramosum DSM 1402] gi|167705311|gb|EDS19890.1| hypothetical protein CLORAM_00766 [Clostridium ramosum DSM 1402] Length = 461 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++ L GINVN PV D+ + FI + F P + E + + Sbjct: 248 SEFLKEFGINVNIGPVADVAMSKDDFI--YQRSFGTDPNETAEFVKNVVKAMND 299 >gi|83767745|dbj|BAE57884.1| unnamed protein product [Aspergillus oryzae] Length = 741 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 8/44 (18%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Query: 12 VNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +N++PV D+ P + F P A ++ + Sbjct: 1 MNYAPVCDINSEPLNPVIGV-RSFGDHPGLVGRLACATAQGLRE 43 >gi|68535234|ref|YP_249939.1| putative beta-glucosidase-related glycosidase [Corynebacterium jeikeium K411] gi|68262833|emb|CAI36321.1| putative beta-glucosidase-related glycosidase [Corynebacterium jeikeium K411] Length = 401 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 5/57 (8%) Query: 2 AKNLVTSGINVNFSPVLDLLYG---PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K + GI V+F+PV+DL G + I FS P A + A+ +S + Sbjct: 178 GKKVRDLGITVDFAPVVDLAGGQEVSDNAIGS--RSFSADPKVAADYARAYSEGLQQ 232 >gi|326564344|gb|EGE14573.1| beta-hexosaminidase [Moraxella catarrhalis 46P47B1] Length = 357 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ G++ +F+PVLD+ ++ + F PA ++ F Sbjct: 107 MACEVLAVGVDFSFAPVLDID--GKSLVIG-DRAFHANPAAIIALSRQFMDGMKN 158 >gi|238919709|ref|YP_002933224.1| beta-hexosaminidase [Edwardsiella ictaluri 93-146] gi|259511216|sp|C5BFM6|NAGZ_EDWI9 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|238869278|gb|ACR68989.1| beta-hexosaminidase [Edwardsiella ictaluri 93-146] Length = 340 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL +G F R A AQ F + Sbjct: 104 MACEMIAMDIDLSFAPVLDLGHGSAAI---GERAFHREAESAIPLAQAFIDGMHQ 155 >gi|332671229|ref|YP_004454237.1| glycoside hydrolase family 3 domain-containing protein [Cellulomonas fimi ATCC 484] gi|332340267|gb|AEE46850.1| glycoside hydrolase family 3 domain protein [Cellulomonas fimi ATCC 484] Length = 760 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ G++ +PVLD++ P + P + R Sbjct: 143 IGGSMRALGVHQGLAPVLDVIRDPR--WGRVDECIGEDPYLVGTVGTSYVRGLQ 194 >gi|308186424|ref|YP_003930555.1| beta-N-acetylhexosaminidase [Pantoea vagans C9-1] gi|308056934|gb|ADO09106.1| beta-N-acetylhexosaminidase [Pantoea vagans C9-1] Length = 346 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I F PA A A+ F + Sbjct: 109 MAAEMIAMDIDISFAPVLDIGH-ISAAIG--DRSFHADPAIALAVARRFIAGMHE 160 >gi|315504984|ref|YP_004083871.1| glycoside hydrolase family 3 domain protein [Micromonospora sp. L5] gi|315411603|gb|ADU09720.1| glycoside hydrolase family 3 domain protein [Micromonospora sp. L5] Length = 379 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 24/59 (40%), Gaps = 9/59 (15%) Query: 5 LVTSGINVNFSPVLDLLYGP---------ETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L G+N+N++PV+DL Y P I + FS P +A + + Sbjct: 153 LTRIGVNLNYAPVVDLNYAPVVDLNINPDSRAIGKLGRSFSADPDVVVSNATEEIQAHR 211 >gi|297189968|ref|ZP_06907366.1| glycoside hydrolase family 3 protein [Streptomyces pristinaespiralis ATCC 25486] gi|197718625|gb|EDY62533.1| glycoside hydrolase family 3 protein [Streptomyces pristinaespiralis ATCC 25486] Length = 800 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 M + + G+ +PV+D+ + + P F+R N Sbjct: 129 MRRQMRAVGMLQALAPVIDVARDAR--WGRMTETYGEDPYLVAALGVAFTRGMQGN 182 >gi|251794353|ref|YP_003009084.1| glycoside hydrolase [Paenibacillus sp. JDR-2] gi|247541979|gb|ACS98997.1| glycoside hydrolase family 3 domain protein [Paenibacillus sp. JDR-2] Length = 720 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK +GI+V F+P++DL+ P + P E A+ F R + Sbjct: 120 AKESAVTGIHVTFAPMVDLVRDPR--WGRVMESTGEDPYLNSEYARAFVRGFQ 170 >gi|302553599|ref|ZP_07305941.1| xylan 1,4-beta-xylosidase [Streptomyces viridochromogenes DSM 40736] gi|302471217|gb|EFL34310.1| xylan 1,4-beta-xylosidase [Streptomyces viridochromogenes DSM 40736] Length = 717 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +L ++G++ +PVLD++ P + P + R Sbjct: 93 IGDDLRSAGVHQGLAPVLDVVRDPR--WGRVEETIGEDPYLVGTIGTAYVRGL 143 >gi|115433022|ref|XP_001216648.1| conserved hypothetical protein [Aspergillus terreus NIH2624] gi|114189500|gb|EAU31200.1| conserved hypothetical protein [Aspergillus terreus NIH2624] Length = 794 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + GI F+P DL P + S P A E F + KN Sbjct: 180 IGQEARALGITQVFAPSADLARDPRH--GRVEESMSEDPYLAGEMVAHFVQGLWKN 233 >gi|167949826|ref|ZP_02536900.1| Glycoside hydrolase, family 3-like protein [Endoriftia persephone 'Hot96_1+Hot96_2'] Length = 83 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Query: 8 SGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 G++ +F+PVLDL G I FS P + A+ + R Sbjct: 1 MGVDFSFAPVLDLDMGVSEVIG--DRAFSSSPEVVADLARAWMRGVH 45 >gi|291482541|dbj|BAI83616.1| hypothetical protein BSNT_00317 [Bacillus subtilis subsp. natto BEST195] Length = 642 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K L GIN +FSPV+D+ P + FS + Sbjct: 160 IGKELSALGINTDFSPVVDINNNPNNPVIGV-RSFSSNRELTSRLGLYTMKGLQ 212 >gi|260597478|ref|YP_003210049.1| beta-hexosaminidase [Cronobacter turicensis z3032] gi|260216655|emb|CBA29982.1| Beta-hexosaminidase [Cronobacter turicensis z3032] Length = 341 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + F P A+ F Sbjct: 104 MACEMIAMDIDISFAPVLDVGHLSAAI---GERSFHDEPENVLAMAKRFISGMR 154 >gi|168333660|ref|ZP_02691915.1| Beta-glucosidase-related glycosidase [Epulopiscium sp. 'N.t. morphotype B'] Length = 509 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GIN N +P LD+ P I F P + + Sbjct: 112 GEMLEALGINYNLAPSLDINNNPNNPIIGI-RSFGENPETVTNMGLACIKGFQD 164 >gi|269139235|ref|YP_003295936.1| beta-N-acetylhexosaminidase [Edwardsiella tarda EIB202] gi|267984896|gb|ACY84725.1| beta-N-acetylhexosaminidase [Edwardsiella tarda EIB202] gi|304559145|gb|ADM41809.1| Beta N-acetyl-glucosaminidase [Edwardsiella tarda FL6-60] Length = 340 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL +G F R A AQ F + Sbjct: 104 MACEMIAMDIDLSFAPVLDLGHGSAAI---GERAFHREAESAIPLAQAFIDGMHQ 155 >gi|126734652|ref|ZP_01750398.1| Putative Glycoside hydrolase [Roseobacter sp. CCS2] gi|126715207|gb|EBA12072.1| Putative Glycoside hydrolase [Roseobacter sp. CCS2] Length = 327 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L GI+ N +P+ D+ + K ++ +++ + ++ Sbjct: 103 IAAELHDVGIDANCAPLADIAEDATHPV-LKNRLYGYDVETVVAASRTCADAHL 155 >gi|262172231|ref|ZP_06039909.1| beta N-acetyl-glucosaminidase [Vibrio mimicus MB-451] gi|261893307|gb|EEY39293.1| beta N-acetyl-glucosaminidase [Vibrio mimicus MB-451] Length = 330 Score = 47.5 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFACKAI---GNRAFGEDVQTVLNHSSAFLRGMK 151 >gi|254488935|ref|ZP_05102140.1| beta-N-acetylhexosaminidase [Roseobacter sp. GAI101] gi|214045804|gb|EEB86442.1| beta-N-acetylhexosaminidase [Roseobacter sp. GAI101] Length = 334 Score = 47.5 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L GI+ N +P++D+ GP+T + A+ + + + Sbjct: 106 IADELYNIGIDSNCAPMVDVA-GPQTHEFLYNRCYGTDAAQVATLGRAAADGML 158 >gi|148826390|ref|YP_001291143.1| beta-hexosaminidase [Haemophilus influenzae PittEE] gi|229846019|ref|ZP_04466131.1| beta-hexosaminidase [Haemophilus influenzae 7P49H1] gi|166233257|sp|A5UDA9|NAGZ_HAEIE RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|148716550|gb|ABQ98760.1| beta-hexosaminidase [Haemophilus influenzae PittEE] gi|229811023|gb|EEP46740.1| beta-hexosaminidase [Haemophilus influenzae 7P49H1] Length = 350 Score = 47.5 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + FS A A F + Sbjct: 104 MAAEMIALDIDLSFAPVLDLGHECRAI---GDRSFSSDVKSAVNLAINFIDGMHQ 155 >gi|68249547|ref|YP_248659.1| beta-hexosaminidase [Haemophilus influenzae 86-028NP] gi|81336026|sp|Q4QLU8|NAGZ_HAEI8 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|68057746|gb|AAX87999.1| beta-hexosaminidase [Haemophilus influenzae 86-028NP] Length = 351 Score = 47.5 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLDL + FS A A F + Sbjct: 104 MAAEMIALDIDLSFAPVLDLGHECRAI---GDRSFSSDVKSAVNLAINFIDGMHQ 155 >gi|50120744|ref|YP_049911.1| beta-hexosaminidase [Pectobacterium atrosepticum SCRI1043] gi|81645360|sp|Q6D674|NAGZ_ERWCT RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|49611270|emb|CAG74717.1| beta-hexosaminidase [Pectobacterium atrosepticum SCRI1043] Length = 342 Score = 47.5 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + F P A AQ F R Sbjct: 104 MAAEMIAMDIDISFAPVLDIGHQSAAI---GERSFHEQPEMALAVAQSFIRGMH 154 >gi|242239044|ref|YP_002987225.1| beta-hexosaminidase [Dickeya dadantii Ech703] gi|242131101|gb|ACS85403.1| glycoside hydrolase family 3 domain protein [Dickeya dadantii Ech703] Length = 348 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA +++ I+++F+PVLD+ + F P A F + + Sbjct: 111 MAAEMISMDIDISFAPVLDVGHQSAAI---GDRAFHDEPDTLLAVAGGFIQGMRQ 162 >gi|296128982|ref|YP_003636232.1| glycoside hydrolase family 3 domain protein [Cellulomonas flavigena DSM 20109] gi|296020797|gb|ADG74033.1| glycoside hydrolase family 3 domain protein [Cellulomonas flavigena DSM 20109] Length = 760 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ T G++ +PVLD++ P + S P + R Sbjct: 143 IGESMRTLGVHQGLAPVLDVIRDPR--WGRVDECISEDPYLVGTVGTSYVRGLQ 194 >gi|119945674|ref|YP_943354.1| glycoside hydrolase family 3 protein [Psychromonas ingrahamii 37] gi|166233259|sp|A1SW90|NAGZ_PSYIN RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|119864278|gb|ABM03755.1| beta-N-acetylhexosaminidase. Glycosyl Hydrolase family 3 [Psychromonas ingrahamii 37] Length = 337 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+ +F+PVLDL G I + FS + A+ + Sbjct: 104 MASELIACDIDFSFAPVLDLN-GISNVI--QNRAFSSSITETVTLAEAYINGMK 154 >gi|289177688|gb|ADC84934.1| Beta-glucosidase [Bifidobacterium animalis subsp. lactis BB-12] Length = 818 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ + +G++ FSPVL + + F P E A + Y KN Sbjct: 168 AEEVSCTGVHWTFSPVLCIARDTR--WGRVDETFGEDPVLIGEMASAMVKGYQKN 220 >gi|219683378|ref|YP_002469761.1| beta-D-glucosideglucohydrolase [Bifidobacterium animalis subsp. lactis AD011] gi|219621028|gb|ACL29185.1| beta-D-glucosideglucohydrolase [Bifidobacterium animalis subsp. lactis AD011] Length = 807 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ + +G++ FSPVL + + F P E A + Y KN Sbjct: 157 AEEVSCTGVHWTFSPVLCIARDTR--WGRVDETFGEDPVLIGEMASAMVKGYQKN 209 >gi|183602858|ref|ZP_02964219.1| beta-D-glucosideglucohydrolase [Bifidobacterium animalis subsp. lactis HN019] gi|241191560|ref|YP_002968954.1| beta-D-glucosideglucohydrolase [Bifidobacterium animalis subsp. lactis Bl-04] gi|241196965|ref|YP_002970520.1| beta-D-glucosideglucohydrolase [Bifidobacterium animalis subsp. lactis DSM 10140] gi|183217911|gb|EDT88561.1| beta-D-glucosideglucohydrolase [Bifidobacterium animalis subsp. lactis HN019] gi|240249952|gb|ACS46892.1| beta-D-glucosideglucohydrolase [Bifidobacterium animalis subsp. lactis Bl-04] gi|240251519|gb|ACS48458.1| beta-D-glucosideglucohydrolase [Bifidobacterium animalis subsp. lactis DSM 10140] gi|295794552|gb|ADG34087.1| beta-D-glucosideglucohydrolase [Bifidobacterium animalis subsp. lactis V9] Length = 776 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ + +G++ FSPVL + + F P E A + Y KN Sbjct: 126 AEEVSCTGVHWTFSPVLCIARDTR--WGRVDETFGEDPVLIGEMASAMVKGYQKN 178 >gi|281490994|ref|YP_003352974.1| family 3 glycosyl hydrolase [Lactococcus lactis subsp. lactis KF147] gi|281374752|gb|ADA64272.1| Glycoside hydrolase, family 3 [Lactococcus lactis subsp. lactis KF147] gi|326406028|gb|ADZ63099.1| family 3 glycosyl hydrolase [Lactococcus lactis subsp. lactis CV56] Length = 403 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Query: 2 AKNLVTSGINVNFSPVLD----LLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L +G+N + +PV D + P+ I ++ A AQ F+ Sbjct: 178 GSELYAAGVNFDLAPVADQVLSADFAPQNAPIGYWSRQYAYDKASIISHAQAFTEGMK 235 >gi|15672482|ref|NP_266656.1| hypothetical protein L100350 [Lactococcus lactis subsp. lactis Il1403] gi|12723382|gb|AAK04598.1|AE006285_6 conserved hypothetical protein [Lactococcus lactis subsp. lactis Il1403] Length = 403 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Query: 2 AKNLVTSGINVNFSPVLD----LLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L +G+N + +PV D + P+ I ++ A AQ F+ Sbjct: 178 GSELYAAGVNFDLAPVADQVLSADFAPQNAPIGYWSRQYAYDKASIISHAQAFTEGMK 235 >gi|187736587|ref|YP_001878699.1| Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835] gi|187426639|gb|ACD05918.1| Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835] Length = 353 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 12/49 (24%), Positives = 21/49 (42%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 A L G+N+NF+PVLD+ + P A + +++ Sbjct: 101 ALALRYLGVNLNFAPVLDICHDPSAANALPGRCWGDNAQDVISRGGVYA 149 >gi|146419213|ref|XP_001485570.1| hypothetical protein PGUG_01241 [Meyerozyma guilliermondii ATCC 6260] Length = 990 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 15/55 (27%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L G + PVLD++ + F +R Sbjct: 111 LATELKHIGFLMILGPVLDVVTKLSHQLVGV-RSFGTTLESVTRYGMACARGLQD 164 >gi|283833516|ref|ZP_06353257.1| beta-hexosaminidase [Citrobacter youngae ATCC 29220] gi|291071184|gb|EFE09293.1| beta-hexosaminidase [Citrobacter youngae ATCC 29220] Length = 337 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I + P KA A F Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPLKALAMATRFIDGMH 150 >gi|227111694|ref|ZP_03825350.1| beta-hexosaminidase [Pectobacterium carotovorum subsp. brasiliensis PBR1692] Length = 338 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + F P A AQ F Sbjct: 100 MAAEMIAMDIDISFAPVLDIGHQSAAI---GERSFHANPETALAVAQSFIHGMH 150 >gi|257093439|ref|YP_003167080.1| Beta-N-acetylhexosaminidase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] gi|257045963|gb|ACV35151.1| Beta-N-acetylhexosaminidase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] Length = 481 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 19/59 (32%), Gaps = 5/59 (8%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFI-----AQKRSIFSRIPAKAEESAQLFSRTYIK 55 +L G+N+N +PV+DL PA E A+ + Sbjct: 214 GASLAALGVNLNLAPVVDLRPSEPNAALAFLTGSGGRAIDDDPAVVTEVARAYVAGLAD 272 >gi|22536869|ref|NP_687720.1| glycosy hydrolase family protein [Streptococcus agalactiae 2603V/R] gi|76798565|ref|ZP_00780796.1| glycosyl hydrolase, family 3 [Streptococcus agalactiae 18RS21] gi|22533718|gb|AAM99592.1|AE014223_11 glycosyl hydrolase, family 3 [Streptococcus agalactiae 2603V/R] gi|76586071|gb|EAO62598.1| glycosyl hydrolase, family 3 [Streptococcus agalactiae 18RS21] Length = 596 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 8/51 (15%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 G N +FSP++DL I + + ++ + + Sbjct: 131 GMEASAVGCNASFSPIVDLTRNWRNPIIAS-RNWGANVDQIISLSKEYMKG 180 >gi|327304847|ref|XP_003237115.1| glycosyl hydrolase [Trichophyton rubrum CBS 118892] gi|326460113|gb|EGD85566.1| glycosyl hydrolase [Trichophyton rubrum CBS 118892] Length = 353 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 16/49 (32%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 A L IN N +PVLD+ FI + F F Sbjct: 130 AAALKAQKINGNLAPVLDIYREEGNFIDEFGRSFGNNTEIVTSCGSAFV 178 >gi|237731087|ref|ZP_04561568.1| beta-hexosaminidase [Citrobacter sp. 30_2] gi|226906626|gb|EEH92544.1| beta-hexosaminidase [Citrobacter sp. 30_2] Length = 341 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I + P KA A F Sbjct: 104 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPLKALAMATRFIDGMH 154 >gi|77408354|ref|ZP_00785095.1| glycosyl hydrolase, family 3 [Streptococcus agalactiae COH1] gi|77173035|gb|EAO76163.1| glycosyl hydrolase, family 3 [Streptococcus agalactiae COH1] Length = 596 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 8/51 (15%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 G N +FSP++DL I + + ++ + + Sbjct: 131 GMEASAVGCNASFSPIVDLTRNWRNPIIAS-RNWGANVDQIISLSKEYMKG 180 >gi|84516345|ref|ZP_01003705.1| putative Glycoside hydrolase [Loktanella vestfoldensis SKA53] gi|84510041|gb|EAQ06498.1| putative Glycoside hydrolase [Loktanella vestfoldensis SKA53] Length = 328 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A +L++ GI+VN +P+ DL + ++ R +A+ + + Sbjct: 104 IAHDLLSVGIDVNCAPLADLAEDATHP-FLQNRLYGRDVPTVIAAARACADGLL 156 >gi|260881370|ref|ZP_05404229.2| glycosyl hydrolase domain protein [Mitsuokella multacida DSM 20544] gi|260849219|gb|EEX69226.1| glycosyl hydrolase domain protein [Mitsuokella multacida DSM 20544] Length = 381 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 21/54 (38%), Gaps = 8/54 (14%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G NVNF+PV D + F P + + ++ Y + Sbjct: 165 AEKLKKLGFNVNFAPVAD--------VGDYARSFGPDPEQTAKFVAAAAQGYEQ 210 >gi|320157338|ref|YP_004189717.1| beta N-acetyl-glucosaminidase [Vibrio vulnificus MO6-24/O] gi|319932650|gb|ADV87514.1| beta N-acetyl-glucosaminidase [Vibrio vulnificus MO6-24/O] Length = 328 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD +G + F + + + Sbjct: 101 MAAELIAHDIDLSFAPVLDQGFGCKAI---GNRAFGEDTQTILRHSSAYMQGMK 151 >gi|27363960|ref|NP_759488.1| beta-hexosaminidase [Vibrio vulnificus CMCP6] gi|27360077|gb|AAO09015.1| Beta N-acetyl-glucosaminidase [Vibrio vulnificus CMCP6] Length = 328 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD +G + F + + + Sbjct: 101 MAAELIAHDIDLSFAPVLDQGFGCKAI---GNRAFGEDTQTILRHSSAYMQGMK 151 >gi|37678884|ref|NP_933493.1| beta-hexosaminidase [Vibrio vulnificus YJ016] gi|37197625|dbj|BAC93464.1| beta-hexosaminidase [Vibrio vulnificus YJ016] Length = 328 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD +G + F + + + Sbjct: 101 MAAELIAHDIDLSFAPVLDQGFGCKAI---GNRAFGEDTQTILRHSSAYMQGMK 151 >gi|255321147|ref|ZP_05362313.1| beta-hexosaminidase [Acinetobacter radioresistens SK82] gi|262380165|ref|ZP_06073320.1| beta-hexosaminidase [Acinetobacter radioresistens SH164] gi|255301701|gb|EET80952.1| beta-hexosaminidase [Acinetobacter radioresistens SK82] gi|262298359|gb|EEY86273.1| beta-hexosaminidase [Acinetobacter radioresistens SH164] Length = 341 Score = 47.5 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ GI+ +F+PVLD+ I F+ A A F + Sbjct: 106 MATEVLAVGIDFSFAPVLDIN-AISDVIG--DRGFALTQADIIPLAHAFIQGMH 156 >gi|156934406|ref|YP_001438322.1| beta-hexosaminidase [Cronobacter sakazakii ATCC BAA-894] gi|166233256|sp|A7MFT1|NAGZ_ENTS8 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|156532660|gb|ABU77486.1| hypothetical protein ESA_02237 [Cronobacter sakazakii ATCC BAA-894] Length = 341 Score = 47.5 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + F P A+ F Sbjct: 104 MACEMIAMDIDISFAPVLDVGHLSAAI---GERSFHEEPENVLAMAKRFITGMQ 154 >gi|328472081|gb|EGF42958.1| beta-hexosaminidase [Vibrio parahaemolyticus 10329] Length = 327 Score = 47.5 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + + + Sbjct: 101 MAAELIAHDIDLSFAPVLDKGHQCKAI---GNRSFGEDADTILRYSTAYMQGMK 151 >gi|312889809|ref|ZP_07749355.1| Beta-N-acetylhexosaminidase [Mucilaginibacter paludis DSM 18603] gi|311297735|gb|EFQ74858.1| Beta-N-acetylhexosaminidase [Mucilaginibacter paludis DSM 18603] Length = 575 Score = 47.5 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A + G+ +NF+P +D+ P + F + + + N Sbjct: 154 ANDFKRLGMQMNFAPDMDVNNNPNNPVIG-YRSFGDNKFNVAKKGIAYMQGMQNN 207 >gi|271500146|ref|YP_003333171.1| glycoside hydrolase family 3 domain-containing protein [Dickeya dadantii Ech586] gi|270343701|gb|ACZ76466.1| glycoside hydrolase family 3 domain protein [Dickeya dadantii Ech586] Length = 341 Score = 47.5 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++T I+++F+PVLD+ + F P A+ F Sbjct: 104 MAAEMITLDIDISFAPVLDVGHQSAAI---GDRAFHDDPDTLLAVAEHFIAGMR 154 >gi|153838764|ref|ZP_01991431.1| beta-hexosaminidase [Vibrio parahaemolyticus AQ3810] gi|149747796|gb|EDM58686.1| beta-hexosaminidase [Vibrio parahaemolyticus AQ3810] Length = 327 Score = 47.5 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + + + Sbjct: 101 MAAELIAHDIDLSFAPVLDKGHQCKAI---GNRSFGEDADTILRYSTAYMQGMK 151 >gi|28897319|ref|NP_796924.1| beta-hexosaminidase [Vibrio parahaemolyticus RIMD 2210633] gi|260363881|ref|ZP_05776629.1| beta-L-N-acetylhexosaminidase [Vibrio parahaemolyticus K5030] gi|260876282|ref|ZP_05888637.1| beta-L-N-acetylhexosaminidase [Vibrio parahaemolyticus AN-5034] gi|260895089|ref|ZP_05903585.1| beta-L-N-acetyl hexosaminidase [Vibrio parahaemolyticus Peru-466] gi|28805528|dbj|BAC58808.1| beta-hexosaminidase [Vibrio parahaemolyticus RIMD 2210633] gi|308088917|gb|EFO38612.1| beta-L-N-acetyl hexosaminidase [Vibrio parahaemolyticus Peru-466] gi|308092852|gb|EFO42547.1| beta-L-N-acetylhexosaminidase [Vibrio parahaemolyticus AN-5034] gi|308112980|gb|EFO50520.1| beta-L-N-acetylhexosaminidase [Vibrio parahaemolyticus K5030] Length = 327 Score = 47.5 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + + + Sbjct: 101 MAAELIAHDIDLSFAPVLDKGHQCKAI---GNRSFGEDADTILRYSTAYMQGMK 151 >gi|284007290|emb|CBA72620.1| beta-hexosaminidase [Arsenophonus nasoniae] Length = 338 Score = 47.5 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + IA F + A A+ F Sbjct: 105 MAAEMIAMDIDISFAPVLDIGH---HCIAIGDRSFHQQLDIAIMMAEAFITGMH 155 >gi|295096201|emb|CBK85291.1| beta-N-acetylhexosaminidase [Enterobacter cloacae subsp. cloacae NCTC 9394] Length = 337 Score = 47.5 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD + I + P A A F Sbjct: 100 MASEMIAMDIDISFAPVLDAGH-ISAAIG--ERSYHDDPRIALAMATRFIDGMH 150 >gi|332884165|gb|EGK04433.1| hypothetical protein HMPREF9456_00760 [Dysgonomonas mossii DSM 22836] Length = 743 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 23/61 (37%), Gaps = 6/61 (9%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK----NP 57 A +GI F+P++D+ + P + F P E + R + NP Sbjct: 130 ATEASAAGIRWTFAPMIDITHDPR--WGRIAEGFGEDPYLVSEMGKASIRGFQGRSLHNP 187 Query: 58 K 58 + Sbjct: 188 R 188 >gi|157146193|ref|YP_001453512.1| beta-hexosaminidase [Citrobacter koseri ATCC BAA-895] gi|157083398|gb|ABV13076.1| hypothetical protein CKO_01949 [Citrobacter koseri ATCC BAA-895] Length = 337 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I + P KA A F Sbjct: 100 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADPLKALAMATRFIDGMH 150 >gi|238018308|ref|ZP_04598734.1| hypothetical protein VEIDISOL_00132 [Veillonella dispar ATCC 17748] gi|237864779|gb|EEP66069.1| hypothetical protein VEIDISOL_00132 [Veillonella dispar ATCC 17748] Length = 382 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 19/54 (35%), Gaps = 7/54 (12%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G N+NF+PV DL FS P + A + Y + Sbjct: 166 GTELKDLGFNINFAPVADLGL-------TYGRSFSTNPDEVVRYASAVGKAYDE 212 >gi|3941372|gb|AAC99628.1| BxlA [Streptomyces lividans] Length = 861 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +++ + GI+ +PVLD++ + P + + Sbjct: 156 IGRDMRSVGIHQGLAPVLDVVRDGR--WGRVEETIGEDPYLVGTIGTAYVQGL 206 >gi|260903291|ref|ZP_05911686.1| beta-L-N-acetylhexosaminidase [Vibrio parahaemolyticus AQ4037] gi|308107930|gb|EFO45470.1| beta-L-N-acetylhexosaminidase [Vibrio parahaemolyticus AQ4037] Length = 327 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + + + Sbjct: 101 MAAELIAHDIDLSFAPVLDKGHQCKAI---GNRAFGEDADTILRYSTAYMQGMK 151 >gi|268316642|ref|YP_003290361.1| glycoside hydrolase family 3 domain-containing protein [Rhodothermus marinus DSM 4252] gi|262334176|gb|ACY47973.1| glycoside hydrolase family 3 domain protein [Rhodothermus marinus DSM 4252] Length = 784 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G++ +PV+D+ P + F P E + Sbjct: 150 IAREVRARGVHQVLAPVVDVGREPR--WGRIEETFGEDPYLVAEMGKAAVWGLQ 201 >gi|268316641|ref|YP_003290360.1| glycoside hydrolase family 3 domain-containing protein [Rhodothermus marinus DSM 4252] gi|262334175|gb|ACY47972.1| glycoside hydrolase family 3 domain protein [Rhodothermus marinus DSM 4252] Length = 792 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G++ +PV+D+ P + F P E + Sbjct: 158 IAREVRARGVHQVLAPVVDVGREPR--WGRIEETFGEDPYLVAEMGKAAVWGLQ 209 >gi|241957812|ref|XP_002421625.1| beta-n-acetylglucosaminidase, putative [Candida dubliniensis CD36] gi|223644970|emb|CAX39562.1| beta-n-acetylglucosaminidase, putative [Candida dubliniensis CD36] Length = 960 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A + G ++ PVLD++ + F + ++ +R Sbjct: 114 IATEIKKIGFSIILGPVLDVVTKLSHQLVGV-RSFGTTIEDVVKYGRMCARGLQD 167 >gi|90962539|ref|YP_536455.1| Beta-N-acetylhexosaminidase [Lactobacillus salivarius UCC118] gi|90821733|gb|ABE00372.1| Beta-N-acetylhexosaminidase [Lactobacillus salivarius UCC118] Length = 367 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L GIN +F+PV D+ P +FI + + K Sbjct: 151 AEILRNLGINWDFAPVADVSNDPNSFI--YDRTLGQNYQLTAQYVSKVVPAIQK 202 >gi|239983655|ref|ZP_04706179.1| beta-xylosidase [Streptomyces albus J1074] gi|291455465|ref|ZP_06594855.1| beta-xylosidase [Streptomyces albus J1074] gi|291358414|gb|EFE85316.1| beta-xylosidase [Streptomyces albus J1074] Length = 808 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + ++L + G++ +PVLD++ + P A + R Sbjct: 164 IGRDLRSVGVHQGLAPVLDVVRDAR--WGRVEETIGEDPYLVGTVATAYVRGL 214 >gi|323497809|ref|ZP_08102823.1| beta-hexosaminidase [Vibrio sinaloensis DSM 21326] gi|323317156|gb|EGA70153.1| beta-hexosaminidase [Vibrio sinaloensis DSM 21326] Length = 328 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + + + + Sbjct: 101 MAAELIAHDIDLSFAPVLDKGHECKAI---GNRAFGQDVETILRHSLAYMKGMK 151 >gi|239928366|ref|ZP_04685319.1| beta-D-xylosidase [Streptomyces ghanaensis ATCC 14672] gi|291436693|ref|ZP_06576083.1| beta-D-xylosidase [Streptomyces ghanaensis ATCC 14672] gi|291339588|gb|EFE66544.1| beta-D-xylosidase [Streptomyces ghanaensis ATCC 14672] Length = 793 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 7/55 (12%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + +++ + G++ +PVLD++ + P + R + Sbjct: 156 IGRDMRSVGVHQGLAPVLDVVRDAR--WGRVEETIGEDPYLVGTIGTAYVRGLEE 208 >gi|86142030|ref|ZP_01060554.1| putative beta-glucosidase [Leeuwenhoekiella blandensis MED217] gi|85831593|gb|EAQ50049.1| putative beta-glucosidase [Leeuwenhoekiella blandensis MED217] Length = 803 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 23/61 (37%), Gaps = 6/61 (9%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI----KNP 57 AK L G ++ + P+LDL P ++ F P E + +NP Sbjct: 181 AKELRAQGAHIGYGPILDLAREPR--WSRVEETFGEDPYLISEMGLGVIEGFQGEGIENP 238 Query: 58 K 58 + Sbjct: 239 E 239 >gi|227891403|ref|ZP_04009208.1| possible beta-N-acetylhexosaminidase [Lactobacillus salivarius ATCC 11741] gi|227866792|gb|EEJ74213.1| possible beta-N-acetylhexosaminidase [Lactobacillus salivarius ATCC 11741] Length = 205 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK L + GIN NF+PV D+ P +FI + + K Sbjct: 9 AKVLRSLGINWNFAPVADVSDDPNSFI--YNRTLGQNYKLTAQYVSKVVPAIQK 60 >gi|242817272|ref|XP_002486922.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218713387|gb|EED12811.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 970 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 16/54 (29%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K L G+N PV D+ + F P E A Y + Sbjct: 161 GKELACIGVNWLVGPVFDVHSNTKPQPMGV-RCFGEYPEIVAEQALESMLGYQE 213 >gi|192359054|ref|YP_001981636.1| putative 1,4-beta-D-glucan glucohydrolase cel3D [Cellvibrio japonicus Ueda107] gi|190685219|gb|ACE82897.1| putative 1,4-beta-D-glucan glucohydrolase cel3D [Cellvibrio japonicus Ueda107] Length = 1069 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK + ++GI F+P L + + ++ P A Sbjct: 173 AKEVRSTGIEWVFAPTLAVAQNDR--WGRTYESYAEDPKVVATLATAMVEGLQ 223 >gi|307330635|ref|ZP_07609774.1| glycoside hydrolase family 3 domain protein [Streptomyces violaceusniger Tu 4113] gi|306883696|gb|EFN14743.1| glycoside hydrolase family 3 domain protein [Streptomyces violaceusniger Tu 4113] Length = 804 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +L ++GI+ +PVLD++ + P + R Sbjct: 146 IGGSLRSAGIHQGLAPVLDVVRDAR--WGRTEESIGEDPYLVATIGTAYVRGL 196 >gi|330466161|ref|YP_004403904.1| glycoside hydrolase family 3 domain-containing protein [Verrucosispora maris AB-18-032] gi|328809132|gb|AEB43304.1| glycoside hydrolase family 3 domain protein [Verrucosispora maris AB-18-032] Length = 483 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 9/39 (23%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIP 39 + L GI VN +P +D+ + + F P Sbjct: 110 IGGELAALGITVNLAPTVDVNSTDDNPVIGT-RSFGADP 147 >gi|302873935|ref|YP_003842568.1| glycoside hydrolase family 3 domain-containing protein [Clostridium cellulovorans 743B] gi|307689813|ref|ZP_07632259.1| glycoside hydrolase family 3 domain-containing protein [Clostridium cellulovorans 743B] gi|302576792|gb|ADL50804.1| glycoside hydrolase family 3 domain protein [Clostridium cellulovorans 743B] Length = 732 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK GI FSP++D+ P + + AQ R Y Sbjct: 124 AKEATICGIRWTFSPMIDVSRNP--KWGRVAEGYGEDAFLVSSFAQAVIRGYQ 174 >gi|251795208|ref|YP_003009939.1| glycoside hydrolase [Paenibacillus sp. JDR-2] gi|247542834|gb|ACS99852.1| glycoside hydrolase family 3 domain protein [Paenibacillus sp. JDR-2] Length = 878 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + GI+ F PVLDL P + F A A + Sbjct: 146 IAAESRSVGIHETFGPVLDLAREPR--WGRVEETFGEDTHLASRMAVAMIKGLQ 197 >gi|312881903|ref|ZP_07741666.1| beta-hexosaminidase [Vibrio caribbenthicus ATCC BAA-2122] gi|309370421|gb|EFP97910.1| beta-hexosaminidase [Vibrio caribbenthicus ATCC BAA-2122] Length = 327 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD+ + + F + + + + Sbjct: 101 MAAELIAHDIDLSFAPVLDMGHQCKA--IGT-RSFGEDKTTILKHSGAYIQGMK 151 >gi|289774037|ref|ZP_06533415.1| beta-xylosidase [Streptomyces lividans TK24] gi|289704236|gb|EFD71665.1| beta-xylosidase [Streptomyces lividans TK24] Length = 792 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +++ G++ +PVLD++ + P + R Sbjct: 152 IGRDMRAVGVHQGLAPVLDVVRDAR--WGRVEETIGEDPYLVGTIGTAYVRGL 202 >gi|290958100|ref|YP_003489282.1| beta-xylosidase [Streptomyces scabiei 87.22] gi|260647626|emb|CBG70731.1| putative beta-xylosidase [Streptomyces scabiei 87.22] Length = 761 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + ++ + G++ SPVLD++ P + P + R Sbjct: 145 IGHDMASVGVHQGLSPVLDVVRDPR--WGRVEETVGEDPYLVGTIGSAYVRGL 195 >gi|256790160|ref|ZP_05528591.1| beta-xylosidase [Streptomyces lividans TK24] Length = 796 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +++ G++ +PVLD++ + P + R Sbjct: 156 IGRDMRAVGVHQGLAPVLDVVRDAR--WGRVEETIGEDPYLVGTIGTAYVRGL 206 >gi|256783665|ref|ZP_05522096.1| beta-D-xylosidase [Streptomyces lividans TK24] gi|289767549|ref|ZP_06526927.1| beta-D-xylosidase [Streptomyces lividans TK24] gi|289697748|gb|EFD65177.1| beta-D-xylosidase [Streptomyces lividans TK24] Length = 797 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +++ + GI+ +PVLD++ + P + + Sbjct: 156 IGRDMRSVGIHQGLAPVLDVVRDAR--WGRVEETIGEDPYLVGTIGTAYVQGL 206 >gi|21218842|ref|NP_624621.1| beta-xylosidase [Streptomyces coelicolor A3(2)] gi|5881851|emb|CAB55650.1| putative beta-xylosidase [Streptomyces coelicolor A3(2)] Length = 796 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +++ G++ +PVLD++ + P + R Sbjct: 156 IGRDMRAVGVHQGLAPVLDVVRDAR--WGRVEETIGEDPYLVGTIGTAYVRGL 206 >gi|21225316|ref|NP_631095.1| beta-D-xylosidase [Streptomyces coelicolor A3(2)] gi|7619786|emb|CAB88164.1| beta-D-xylosidase [Streptomyces coelicolor A3(2)] Length = 797 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +++ + GI+ +PVLD++ + P + + Sbjct: 156 IGRDMRSVGIHQGLAPVLDVVRDAR--WGRVEETIGEDPYLVGTIGTAYVQGL 206 >gi|319783186|ref|YP_004142662.1| glycoside hydrolase family 3 domain protein [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317169074|gb|ADV12612.1| glycoside hydrolase family 3 domain protein [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 339 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +L+ GI + PVLD+ + + + + P E + + I Sbjct: 112 AFDLLRYGITADCLPVLDVPIEGASDVIGA-RAYGKDPRPVIELGRAAAEGLI 163 >gi|258543787|ref|ZP_05704021.1| beta-hexosaminidase [Cardiobacterium hominis ATCC 15826] gi|258520962|gb|EEV89821.1| beta-hexosaminidase [Cardiobacterium hominis ATCC 15826] Length = 335 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A L I+ +F+PVLDL I PA A R Sbjct: 105 IAYELRQFSIDFSFTPVLDLHDPVSEVIG--DRALHANPAVVVTLADALRRGL 155 >gi|257449952|gb|ACV53814.1| glycoside hydrolase family 3 domain protein [Anabaena fertilissima RPAN1] Length = 366 Score = 47.1 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 A L + GIN+++SPV D+ P+ F P A A+ Sbjct: 115 AIELKSEGINLSWSPVADIYSHPQNPEIGS-RAFGNTPETAATGARE 160 >gi|284032130|ref|YP_003382061.1| glycoside hydrolase family 3 domain-containing protein [Kribbella flavida DSM 17836] gi|283811423|gb|ADB33262.1| glycoside hydrolase family 3 domain protein [Kribbella flavida DSM 17836] Length = 802 Score = 47.1 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ +G++ SPVLD++ + P + R Sbjct: 165 IGRDMAAAGVHQGLSPVLDVVRDYR--WGRVEESIGEDPYLVAMVGSAYVRGLQ 216 >gi|254438843|ref|ZP_05052337.1| Glycosyl hydrolase family 3 N terminal domain protein [Octadecabacter antarcticus 307] gi|198254289|gb|EDY78603.1| Glycosyl hydrolase family 3 N terminal domain protein [Octadecabacter antarcticus 307] Length = 333 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L GI+ N +P+ D+ T + + + ++++ S ++ Sbjct: 105 IAAELRDVGIDTNCAPIADI-TARLTHLFLRNRCYGDDAVTVMDASRAVSDAHL 157 >gi|238063167|ref|ZP_04607876.1| glycoside hydrolase family 3 [Micromonospora sp. ATCC 39149] gi|237884978|gb|EEP73806.1| glycoside hydrolase family 3 [Micromonospora sp. ATCC 39149] Length = 483 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 9/39 (23%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIP 39 + L GI V+ +P +D+ E + F P Sbjct: 110 IGTELAALGITVDLAPTVDVNTADENPVIGT-RSFGADP 147 >gi|254409730|ref|ZP_05023511.1| Glycosyl hydrolase family 3 N terminal domain protein [Microcoleus chthonoplastes PCC 7420] gi|196183727|gb|EDX78710.1| Glycosyl hydrolase family 3 N terminal domain protein [Microcoleus chthonoplastes PCC 7420] Length = 442 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 25/61 (40%), Gaps = 10/61 (16%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKR-------SIFSRIPAKAEESAQLFSRTYI 54 K L GIN+NF+PV+DL YG I+ + S + A + +T Sbjct: 218 GKELSEIGINLNFAPVVDLNYG---VISSEDKYSKIYLRAISADKDIVAKVALWYCQTLA 274 Query: 55 K 55 Sbjct: 275 D 275 >gi|116511326|ref|YP_808542.1| Beta-glucosidase-related glycosidase [Lactococcus lactis subsp. cremoris SK11] gi|116106980|gb|ABJ72120.1| Beta-glucosidase-related glycosidase [Lactococcus lactis subsp. cremoris SK11] Length = 403 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Query: 2 AKNLVTSGINVNFSPVLD----LLYGPET-FIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L T+GIN + +PV D + P+ I ++ A A FS+ Sbjct: 178 GSELSTAGINFDLAPVADQVLSADFAPQNAPIGYWSRQYAYDKANIVSHADAFSKGMK 235 >gi|269954995|ref|YP_003324784.1| glycoside hydrolase family 3 domain-containing protein [Xylanimonas cellulosilytica DSM 15894] gi|269303676|gb|ACZ29226.1| glycoside hydrolase family 3 domain protein [Xylanimonas cellulosilytica DSM 15894] Length = 803 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ G+++ +PVLD++ P + S P A + + Sbjct: 150 IGESMKKLGVHLGLAPVLDVIRDPR--WGRTEEAISEDPYVVGTIATKYVQGLQ 201 >gi|327194516|gb|EGE61375.1| putative beta-N-acetylhexosaminidase protein [Rhizobium etli CNPAF512] Length = 340 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M + G++ SPVLDL++ + + F P + ++ Sbjct: 112 MGAMMTELGLSSGCSPVLDLVFETTSAVIGA-RSFGSDPDVIAALGREVVDGLLE 165 >gi|302506559|ref|XP_003015236.1| hypothetical protein ARB_06359 [Arthroderma benhamiae CBS 112371] gi|291178808|gb|EFE34596.1| hypothetical protein ARB_06359 [Arthroderma benhamiae CBS 112371] Length = 353 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 17/49 (34%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 A L IN N +PVLD+ FI + F F+ Sbjct: 130 AAALKAQKINGNLAPVLDIYREEGNFIDEFGRSFGNNTEIVTSCGSAFA 178 >gi|320160742|ref|YP_004173966.1| glycosidase [Anaerolinea thermophila UNI-1] gi|319994595|dbj|BAJ63366.1| glycosidase [Anaerolinea thermophila UNI-1] Length = 942 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 10/58 (17%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKR---SIFSRIPAKAEESAQLFSRTYIK 55 + L G N+ P LD+L + ++ F P E + + + Sbjct: 179 LGSELSALGFNLILGPSLDVL-DVSYTVGKEDLGSRTFGGDPYWVSEMGKAYIAGIHQ 235 >gi|91227658|ref|ZP_01261935.1| beta-hexosaminidase [Vibrio alginolyticus 12G01] gi|269966596|ref|ZP_06180677.1| beta-N-acetylhexosaminidase [Vibrio alginolyticus 40B] gi|91188437|gb|EAS74731.1| beta-hexosaminidase [Vibrio alginolyticus 12G01] gi|269828781|gb|EEZ83034.1| beta-N-acetylhexosaminidase [Vibrio alginolyticus 40B] Length = 327 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + + + Sbjct: 101 MAAELIAHDIDLSFAPVLDQGHQCKAI---GNRAFGEDADTILRYSTAYMQGMK 151 >gi|227489198|ref|ZP_03919514.1| beta-N-acetylglucosaminidase family protein [Corynebacterium glucuronolyticum ATCC 51867] gi|227090820|gb|EEI26132.1| beta-N-acetylglucosaminidase family protein [Corynebacterium glucuronolyticum ATCC 51867] Length = 469 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + L GI V+F+PVLD GP FS +A E A F+R Sbjct: 247 LGQKLTDLGITVDFAPVLDTDAGPADGAIG-DRSFSAEAGRATEYAIAFARGL 298 >gi|326477232|gb|EGE01242.1| glycosyl hydrolase [Trichophyton equinum CBS 127.97] Length = 353 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 17/49 (34%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 A L IN N +PVLD+ FI + F F+ Sbjct: 130 AAALKAQKINGNLAPVLDIYREEGNFIDEFGRSFGNNTEIVTSCGSAFA 178 >gi|326471904|gb|EGD95913.1| glycosyl hydrolase [Trichophyton tonsurans CBS 112818] Length = 344 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 17/49 (34%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 A L IN N +PVLD+ FI + F F+ Sbjct: 121 AAALKAQKINGNLAPVLDIYREEGNFIDEFGRSFGNNTEIVTSCGSAFA 169 >gi|302653513|ref|XP_003018582.1| hypothetical protein TRV_07427 [Trichophyton verrucosum HKI 0517] gi|291182236|gb|EFE37937.1| hypothetical protein TRV_07427 [Trichophyton verrucosum HKI 0517] Length = 353 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 17/49 (34%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 A L IN N +PVLD+ FI + F F+ Sbjct: 130 AAALKAQKINGNLAPVLDIYREEGNFIDEFGRSFGNNTEIVTSCGSAFA 178 >gi|293396560|ref|ZP_06640836.1| beta-hexosaminidase [Serratia odorifera DSM 4582] gi|291420824|gb|EFE94077.1| beta-hexosaminidase [Serratia odorifera DSM 4582] Length = 341 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + F PA+A A+ F + Sbjct: 100 MAAEMIAQDIDISFAPVLDIGHASAAI---GERSFHSEPAQALAMAERFIQGMH 150 >gi|203287475|ref|YP_002222490.1| beta-N-acetylhexosaminidase, putative [Borrelia recurrentis A1] gi|201084695|gb|ACH94269.1| beta-N-acetylhexosaminidase, putative [Borrelia recurrentis A1] Length = 365 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K L GIN+N +PV D + P++ + F + F Sbjct: 183 LGKQLRRLGINMNMAPVADSKFAPDSPLG--NRTFGYSFYDIGLMVEAFVDGMQ 234 >gi|300215154|gb|ADJ79570.1| Beta-N-acetylhexosaminidase [Lactobacillus salivarius CECT 5713] Length = 367 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L GIN +F+PV D+ P +FI + + K Sbjct: 151 AEILRNLGINWDFAPVADVSNDPNSFI--YDRTLGQNYQLTAQYVSKVVPAIQK 202 >gi|91793300|ref|YP_562951.1| beta-hexosaminidase [Shewanella denitrificans OS217] gi|91715302|gb|ABE55228.1| Beta-N-acetylhexosaminidase [Shewanella denitrificans OS217] Length = 337 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA L+ I+++F+PVLD+ G I + FS P + A F + Sbjct: 105 MAIELLECDIDLSFAPVLDVN-GISQVIGK--RSFSPAPEEISILASEFIHGMNQ 156 >gi|332671768|ref|YP_004454776.1| glycoside hydrolase family 3 domain-containing protein [Cellulomonas fimi ATCC 484] gi|332340806|gb|AEE47389.1| glycoside hydrolase family 3 domain protein [Cellulomonas fimi ATCC 484] Length = 778 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 7/55 (12%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + +G++ +PVLD+ + P + R + Sbjct: 150 IGATMRAAGVHQGLAPVLDVTRDYR--WGRTEETIGEDPYLVATVGTAYVRGLEQ 202 >gi|227540764|ref|ZP_03970813.1| beta-N-acetylglucosaminidase family protein [Corynebacterium glucuronolyticum ATCC 51866] gi|227183476|gb|EEI64448.1| beta-N-acetylglucosaminidase family protein [Corynebacterium glucuronolyticum ATCC 51866] Length = 469 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + L GI V+F+PVLD GP FS +A E A F+R Sbjct: 247 LGQKLTDLGITVDFAPVLDTDAGPADGAIG-DRSFSAEAGRATEYAIAFARGL 298 >gi|203283932|ref|YP_002221672.1| beta-N-acetylhexosaminidase, putative [Borrelia duttonii Ly] gi|201083375|gb|ACH92966.1| beta-N-acetylhexosaminidase, putative [Borrelia duttonii Ly] Length = 365 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K L GIN+N +PV D + P++ + F + F Sbjct: 183 LGKQLRRLGINMNMAPVADSKFAPDSPLG--NRTFGYSFYDIGLMVEAFVDGMQ 234 >gi|291300733|ref|YP_003512011.1| glycoside hydrolase family 3 domain-containing protein [Stackebrandtia nassauensis DSM 44728] gi|290569953|gb|ADD42918.1| glycoside hydrolase family 3 domain protein [Stackebrandtia nassauensis DSM 44728] Length = 769 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ G++ SPVLD++ + P + + R Sbjct: 149 IGADMRAVGVHQGLSPVLDVVRDYR--WGRVEETMGEDPYLVAVTGTAYVRGLQ 200 >gi|323358483|ref|YP_004224879.1| beta-glucosidase-related glycosidase [Microbacterium testaceum StLB037] gi|323274854|dbj|BAJ74999.1| beta-glucosidase-related glycosidase [Microbacterium testaceum StLB037] Length = 779 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A G++V P ++L P + S P E + R N Sbjct: 66 ASEARRKGVDVVLGPTINLHRSPLG--GRHFECLSEDPELTAELGAAYVRGLQDN 118 >gi|304405499|ref|ZP_07387158.1| glycoside hydrolase family 3 domain protein [Paenibacillus curdlanolyticus YK9] gi|304345538|gb|EFM11373.1| glycoside hydrolase family 3 domain protein [Paenibacillus curdlanolyticus YK9] Length = 880 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + GI+ +F PVLDL P + F A + Sbjct: 148 IAAETRSLGIHESFGPVLDLARDPR--WGRVEETFGEDTHLASRMGVAMVQGLQ 199 >gi|237734165|ref|ZP_04564646.1| conserved hypothetical protein [Mollicutes bacterium D7] gi|229382725|gb|EEO32816.1| conserved hypothetical protein [Coprobacillus sp. D7] Length = 2230 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 7/51 (13%), Positives = 15/51 (29%), Gaps = 2/51 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 A + G N F+P L + + + F + + + Sbjct: 146 ASEVRAMGANWTFTPTLGVPHNER--WGRTYETFGDDVERVTNLGTAYIKG 194 >gi|167756220|ref|ZP_02428347.1| hypothetical protein CLORAM_01750 [Clostridium ramosum DSM 1402] gi|167704212|gb|EDS18791.1| hypothetical protein CLORAM_01750 [Clostridium ramosum DSM 1402] Length = 2230 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 7/51 (13%), Positives = 15/51 (29%), Gaps = 2/51 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 A + G N F+P L + + + F + + + Sbjct: 146 ASEVRAMGANWTFTPTLGVPHNER--WGRTYETFGDDVERVTNLGTAYIKG 194 >gi|169350247|ref|ZP_02867185.1| hypothetical protein CLOSPI_00991 [Clostridium spiroforme DSM 1552] gi|169293030|gb|EDS75163.1| hypothetical protein CLOSPI_00991 [Clostridium spiroforme DSM 1552] Length = 1020 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L G+N NF+P D+ P + FS P A + + Sbjct: 172 IGSELSAVGVNTNFAPDADVNNNPNNPVIGL-RSFSSSPQLAAKFTTAYIEGVQ 224 >gi|332654811|ref|ZP_08420553.1| glycosyl hydrolase domain protein [Ruminococcaceae bacterium D16] gi|332516154|gb|EGJ45762.1| glycosyl hydrolase domain protein [Ruminococcaceae bacterium D16] Length = 409 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 L+ G+NVN +PV D+ P FI F + E +T Sbjct: 196 TLLGLGVNVNLAPVADVSTDPNDFI--YDRSFGQDAQATAEYVSNVVKTM 243 >gi|119896992|ref|YP_932205.1| putative beta-hexosaminidase [Azoarcus sp. BH72] gi|119669405|emb|CAL93318.1| putative beta-hexosaminidase [Azoarcus sp. BH72] Length = 451 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 19/56 (33%), Gaps = 5/56 (8%) Query: 5 LVTSGINVNFSPVLDLLYGPETFIA-----QKRSIFSRIPAKAEESAQLFSRTYIK 55 L G+ +NF PV+DL + PA+ A+ ++ Sbjct: 215 LAALGVTLNFGPVVDLRPAHGGPLFDTHTRIGERAIDGDPARVARVARAYAEGLAD 270 >gi|322387176|ref|ZP_08060786.1| beta-hexosaminidase [Streptococcus infantis ATCC 700779] gi|321141705|gb|EFX37200.1| beta-hexosaminidase [Streptococcus infantis ATCC 700779] Length = 396 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ L + GIN PV DL FI + + KN Sbjct: 180 AEVLKSVGINAGLFPVADLAGDSSAFI--YDRTIGQDAQTTASYVKQVVEELQKN 232 >gi|164686573|ref|ZP_02210601.1| hypothetical protein CLOBAR_00140 [Clostridium bartlettii DSM 16795] gi|164604442|gb|EDQ97907.1| hypothetical protein CLOBAR_00140 [Clostridium bartlettii DSM 16795] Length = 573 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K G N F+P++D+ + FS + + ++ + R Sbjct: 129 CKEAAAIGCNWTFAPIVDINKNWRNCVVSS-RCFSSEAQQVLDMSKEYLRGAKD 181 >gi|37522874|ref|NP_926251.1| hydrolase [Gloeobacter violaceus PCC 7421] gi|35213876|dbj|BAC91246.1| glr3305 [Gloeobacter violaceus PCC 7421] Length = 568 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ G++V F+PVLD+ P I F + P + Sbjct: 140 AREARALGVHVVFAPVLDVNNNPRNPIINV-RSFGQSPDLVSRLGAAYIAGL 190 >gi|304397235|ref|ZP_07379114.1| glycoside hydrolase family 3 domain protein [Pantoea sp. aB] gi|304355384|gb|EFM19752.1| glycoside hydrolase family 3 domain protein [Pantoea sp. aB] Length = 346 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + I F PA A A+ F + Sbjct: 109 MAAEMIAMDIDISFAPVLDIGH-ISAAIG--DRSFHANPAIALAVARRFIAGMHE 160 >gi|269798829|ref|YP_003312729.1| glycoside hydrolase [Veillonella parvula DSM 2008] gi|269095458|gb|ACZ25449.1| glycoside hydrolase family 3 domain protein [Veillonella parvula DSM 2008] Length = 381 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 19/54 (35%), Gaps = 7/54 (12%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G N+NF+PV DL +S P + A + Y + Sbjct: 166 GAELKDLGFNINFAPVADLGL-------TYGRSYSTSPDEVVRYAGAVGKAYDE 212 >gi|320012278|gb|ADW07128.1| glycoside hydrolase family 3 domain protein [Streptomyces flavogriseus ATCC 33331] Length = 800 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + ++ + G++ +PVLD++ + P + R Sbjct: 162 IGSDMRSVGVHQGLAPVLDVVRDLR--WGRVEETIGEDPYLVATIGTAYVRGL 212 >gi|313894422|ref|ZP_07827987.1| glycosyl hydrolase family 3 N-terminal domain protein [Veillonella sp. oral taxon 158 str. F0412] gi|313441246|gb|EFR59673.1| glycosyl hydrolase family 3 N-terminal domain protein [Veillonella sp. oral taxon 158 str. F0412] Length = 382 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 7/54 (12%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G N+NF+PV DL +S P + A ++Y + Sbjct: 166 GTELKELGFNINFAPVADLGL-------TYGRSYSTNPDEVVRYASAVGKSYDE 212 >gi|332977322|gb|EGK14110.1| beta-hexosaminidase [Psychrobacter sp. 1501(2011)] Length = 351 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ GI+++F+PVLD+ G I F R + F R Sbjct: 101 MAAEVMAVGIDLSFAPVLDIN-GVSKVIG--DRSFHRRTEAIVALSMQFMRGMK 151 >gi|297163191|gb|ADI12903.1| glycoside hydrolase family 3 domain protein [Streptomyces bingchenggensis BCW-1] Length = 723 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ ++GI+ FSP++D+ P + P A R Y Sbjct: 120 AREARSNGIHWTFSPMMDVTREPR--WGRIAESIGEDPCLTTAYAAAKVRGYQ 170 >gi|226321170|ref|ZP_03796711.1| putative beta-N-acetylhexosaminidase [Borrelia burgdorferi 29805] gi|226233462|gb|EEH32202.1| putative beta-N-acetylhexosaminidase [Borrelia burgdorferi 29805] Length = 243 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSR-IPAKAEESAQLFSRTYIKN 56 +AK L GIN+N +PV D+ + P T F + F N Sbjct: 168 LAKQLRRLGINLNMAPVADIKFAPHTP--LLNRTFGGYSAYNIGLMVEAFIDGMQNN 222 >gi|258652251|ref|YP_003201407.1| glycoside hydrolase family 3 domain-containing protein [Nakamurella multipartita DSM 44233] gi|258555476|gb|ACV78418.1| glycoside hydrolase family 3 domain protein [Nakamurella multipartita DSM 44233] Length = 490 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + GINV+F+P D+L F P ++ R Y Sbjct: 241 GAEMRAVGINVDFAPDADVL-PQSGDSGVDGRTFGADPDRSATLVAAAVRGYQ 292 >gi|308067121|ref|YP_003868726.1| Periplasmic beta-glucosidase precursor [Paenibacillus polymyxa E681] gi|305856400|gb|ADM68188.1| Periplasmic beta-glucosidase precursor [Paenibacillus polymyxa E681] Length = 720 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++V F+P++DL+ P + P E A+ F R + Sbjct: 121 AREAAVSGVHVTFAPMVDLVRDPR--WGRVMESTGEDPYLNSEFARAFVRGFQ 171 >gi|253576566|ref|ZP_04853894.1| glycoside hydrolase [Paenibacillus sp. oral taxon 786 str. D14] gi|251843980|gb|EES72000.1| glycoside hydrolase [Paenibacillus sp. oral taxon 786 str. D14] Length = 721 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++V F+P++DL+ P + P E A+ F R + Sbjct: 122 AREAAVSGVHVTFAPMVDLVRDPR--WGRVMESTGEDPYLNSEFARAFVRGFQ 172 >gi|254230248|ref|ZP_04923639.1| beta-hexosaminidase [Vibrio sp. Ex25] gi|262395176|ref|YP_003287030.1| beta N-acetyl-glucosaminidase [Vibrio sp. Ex25] gi|151937228|gb|EDN56095.1| beta-hexosaminidase [Vibrio sp. Ex25] gi|262338770|gb|ACY52565.1| beta N-acetyl-glucosaminidase [Vibrio sp. Ex25] Length = 327 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + + + Sbjct: 101 MAAELIAHDIDLSFAPVLDKGHQCKAI---GNRAFGEDADTILRFSTAYMQGMK 151 >gi|315504358|ref|YP_004083245.1| glycoside hydrolase family 3 domain protein [Micromonospora sp. L5] gi|315410977|gb|ADU09094.1| glycoside hydrolase family 3 domain protein [Micromonospora sp. L5] Length = 574 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L G+N++F+PV D+L I F PA A R Sbjct: 207 GAELAAMGVNLDFAPVADVLATRSAVIGS--RSFGADPATASPQVAGAVRGLQ 257 >gi|149371691|ref|ZP_01891107.1| beta-N-acetylglucosaminidase [unidentified eubacterium SCB49] gi|149355318|gb|EDM43878.1| beta-N-acetylglucosaminidase [unidentified eubacterium SCB49] Length = 364 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L+ G NF+PV+D+ E K F + ++ F +T + Sbjct: 151 INKTLLDIGFRQNFAPVVDVSPNNEAI---KNRSFGNDKNQVVALSKQFIKTTQE 202 >gi|325965016|ref|YP_004242922.1| beta-glucosidase-like glycosyl hydrolase [Arthrobacter phenanthrenivorans Sphe3] gi|323471103|gb|ADX74788.1| beta-glucosidase-like glycosyl hydrolase [Arthrobacter phenanthrenivorans Sphe3] Length = 787 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + ++ + G++ +PVLD++ + P A + + Sbjct: 151 IGTDMRSVGVHQGLAPVLDVVRDAR--WGRVEETIGEDPYLIGTLATAYIQGL 201 >gi|218132023|ref|ZP_03460827.1| hypothetical protein BACEGG_03648 [Bacteroides eggerthii DSM 20697] gi|217985783|gb|EEC52123.1| hypothetical protein BACEGG_03648 [Bacteroides eggerthii DSM 20697] Length = 762 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ +G++ SPVLDL + + P + + K Sbjct: 157 IAQEAKATGVDQVLSPVLDLARELR--WGRVEETYGEDPYLVGRMGVAYVSAFNK 209 >gi|115397099|ref|XP_001214141.1| conserved hypothetical protein [Aspergillus terreus NIH2624] gi|114192332|gb|EAU34032.1| conserved hypothetical protein [Aspergillus terreus NIH2624] Length = 356 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 13/51 (25%), Positives = 22/51 (43%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 K L + +N N +PV+D+ P+ FI + +S + A F Sbjct: 134 GKVLRQNNLNTNLAPVVDVFQAPDNFIDEYGRSYSNSSTVVADCAGKFLEG 184 >gi|216264312|ref|ZP_03436304.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi 156a] gi|215980785|gb|EEC21592.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi 156a] gi|312148379|gb|ADQ31038.1| Glycosyl hydrolase family 3 N terminal domain [Borrelia burgdorferi JD1] Length = 342 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSR-IPAKAEESAQLFSRTYIKN 56 +AK L GIN+N +PV D+ + P+T F + F N Sbjct: 168 LAKQLRRLGINLNMAPVADIKFAPQTP--LLNRTFGGYSAYNIGLMVEAFIDGMQNN 222 >gi|282849552|ref|ZP_06258936.1| glycosyl hydrolase family 3 N-terminal domain protein [Veillonella parvula ATCC 17745] gi|282580489|gb|EFB85888.1| glycosyl hydrolase family 3 N-terminal domain protein [Veillonella parvula ATCC 17745] Length = 382 Score = 46.3 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 19/54 (35%), Gaps = 7/54 (12%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G N+NF+PV DL +S P + A + Y + Sbjct: 166 GAELKDLGFNINFAPVADLGL-------TYGRSYSTSPDEVVRYAGAVGKAYDE 212 >gi|50553532|ref|XP_504177.1| YALI0E20185p [Yarrowia lipolytica] gi|49650046|emb|CAG79772.1| YALI0E20185p [Yarrowia lipolytica] Length = 857 Score = 46.3 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 10/50 (20%), Positives = 14/50 (28%), Gaps = 2/50 (4%) Query: 8 SGINVNFSPVLDL--LYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 GIN F+P +D+ F + F R K Sbjct: 123 CGINFMFAPCMDVLKSTSASADFLLGTRAFGDDHEIVSQFGCAFLRGLQK 172 >gi|291449538|ref|ZP_06588928.1| beta-D-xylosidase [Streptomyces roseosporus NRRL 15998] gi|291352485|gb|EFE79389.1| beta-D-xylosidase [Streptomyces roseosporus NRRL 15998] Length = 827 Score = 46.3 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +++ + G++ +PVLD++ + P A + R Sbjct: 174 IGRDMRSVGVHQGLAPVLDVVRDAR--WGRVEETIGEDPYLVGTVATAYVRGL 224 >gi|239946087|ref|ZP_04698024.1| beta-xylosidase [Streptomyces roseosporus NRRL 15998] gi|239992560|ref|ZP_04713224.1| beta-xylosidase [Streptomyces roseosporus NRRL 11379] Length = 777 Score = 46.3 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +++ + G++ +PVLD++ + P A + R Sbjct: 124 IGRDMRSVGVHQGLAPVLDVVRDAR--WGRVEETIGEDPYLVGTVATAYVRGL 174 >gi|83593112|ref|YP_426864.1| beta-N-acetylhexosaminidase [Rhodospirillum rubrum ATCC 11170] gi|83576026|gb|ABC22577.1| Beta-N-acetylhexosaminidase [Rhodospirillum rubrum ATCC 11170] Length = 339 Score = 46.3 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 11/39 (28%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIP 39 +A L GI+ + PVLD+ I +S P Sbjct: 113 IAHELRGLGIDTDCLPVLDVRQSAADDIVG-DRAYSDDP 150 >gi|262369908|ref|ZP_06063235.1| beta-N-acetyl-D-glucosaminidase [Acinetobacter johnsonii SH046] gi|262314947|gb|EEY95987.1| beta-N-acetyl-D-glucosaminidase [Acinetobacter johnsonii SH046] Length = 338 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ GI+ +F+PVLDL I F++ A F + Sbjct: 106 MATEVLAVGIDFSFAPVLDLN-DISDVIG--DRGFAKNIQDIVPLASAFLKGMK 156 >gi|225551894|ref|ZP_03772835.1| glycosyl hydrolase family 3 N domain protein [Borrelia sp. SV1] gi|225371504|gb|EEH00933.1| glycosyl hydrolase family 3 N domain protein [Borrelia sp. SV1] Length = 300 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSR-IPAKAEESAQLFSRTYIKN 56 +AK L GIN+N +PV D+ + P T F + F + Sbjct: 126 LAKQLRRLGINLNMAPVADIKFAPHTP--LLNRTFGGYSAYIVGLMVEAFIDGMQNH 180 >gi|328907774|gb|EGG27538.1| putative beta-hexosaminidase [Propionibacterium sp. P08] Length = 412 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV D++ I + F P K + + + K Sbjct: 188 ARQLAKLGVHMVFSPVADVIDPGLGVRNKPITKHHRGFGTDPRKCGQYSAAVIAGHRK 245 >gi|254294811|ref|YP_003060834.1| glycoside hydrolase [Hirschia baltica ATCC 49814] gi|254043342|gb|ACT60137.1| glycoside hydrolase family 3 domain protein [Hirschia baltica ATCC 49814] Length = 792 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G++ SPV+D+ P + F P E + + Sbjct: 186 GREIRARGVHHVLSPVVDVALDPR--WGRIEETFGEDPFLVSEMGVAAIKGFQ 236 >gi|31282894|gb|AAO42605.1| beta-xylosidase [Streptomyces sp. CH7] Length = 791 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +++ G++ +PVLD++ + P + + Sbjct: 156 IGRDMRAVGVHQGLAPVLDVVRDVR--WGRVEETIGEDPYLVGTIGTAYVQGL 206 >gi|254469845|ref|ZP_05083250.1| beta-N-acetyl-D-glucosaminidase [Pseudovibrio sp. JE062] gi|211961680|gb|EEA96875.1| beta-N-acetyl-D-glucosaminidase [Pseudovibrio sp. JE062] Length = 305 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 7/52 (13%), Positives = 15/52 (28%), Gaps = 1/52 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 + +L G+ N P LD+ + I + + + Sbjct: 73 IGLDLRDLGLTGNCIPCLDMPIEGASNIIGL-RAYGSDVRLVSDMGRAAMDG 123 >gi|121708730|ref|XP_001272229.1| glycosyl hydrolase, putative [Aspergillus clavatus NRRL 1] gi|119400377|gb|EAW10803.1| glycosyl hydrolase, putative [Aspergillus clavatus NRRL 1] Length = 357 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 19/54 (35%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L N N +PVLD+ F + + + A E A F K Sbjct: 136 AAVLAKYHNNANLAPVLDVYREKGDFEDRYQRSYGNTSALVSECATAFITAQQK 189 >gi|189462809|ref|ZP_03011594.1| hypothetical protein BACCOP_03507 [Bacteroides coprocola DSM 17136] gi|189430425|gb|EDU99409.1| hypothetical protein BACCOP_03507 [Bacteroides coprocola DSM 17136] Length = 754 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI F+P++D+ P + P + + Sbjct: 142 AIEASADGIRWTFAPMIDVSRDPR--WGRIAESCGEDPYLTAVLGKAMIEGFQ 192 >gi|85710681|ref|ZP_01041745.1| 1,4-beta-D-glucan glucohydrolase D [Erythrobacter sp. NAP1] gi|85687859|gb|EAQ27864.1| 1,4-beta-D-glucan glucohydrolase D [Erythrobacter sp. NAP1] Length = 750 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI+ NFSP + + + +S P + Sbjct: 124 ATEIEVTGIDWNFSPTVAVARDDR--WGRTYESYSEDPELVAQMGAALVEGLQ 174 >gi|167645796|ref|YP_001683459.1| glycoside hydrolase family 3 protein [Caulobacter sp. K31] gi|167348226|gb|ABZ70961.1| glycoside hydrolase family 3 domain protein [Caulobacter sp. K31] Length = 808 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + G N+ +PV+D+ P + + P E R + Sbjct: 198 AREMRARGSNIALAPVVDVARDPR--WGRIEETYGEDPHLCAEIGLAAIRGFQ 248 >gi|310639827|ref|YP_003944585.1| glycoside hydrolase family 3 domain protein [Paenibacillus polymyxa SC2] gi|309244777|gb|ADO54344.1| Glycoside hydrolase family 3 domain protein [Paenibacillus polymyxa SC2] Length = 724 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++V F+P++DL+ P + P + A+ F R + Sbjct: 121 AREAAVSGVHVTFAPMVDLVRDPR--WGRVMESTGEDPYLNSQFARAFVRGFQ 171 >gi|294012799|ref|YP_003546259.1| beta-N-acetylhexosaminidase [Sphingobium japonicum UT26S] gi|292676129|dbj|BAI97647.1| beta-N-acetylhexosaminidase [Sphingobium japonicum UT26S] Length = 337 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 15/52 (28%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L GI V+ P+LD+ + I P + + Sbjct: 111 TLAEVGITVDALPLLDVRQEGASDIMG-DRTLGAEPMRVAALGRAVIEGLAD 161 >gi|256833283|ref|YP_003162010.1| glycoside hydrolase family 3 domain-containing protein [Jonesia denitrificans DSM 20603] gi|256686814|gb|ACV09707.1| glycoside hydrolase family 3 domain protein [Jonesia denitrificans DSM 20603] Length = 760 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ T GI+ +PVLD++ P + S P + + Sbjct: 141 IGESMRTLGIHQGLAPVLDVIRDPR--WGRVEECISEDPYAVSVIGTSYVKGVQ 192 >gi|149186242|ref|ZP_01864556.1| glycosyl hydrolase [Erythrobacter sp. SD-21] gi|148830273|gb|EDL48710.1| glycosyl hydrolase [Erythrobacter sp. SD-21] Length = 349 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A+ L +G++V++ D+ + P + + Sbjct: 118 LARELALAGVSVDYHAPFDVRRPETDEVIG-DRALGSKPMQVAALGRAVLDGM 169 >gi|149246133|ref|XP_001527536.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL YB-4239] gi|146447490|gb|EDK41878.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL YB-4239] Length = 930 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L G ++ PVLD++ + F + ++ Sbjct: 113 IAIELKKIGFSIILGPVLDVVTKLSHQLVGV-RSFGTTLDDVKTYGLACAKGLRD 166 >gi|218509690|ref|ZP_03507568.1| putative beta-N-acetylhexosaminidase protein [Rhizobium etli Brasil 5] Length = 334 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M + G++ SPVLDL++ + + F P + ++ Sbjct: 36 MGAMMTELGLSSGCSPVLDLVFETTSAVIGA-RSFGPDPDVIAALGREVVDGLLE 89 >gi|218459908|ref|ZP_03499999.1| putative beta-N-acetylhexosaminidase protein [Rhizobium etli Kim 5] Length = 275 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M + G++ SPVLDL++ + + F P + ++ Sbjct: 47 MGAMMTELGLSSGCSPVLDLVFETTSAVIGA-RSFGPDPDVIAALGREVVDGLLE 100 >gi|262163897|ref|ZP_06031636.1| beta N-acetyl-glucosaminidase [Vibrio mimicus VM223] gi|262027425|gb|EEY46091.1| beta N-acetyl-glucosaminidase [Vibrio mimicus VM223] Length = 330 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + F R Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFVCKAI---GNRAFGEDVQTVLNHSSAFLRGMK 151 >gi|190895578|ref|YP_001985870.1| beta-N-acetylhexosaminidase protein [Rhizobium etli CIAT 652] gi|190699523|gb|ACE93607.1| putative beta-N-acetylhexosaminidase protein [Rhizobium etli CIAT 652] Length = 340 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M + G++ SPVLDL++ + + F P + ++ Sbjct: 112 MGAMMTELGLSSGCSPVLDLVFETTSAVIGA-RSFGPDPDVIAALGREVVDGLLE 165 >gi|25289428|pir||JC7728 xylan 1,4-beta-xylosidase (EC 3.2.1.37) - Streptomyces thermoviolaceus gi|38524470|dbj|BAD02389.1| beta-xylosidase [Streptomyces thermoviolaceus] Length = 770 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +++ + G++ +PV+D++ + P + R Sbjct: 146 IGRDMRSVGVHQGLAPVMDVVRDLR--WGRVEETIGEDPYLVGTIGSAYVRGL 196 >gi|332982620|ref|YP_004464061.1| glycoside hydrolase family 3 domain-containing protein [Mahella australiensis 50-1 BON] gi|332700298|gb|AEE97239.1| glycoside hydrolase family 3 domain protein [Mahella australiensis 50-1 BON] Length = 753 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + +G + SPVLD+ P + F P A + R Sbjct: 134 IRQQMKAAGAHQGLSPVLDVARDPR--WGRVEETFGEDPYLVASMAVSYVRGLQ 185 >gi|295135338|ref|YP_003586014.1| glycoside hydrolase family protein [Zunongwangia profunda SM-A87] gi|294983353|gb|ADF53818.1| glycoside hydrolase family protein [Zunongwangia profunda SM-A87] Length = 764 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ GIN NFSP++D+ P + P + A+ Y Sbjct: 146 AQEATADGINWNFSPMVDIARDPR--WGRIAEGAGEDPYLGSQIAKAMVEGYQ 196 >gi|153809301|ref|ZP_01961969.1| hypothetical protein BACCAC_03614 [Bacteroides caccae ATCC 43185] gi|149128071|gb|EDM19292.1| hypothetical protein BACCAC_03614 [Bacteroides caccae ATCC 43185] Length = 768 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI--KNP 57 + + +SGI+ F+P +D++ + + P E + R Y +NP Sbjct: 143 GEEIRSSGIHWAFAPCIDIVQDAR--WGRTGETYGEDPFLTSELVKEAIRGYQGNENP 198 >gi|332995450|gb|AEF05505.1| family 3 glycoside hydrolase [Alteromonas sp. SN2] Length = 857 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK + +GI+ F+P + + + +S PA A+ Sbjct: 183 AKEVRATGIDWIFAPTVAVARDDR--WGRTYESYSEDPAIVGAYAKAIVSGMQ 233 >gi|15594348|ref|NP_212136.1| beta-N-acetylhexosaminidase, putative [Borrelia burgdorferi B31] gi|218249731|ref|YP_002374536.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi ZS7] gi|221217484|ref|ZP_03588955.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi 72a] gi|223889077|ref|ZP_03623666.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi 64b] gi|225549733|ref|ZP_03770698.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi 118a] gi|226322083|ref|ZP_03797608.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi Bol26] gi|2687889|gb|AAC66400.1| beta-N-acetylhexosaminidase, putative [Borrelia burgdorferi B31] gi|2697109|gb|AAB93995.1| unknown [Borrelia burgdorferi] gi|218164919|gb|ACK74980.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi ZS7] gi|221192762|gb|EEE18978.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi 72a] gi|223885326|gb|EEF56427.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi 64b] gi|225369693|gb|EEG99141.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi 118a] gi|226232673|gb|EEH31427.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi Bol26] Length = 342 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSR-IPAKAEESAQLFSRTYIKN 56 +AK L GIN+N +PV D+ + P T F + F N Sbjct: 168 LAKQLRRLGINLNMAPVADIKFAPHTP--LLNRTFGGYSAYNIGLMVEAFIDGMQNN 222 >gi|320012866|gb|ADW07716.1| glycoside hydrolase family 3 domain protein [Streptomyces flavogriseus ATCC 33331] Length = 789 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +++ + G++ +PVLD++ + P + + Sbjct: 152 IGRDMRSVGVHQGLAPVLDVVRDAR--WGRVEETIGEDPYLVGTIGTAYVQGL 202 >gi|90022142|ref|YP_527969.1| exo-1,4-beta-glucosidase [Saccharophagus degradans 2-40] gi|89951742|gb|ABD81757.1| exo-1,4-beta-glucosidase [Saccharophagus degradans 2-40] Length = 1072 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK + +GI F P L + + +S PA + A Sbjct: 186 AKEVRATGIEWIFGPTLAVAQN--DLWGRTYESYSEDPAIVADYASAMVVGMQ 236 >gi|313836674|gb|EFS74388.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL037PA2] gi|314929920|gb|EFS93751.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL044PA1] gi|314972348|gb|EFT16445.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL037PA3] Length = 318 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV D++ I + F P K + + + K Sbjct: 94 ARQLAKLGVHMVFSPVADVIDPGLGVRNKPITKHHRGFGTDPRKCGQYSAAVIAGHRK 151 >gi|294792487|ref|ZP_06757634.1| glycosyl hydrolase domain protein [Veillonella sp. 6_1_27] gi|294456386|gb|EFG24749.1| glycosyl hydrolase domain protein [Veillonella sp. 6_1_27] Length = 382 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 19/54 (35%), Gaps = 7/54 (12%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G N+NF+PV DL +S P K A + Y + Sbjct: 166 GAELKDLGFNINFAPVADLGL-------TYGRSYSTSPDKVVRYAGAVGKAYDE 212 >gi|260913772|ref|ZP_05920248.1| beta-hexosaminidase [Pasteurella dagmatis ATCC 43325] gi|260632311|gb|EEX50486.1| beta-hexosaminidase [Pasteurella dagmatis ATCC 43325] Length = 354 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F K A F + Sbjct: 107 MAVEMTALDIDLSFAPVLDLGHQCKAI---GDRSFHTQIDKTITLASSFIDGMHE 158 >gi|295690896|ref|YP_003594589.1| glycoside hydrolase family 3 domain-containing protein [Caulobacter segnis ATCC 21756] gi|295432799|gb|ADG11971.1| glycoside hydrolase family 3 domain protein [Caulobacter segnis ATCC 21756] Length = 806 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + G N+ +PV+D+ P + + P E R + Sbjct: 197 AREMRARGSNLALAPVVDVARDPR--WGRIEETYGEDPHVCAEIGLAAIRGFQ 247 >gi|148271478|ref|YP_001221039.1| putative beta-glycosidase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] gi|147829408|emb|CAN00321.1| putative beta-glycosidase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] Length = 793 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ G++ +PVLD++ + + P + R Sbjct: 149 IGGSMRELGVHQGLAPVLDVIRDAR--WGRVDECIAEDPYVVGTIGTAYVRGLQ 200 >gi|68474600|ref|XP_718673.1| potential glycosyl hydrolase [Candida albicans SC5314] gi|46440452|gb|EAK99758.1| potential glycosyl hydrolase [Candida albicans SC5314] Length = 963 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 7/55 (12%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A + G ++ PVLD++ + F + ++ ++ Sbjct: 114 IAIEIKKIGFSIILGPVLDVVTKLSHQLVGV-RSFGTTIEDVVKYGRMCAQGLQD 167 >gi|333029762|ref|ZP_08457823.1| Beta-N-acetylhexosaminidase [Bacteroides coprosuis DSM 18011] gi|332740359|gb|EGJ70841.1| Beta-N-acetylhexosaminidase [Bacteroides coprosuis DSM 18011] Length = 999 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 M + G++VNF+PV D+ P + F P +S+ Sbjct: 153 MGRECREMGVHVNFAPVGDVNVNPNNPVINT-RSFGENPQNVANKVIAYSKGL 204 >gi|224537403|ref|ZP_03677942.1| hypothetical protein BACCELL_02281 [Bacteroides cellulosilyticus DSM 14838] gi|224520981|gb|EEF90086.1| hypothetical protein BACCELL_02281 [Bacteroides cellulosilyticus DSM 14838] Length = 750 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +GI F+P++D+ + P + F P + + + Sbjct: 138 ATEASAAGIRWTFAPMIDITHDPR--WGRIAEGFGEDPLLVSQMGVAAIKGFQ 188 >gi|255533985|ref|YP_003094357.1| glycoside hydrolase family 3 domain-containing protein [Pedobacter heparinus DSM 2366] gi|255346969|gb|ACU06295.1| glycoside hydrolase family 3 domain protein [Pedobacter heparinus DSM 2366] Length = 738 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +AK GI+ ++P+L +L + + + F Sbjct: 109 IAKEARALGIHHCYTPMLGVLRDAR--WGRFEEGYGEDAYLVSKIGVAFINGLQ 160 >gi|261250347|ref|ZP_05942923.1| beta N-acetyl-glucosaminidase [Vibrio orientalis CIP 102891] gi|260939463|gb|EEX95449.1| beta N-acetyl-glucosaminidase [Vibrio orientalis CIP 102891] Length = 328 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA LV I+++F+PVLD + + F + + + Sbjct: 101 MAAELVAHDIDLSFAPVLDKGHECKAI---GSRAFGDDVDTIIRQSLAYMKGMK 151 >gi|163845974|ref|YP_001634018.1| glycoside hydrolase family 3 protein [Chloroflexus aurantiacus J-10-fl] gi|222523700|ref|YP_002568170.1| glycoside hydrolase family 3 domain-containing protein [Chloroflexus sp. Y-400-fl] gi|163667263|gb|ABY33629.1| glycoside hydrolase family 3 domain protein [Chloroflexus aurantiacus J-10-fl] gi|222447579|gb|ACM51845.1| glycoside hydrolase family 3 domain protein [Chloroflexus sp. Y-400-fl] Length = 753 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ GI+ F+P++D+ P + P + A R + Sbjct: 118 AREARAVGIHWTFAPMVDIARDPR--WGRIVEGAGEDPYLGAQMAAAQVRGFQ 168 >gi|307323691|ref|ZP_07602901.1| glycoside hydrolase family 3 domain protein [Streptomyces violaceusniger Tu 4113] gi|306891180|gb|EFN22156.1| glycoside hydrolase family 3 domain protein [Streptomyces violaceusniger Tu 4113] Length = 786 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 10/50 (20%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Query: 6 VTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +GI + F+PV+D+ P + + P A + + F + + Sbjct: 144 RDAGIQLLFAPVMDINRDPR--WGRVHETYGEDPELAAQLSVAFVQGVHQ 191 >gi|94499508|ref|ZP_01306045.1| Glycoside hydrolase, family 3-like protein [Oceanobacter sp. RED65] gi|94428262|gb|EAT13235.1| Glycoside hydrolase, family 3-like protein [Oceanobacter sp. RED65] Length = 334 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 + L+ GI++ ++PVLD+ Y + F+ + A F Sbjct: 106 LCCELLDIGIDLTYAPVLDIDYQRNQVVG--DRGFAHTKEAIVDLASHFIDG 155 >gi|268316488|ref|YP_003290207.1| beta-lactamase [Rhodothermus marinus DSM 4252] gi|262334022|gb|ACY47819.1| beta-lactamase [Rhodothermus marinus DSM 4252] Length = 966 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G++ ++PV D+ P I F P + + F R Sbjct: 154 AREARALGVHQLYAPVADVNNNPMNPIINV-RAFGEDPLQVATMVRAFVRGVQD 206 >gi|224025518|ref|ZP_03643884.1| hypothetical protein BACCOPRO_02258 [Bacteroides coprophilus DSM 18228] gi|224018754|gb|EEF76752.1| hypothetical protein BACCOPRO_02258 [Bacteroides coprophilus DSM 18228] Length = 773 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A + ++G + F+P +D++ + + P A E + + NP Sbjct: 147 AAEIRSAGTHWTFAPCVDIVCDAR--WGRTGETYGEDPFLASEMVRTAVKGLQDNP 200 >gi|220932815|ref|YP_002509723.1| beta-glucosidase [Halothermothrix orenii H 168] gi|219994125|gb|ACL70728.1| beta-glucosidase [Halothermothrix orenii H 168] Length = 739 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 12/51 (23%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Query: 5 LVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G++ N++PVLD+ P + F P R K Sbjct: 169 LEAIGVSWNYAPVLDVARDPR--WGRTYETFGEDPFLVSVMGAASVRGIQK 217 >gi|256421889|ref|YP_003122542.1| glycoside hydrolase family 3 domain protein [Chitinophaga pinensis DSM 2588] gi|256036797|gb|ACU60341.1| glycoside hydrolase family 3 domain protein [Chitinophaga pinensis DSM 2588] Length = 757 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + GI+ SPVLD+ + F P E F + Y Sbjct: 151 GEEAQVIGIHQILSPVLDIARELR--WGRVEETFGEDPFLIAEMGTAFIKGYQ 201 >gi|296535515|ref|ZP_06897700.1| beta-hexosaminidase [Roseomonas cervicalis ATCC 49957] gi|296264154|gb|EFH10594.1| beta-hexosaminidase [Roseomonas cervicalis ATCC 49957] Length = 334 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G++V +PVLDL + FS PA+ + Sbjct: 103 LGLECASVGLDVVCAPVLDLRLPGAHSVVG-DRGFSAEPAEVARLGAAWVAGLQ 155 >gi|254514842|ref|ZP_05126903.1| periplasmic beta-glucosidase [gamma proteobacterium NOR5-3] gi|219677085|gb|EED33450.1| periplasmic beta-glucosidase [gamma proteobacterium NOR5-3] Length = 740 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ V +GIN F+P++D+ P + P + R + Sbjct: 126 AEEAVRAGINWTFAPMIDITRDPR--WGRIAESLGEDPYLCSKLGAAMVRGFQ 176 >gi|294676413|ref|YP_003577028.1| beta-N-acetylhexosaminidase [Rhodobacter capsulatus SB 1003] gi|294475233|gb|ADE84621.1| beta-N-acetylhexosaminidase [Rhodobacter capsulatus SB 1003] Length = 340 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A L GI+ N +P D+ + A ++A+ + + Sbjct: 112 AAELRAVGIDGNCAPTCDIAGPRTHP-FLRNRCLGETVAAVVKNARATADGLL 163 >gi|329940995|ref|ZP_08290275.1| beta-xylosidase [Streptomyces griseoaurantiacus M045] gi|329300289|gb|EGG44187.1| beta-xylosidase [Streptomyces griseoaurantiacus M045] Length = 797 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +++ + GI+ +PVLD++ + P A + + Sbjct: 165 IGRDMASVGIHQGLAPVLDVVRDAR--WGRVEETIGEDPYLVGTVATAYVQGL 215 >gi|209546162|ref|YP_002278052.1| beta-N-acetylhexosaminidase [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209539019|gb|ACI58952.1| Beta-N-acetylhexosaminidase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 340 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M + G++ SPVLDL++ + + F P ++ Sbjct: 112 MGAMMTELGLSSGCSPVLDLVFETTSAVIGA-RSFGPDPDVIAALGPEVIDGLLE 165 >gi|16127284|ref|NP_421848.1| xylosidase/arabinosidase [Caulobacter crescentus CB15] gi|221236085|ref|YP_002518522.1| beta-glucosidase/beta-xylosidase [Caulobacter crescentus NA1000] gi|13424700|gb|AAK25016.1| xylosidase/arabinosidase [Caulobacter crescentus CB15] gi|220965258|gb|ACL96614.1| beta-glucosidase/beta-xylosidase [Caulobacter crescentus NA1000] Length = 806 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + G N+ +PV+D+ P + + P E R + Sbjct: 197 AREMRARGSNLALAPVVDVARDPR--WGRIEETYGEDPHLCAEIGLASIRGFQ 247 >gi|317029226|ref|XP_001391067.2| glycosyl hydrolase [Aspergillus niger CBS 513.88] Length = 365 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 13/47 (27%), Positives = 20/47 (42%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 G+NVN +PVLD+ +F+ + F + A F K Sbjct: 150 GVNVNLAPVLDVYREESSFMNYWQRSFGNTSSLVTRCAVSFLSAMRK 196 >gi|134075529|emb|CAK39213.1| unnamed protein product [Aspergillus niger] Length = 491 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 13/47 (27%), Positives = 20/47 (42%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 G+NVN +PVLD+ +F+ + F + A F K Sbjct: 150 GVNVNLAPVLDVYREESSFMNYWQRSFGNTSSLVTRCAVSFLSAMRK 196 >gi|294146775|ref|YP_003559441.1| beta-glucosidase [Sphingobium japonicum UT26S] gi|292677192|dbj|BAI98709.1| beta-glucosidase [Sphingobium japonicum UT26S] Length = 791 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + + G+++ SPV+D+ P + + P E Sbjct: 182 IAREIRSRGVSLVLSPVVDIARDPR--WGRIEETYGEDPYLVGEMGVAAVEGLQ 233 >gi|291550716|emb|CBL26978.1| Beta-glucosidase-related glycosidases [Ruminococcus torques L2-14] Length = 787 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 15/56 (26%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + GI SPVLDL + + P + N Sbjct: 128 IKNEMRNVGIRQVLSPVLDLARDFR--WGRTNETYGNDPTLVSAFGCAHVQGMQTN 181 >gi|6006601|emb|CAB56857.1| beta-mannanase [Thermotoga neapolitana] Length = 821 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 10/59 (16%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 + +++ G + +PVLD+ P + F P + + +N K Sbjct: 180 IREDMRKLGAHQGLAPVLDVARDPR--WGRTEETFGESPYLVARMGVSYVKGLQGENIK 236 >gi|222099590|ref|YP_002534158.1| Beta-mannanase [Thermotoga neapolitana DSM 4359] gi|2429092|gb|AAB70867.1| beta-xylosidase [Thermotoga neapolitana] gi|221571980|gb|ACM22792.1| Beta-mannanase [Thermotoga neapolitana DSM 4359] Length = 778 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 10/59 (16%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 + +++ G + +PVLD+ P + F P + + +N K Sbjct: 137 IREDMRKLGAHQGLAPVLDVARDPR--WGRTEETFGESPYLVARMGVSYVKGLQGENIK 193 >gi|260771776|ref|ZP_05880694.1| beta N-acetyl-glucosaminidase [Vibrio metschnikovii CIP 69.14] gi|260613068|gb|EEX38269.1| beta N-acetyl-glucosaminidase [Vibrio metschnikovii CIP 69.14] Length = 329 Score = 45.5 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + F + + R Sbjct: 101 MAAELIAHDIDLSFAPVLDKGFDCRAI---GNRAFGDDVQSVLIYSGAYLRGMK 151 >gi|110640149|ref|YP_680359.1| b-glucosidase [Cytophaga hutchinsonii ATCC 33406] gi|110282830|gb|ABG61016.1| candidate b-glucosidase, Glycoside Hydrolase Family 3 protein [Cytophaga hutchinsonii ATCC 33406] Length = 745 Score = 45.5 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A+ + IN F+P++D+ + P A A+ + + NP Sbjct: 135 AQESYSRCINWTFAPMVDICRDAR--WGRIAESPGEDPYLASVLARAYINGFQGNNP 189 >gi|310829514|ref|YP_003961871.1| beta-N-acetylhexosaminidase [Eubacterium limosum KIST612] gi|308741248|gb|ADO38908.1| beta-N-acetylhexosaminidase [Eubacterium limosum KIST612] Length = 456 Score = 45.5 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Query: 5 LVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 L + +NVNF+PV D+ P +I R A + A+ Sbjct: 244 LKSLVLNVNFAPVCDVSQNPADYI--YSRTTGRDAATTADYAKATVSAM 290 >gi|163757059|ref|ZP_02164164.1| beta-glucosidase [Kordia algicida OT-1] gi|161322959|gb|EDP94303.1| beta-glucosidase [Kordia algicida OT-1] Length = 785 Score = 45.5 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A +GIN FSP++D+ P + P + A+ R Y +N Sbjct: 158 AMEASANGINWTFSPMVDISRDPR--WGRVSEGNGEDPYLGSQIARAMVRGYQQN 210 >gi|146301263|ref|YP_001195854.1| glycoside hydrolase family 3 protein [Flavobacterium johnsoniae UW101] gi|146155681|gb|ABQ06535.1| Candidate beta-glucosidase; Glycoside hydrolase family 3 [Flavobacterium johnsoniae UW101] Length = 766 Score = 45.5 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK GIN FSP++D+ P + P + A+ Y ++ Sbjct: 145 AKEASADGINWTFSPMVDISRDPR--WGRVSEGSGEDPYLGSQIAKAMVNGYQQH 197 >gi|295681103|ref|YP_003609677.1| glycoside hydrolase [Burkholderia sp. CCGE1002] gi|295440998|gb|ADG20166.1| glycoside hydrolase family 3 domain protein [Burkholderia sp. CCGE1002] Length = 801 Score = 45.5 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G + +PVLD+ P + P A + + Sbjct: 153 IGEQARSIGCHQGLAPVLDVSRDPR--WGRTEETLGEDPYLVGVLACHYVKGLQ 204 >gi|209519516|ref|ZP_03268310.1| glycoside hydrolase family 3 domain protein [Burkholderia sp. H160] gi|209500056|gb|EEA00118.1| glycoside hydrolase family 3 domain protein [Burkholderia sp. H160] Length = 801 Score = 45.5 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G + +PVLD+ P + P A + + Sbjct: 153 IGEQARSIGCHQGLAPVLDVSRDPR--WGRTEETLGEDPYLVGVLACHYVKGLQ 204 >gi|303241469|ref|ZP_07327971.1| glycoside hydrolase family 3 domain protein [Acetivibrio cellulolyticus CD2] gi|302590978|gb|EFL60724.1| glycoside hydrolase family 3 domain protein [Acetivibrio cellulolyticus CD2] Length = 724 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 11/51 (21%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 AK + G+++N++P LD+ P + P A + F Sbjct: 148 AKQISAVGVDLNYAPCLDVARDPR--WGRTYETLGEDPYLASVIGKSFVEG 196 >gi|261367456|ref|ZP_05980339.1| glycosyl hydrolase domain protein [Subdoligranulum variabile DSM 15176] gi|282570228|gb|EFB75763.1| glycosyl hydrolase domain protein [Subdoligranulum variabile DSM 15176] Length = 415 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRI 38 + L G N++F+PV D+ PE + K FSR Sbjct: 184 IGGYLKRYGFNMDFAPVADVWTNPENAVIGK-RAFSRD 220 >gi|149910534|ref|ZP_01899173.1| beta-hexosaminidase [Moritella sp. PE36] gi|149806377|gb|EDM66350.1| beta-hexosaminidase [Moritella sp. PE36] Length = 337 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L+ I+++F+PVLDL G I F P+ + + K Sbjct: 106 LAAELLAFDIDLSFAPVLDLERG-SQVIG--DRSFHADPSWVTDLSTQLCIGMHK 157 >gi|187917885|ref|YP_001883448.1| hypothetical protein BH0002 [Borrelia hermsii DAH] gi|119860733|gb|AAX16528.1| hypothetical protein BH0002 [Borrelia hermsii DAH] Length = 356 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K L GIN+N +PV D + P++ + F + F Sbjct: 174 LGKQLRRLGINLNMAPVADTKFAPDSPLGS--RTFGYSSYNIGLMVEAFVDGIQ 225 >gi|118595117|ref|ZP_01552464.1| beta-hexosaminidase [Methylophilales bacterium HTCC2181] gi|118440895|gb|EAV47522.1| beta-hexosaminidase [Methylophilales bacterium HTCC2181] Length = 337 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +AK L I+ +F+PVLD+ Y + I F + A + Sbjct: 105 IAKELGGCDIDFSFTPVLDVNYESSSVIG--NRAFHKEIQPTIHLANSLTEGL 155 >gi|149185768|ref|ZP_01864083.1| glucan 1,4-beta-glucosidase precursor [Erythrobacter sp. SD-21] gi|148830329|gb|EDL48765.1| glucan 1,4-beta-glucosidase precursor [Erythrobacter sp. SD-21] Length = 791 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI+ NFSP + + + +S PA Sbjct: 162 AAEIEVTGIDWNFSPTVAVARDDR--WGRTYESYSEDPAIVAPLGAALVEGLQ 212 >gi|163840109|ref|YP_001624514.1| glycoside hydrolase family 3 protein [Renibacterium salmoninarum ATCC 33209] gi|162953585|gb|ABY23100.1| glycosyl hydrolase family 3 N terminal domain protein [Renibacterium salmoninarum ATCC 33209] Length = 378 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 24/54 (44%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L T+ +N + +PVL + + F+ FS+ PA + F RT Sbjct: 156 AIVLATAKMNSDLAPVLGVYRKYDDFLDHYDRSFSQDPAIVSNCGESFIRTLNN 209 >gi|297203118|ref|ZP_06920515.1| sugar hydrolase [Streptomyces sviceus ATCC 29083] gi|197717645|gb|EDY61679.1| sugar hydrolase [Streptomyces sviceus ATCC 29083] Length = 500 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 +A +L T G+ +++PV D+ I + F A + Sbjct: 121 LAGHLATLGVTASYAPVADVQRQAGNPIVRT-RAFGEDTALVSRHLGAWITA 171 >gi|13471186|ref|NP_102755.1| sugar hydrolase [Mesorhizobium loti MAFF303099] gi|14021930|dbj|BAB48541.1| probable sugar hydrolase [Mesorhizobium loti MAFF303099] Length = 339 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A +L+ GI + PVLD+ + + + + P E + Sbjct: 112 AFDLLRYGITADCLPVLDVPIEGASDVIGA-RAYGKEPRAVIELGSAAAEGL 162 >gi|50727110|gb|AAT81216.1| 1,4-beta-D-glucan glucohydrolase [Microbulbifer hydrolyticus] Length = 882 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ F+P + ++ + +S P A+ + Sbjct: 203 AREVAVTGVDWTFAPTIAVVRDDR--WGRTFESYSEDPEIVAAYAREMIKGIQ 253 >gi|269962540|ref|ZP_06176888.1| beta-N-acetylhexosaminidase [Vibrio harveyi 1DA3] gi|269832735|gb|EEZ86846.1| beta-N-acetylhexosaminidase [Vibrio harveyi 1DA3] Length = 327 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + + + Sbjct: 101 MAAELIAHDIDLSFAPVLDKGHQCKAI---GSRAFGEDLDTILRHSSAYMQGMK 151 >gi|269796588|ref|YP_003316043.1| beta-glucosidase-like glycosyl hydrolase [Sanguibacter keddieii DSM 10542] gi|269098773|gb|ACZ23209.1| beta-glucosidase-like glycosyl hydrolase [Sanguibacter keddieii DSM 10542] Length = 791 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 7/55 (12%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + ++ +G++ +PVLD+ + P + R Sbjct: 160 IGTSMRAAGVHQGLAPVLDVTRDYR--WGRTEETIGEDPYLVGTVGAAYVRGLED 212 >gi|301116994|ref|XP_002906225.1| lysosomal beta glucosidase, putative [Phytophthora infestans T30-4] gi|262107574|gb|EEY65626.1| lysosomal beta glucosidase, putative [Phytophthora infestans T30-4] Length = 732 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 ++ +G++ P+LD+ Y P + F P A + + N + Sbjct: 130 GRDTAAAGVSWILGPILDISYNPL--WTRSYETFGEDPYLASVLGAAYIQGVQDNSQ 184 >gi|27382728|ref|NP_774257.1| hypothetical protein bll7617 [Bradyrhizobium japonicum USDA 110] gi|27355900|dbj|BAC52882.1| bll7617 [Bradyrhizobium japonicum USDA 110] Length = 447 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 12/60 (20%), Positives = 21/60 (35%), Gaps = 7/60 (11%) Query: 2 AKNLVTSGINVNFSPVLDL------LYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G+N+N +PVLDL + + + P A + R + Sbjct: 210 GRELAGVGVNLNLAPVLDLKPPQRRNRLDFHTLIG-QRAIATDPVVVSTIANAYVRGLEE 268 >gi|329929023|ref|ZP_08282825.1| glycosyl hydrolase family 3 N-terminal domain protein [Paenibacillus sp. HGF5] gi|328937012|gb|EGG33441.1| glycosyl hydrolase family 3 N-terminal domain protein [Paenibacillus sp. HGF5] Length = 721 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++V F+P++DL+ P + P E A+ F R + Sbjct: 122 AREAAVSGLHVTFAPMVDLVRDPR--WGRVMESTGEDPYLNSEFARAFVRGFQ 172 >gi|315649910|ref|ZP_07902992.1| glycoside hydrolase family 3 domain protein [Paenibacillus vortex V453] gi|315274709|gb|EFU38091.1| glycoside hydrolase family 3 domain protein [Paenibacillus vortex V453] Length = 721 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++V F+P++DL+ P + P E A+ F R + Sbjct: 122 AREAAVSGLHVTFAPMVDLVRDPR--WGRVMESTGEDPYLNSEFARAFVRGFQ 172 >gi|261409718|ref|YP_003245959.1| glycoside hydrolase family 3 domain-containing protein [Paenibacillus sp. Y412MC10] gi|261286181|gb|ACX68152.1| glycoside hydrolase family 3 domain protein [Paenibacillus sp. Y412MC10] Length = 721 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++V F+P++DL+ P + P E A+ F R + Sbjct: 122 AREAAVSGLHVTFAPMVDLVRDPR--WGRVMESTGEDPYLNSEFARAFVRGFQ 172 >gi|325685711|gb|EGD27790.1| beta-N-acetylhexosaminidase [Lactobacillus delbrueckii subsp. lactis DSM 20072] Length = 315 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L GIN+NF+PV DL P +FI + + F + Y + Sbjct: 109 ALELKDLGINLNFAPVADLSLDPASFI--YSRTLQAGAEETGPAIAAFIKLYRQ 160 >gi|300812653|ref|ZP_07093065.1| glycosyl hydrolase family 3 N-terminal domain protein [Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4] gi|300496383|gb|EFK31493.1| glycosyl hydrolase family 3 N-terminal domain protein [Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4] Length = 315 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L GIN+NF+PV DL P +FI + + F + Y + Sbjct: 109 ALELKDLGINLNFAPVADLSLDPASFI--YSRTLQAGAEETGPAIAAFIKLYRQ 160 >gi|288961884|ref|YP_003452194.1| glycoside hydrolase family protein [Azospirillum sp. B510] gi|288914164|dbj|BAI75650.1| glycoside hydrolase family protein [Azospirillum sp. B510] Length = 138 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 5/59 (8%) Query: 2 AKNLVTSGINVNFSPVLDLLYG-PETFIA----QKRSIFSRIPAKAEESAQLFSRTYIK 55 ++L + G+ VN +PVLDL G P + + S P E A ++R Sbjct: 42 GRDLQSIGVTVNLAPVLDLRRGRPPDPLDFQSLIAQRAISGDPEMVAEVAATYARGLAD 100 >gi|281210793|gb|EFA84959.1| beta glucosidase [Polysphondylium pallidum PN500] Length = 748 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK+ GI F+PVLDL P ++ F P A R N Sbjct: 219 AKDTTAVGIPWIFAPVLDLGINPL--WSRIYETFGEDPHVAATMGSAVIRGLQGN 271 >gi|255722693|ref|XP_002546281.1| hypothetical protein CTRG_01063 [Candida tropicalis MYA-3404] gi|240136770|gb|EER36323.1| hypothetical protein CTRG_01063 [Candida tropicalis MYA-3404] Length = 882 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 7/52 (13%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G ++ PVLD++ + F + + ++ Sbjct: 117 ELKKIGFSIILGPVLDVVTKFSHQLVGV-RSFGTTIEDVTKYGGMCAKGLQD 167 >gi|255263562|ref|ZP_05342904.1| beta-hexosaminidase [Thalassiobium sp. R2A62] gi|255105897|gb|EET48571.1| beta-hexosaminidase [Thalassiobium sp. R2A62] Length = 332 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + L+ GI+ N +P D+ + ++ +++ + Sbjct: 107 IGSELMAVGIDTNCAPTADIAQADTHP-FLRNRLYGSDVETVVKASMATAEGL 158 >gi|160894722|ref|ZP_02075497.1| hypothetical protein CLOL250_02273 [Clostridium sp. L2-50] gi|156863656|gb|EDO57087.1| hypothetical protein CLOL250_02273 [Clostridium sp. L2-50] Length = 381 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK L GIN N +PV D+ Y FI FS A L + Sbjct: 159 AKFLKKLGINTNLAPVADVAYDSSNFI--YNRSFSTNAADTSRYINLVVNNMKQ 210 >gi|315634839|ref|ZP_07890121.1| beta-hexosaminidase [Aggregatibacter segnis ATCC 33393] gi|315476391|gb|EFU67141.1| beta-hexosaminidase [Aggregatibacter segnis ATCC 33393] Length = 348 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F A A F R + Sbjct: 105 MAAEMTALDIDLSFAPVLDLGHQCKAI---GDRSFGCEIKSAVNLASNFIRGMHQ 156 >gi|282863065|ref|ZP_06272125.1| glycoside hydrolase family 3 domain protein [Streptomyces sp. ACTE] gi|282562047|gb|EFB67589.1| glycoside hydrolase family 3 domain protein [Streptomyces sp. ACTE] Length = 800 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +++ + G++ +PVLD++ + P A + + Sbjct: 162 IGEDMRSVGVHQGLAPVLDVVRDLR--WGRVEETIGEDPYLVGTIATAYVKGL 212 >gi|116255640|ref|YP_771473.1| putative glycosyl transferase [Rhizobium leguminosarum bv. viciae 3841] gi|115260288|emb|CAK03392.1| putative glycosyl transferase [Rhizobium leguminosarum bv. viciae 3841] Length = 340 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M + G++ SPVLDL++ + + F P + ++ Sbjct: 112 MGAMMTELGLSSGCSPVLDLVFETTSAVIGA-RSFGPDPDFIAALGREVVDGLLE 165 >gi|170717259|ref|YP_001784375.1| beta-hexosaminidase [Haemophilus somnus 2336] gi|189030782|sp|B0UTC6|NAGZ_HAES2 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|168825388|gb|ACA30759.1| glycoside hydrolase family 3 domain protein [Haemophilus somnus 2336] Length = 348 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F K E A+ F + + Sbjct: 105 MAAEMTALDIDLSFAPVLDLGHQCKAI---GDRSFHYEEKKLIELAEKFIQGMRQ 156 >gi|113461275|ref|YP_719344.1| beta-hexosaminidase [Haemophilus somnus 129PT] gi|123132146|sp|Q0I414|NAGZ_HAES1 RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|112823318|gb|ABI25407.1| beta hexosaminadase [Haemophilus somnus 129PT] Length = 351 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F K E A+ F + + Sbjct: 105 MAAEMTALDIDLSFAPVLDLGHQCKAI---GDRSFHYEEKKLIELAEKFIQGMRQ 156 >gi|116621797|ref|YP_823953.1| glycoside hydrolase family 3 protein [Candidatus Solibacter usitatus Ellin6076] gi|116224959|gb|ABJ83668.1| glycoside hydrolase, family 3 domain protein [Candidatus Solibacter usitatus Ellin6076] Length = 765 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G + +PV+D+ P + + P R + Sbjct: 150 AAEARARGTHQALTPVVDVAREPR--WGRVEETYGEDPFLVSRMGIAAVRGFQ 200 >gi|256419370|ref|YP_003120023.1| glycoside hydrolase family 3 domain protein [Chitinophaga pinensis DSM 2588] gi|256034278|gb|ACU57822.1| glycoside hydrolase family 3 domain protein [Chitinophaga pinensis DSM 2588] Length = 807 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +AK G ++ + PVLDL+ P ++ + P + + + N Sbjct: 185 IAKEARVQGAHIGYGPVLDLVREPR--WSRLEETYGEDPYLISQMGISMVKGFQGN 238 >gi|281412136|ref|YP_003346215.1| glycoside hydrolase family 3 domain protein [Thermotoga naphthophila RKU-10] gi|281373239|gb|ADA66801.1| glycoside hydrolase family 3 domain protein [Thermotoga naphthophila RKU-10] Length = 778 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ G + +PVLD+ P + F P + + Sbjct: 137 IREDMRKIGAHQGLAPVLDVARDPR--WGRTEETFGESPYLVARMGVSYVKGLQ 188 >gi|170288668|ref|YP_001738906.1| glycoside hydrolase family 3 protein [Thermotoga sp. RQ2] gi|170176171|gb|ACB09223.1| glycoside hydrolase family 3 domain protein [Thermotoga sp. RQ2] Length = 778 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ G + +PVLD+ P + F P + + Sbjct: 137 IREDMRKIGAHQGLAPVLDVARDPR--WGRTEETFGESPYLVARMGVSYVKGLQ 188 >gi|163787414|ref|ZP_02181861.1| candidate b-glucosidase, Glycoside Hydrolase Family 3 protein [Flavobacteriales bacterium ALC-1] gi|159877302|gb|EDP71359.1| candidate b-glucosidase, Glycoside Hydrolase Family 3 protein [Flavobacteriales bacterium ALC-1] Length = 763 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A ++GI F+P+LD+ + P A + + + N Sbjct: 155 AFEASSAGIRWTFAPMLDIARDSR--WGRIAESPGEDPYLASILGKAYVEGFQSN 207 >gi|148269983|ref|YP_001244443.1| glycoside hydrolase family 3 protein [Thermotoga petrophila RKU-1] gi|147735527|gb|ABQ46867.1| glycoside hydrolase, family 3 domain protein [Thermotoga petrophila RKU-1] Length = 778 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ G + +PVLD+ P + F P + + Sbjct: 137 IREDMRKIGAHQGLAPVLDVARDPR--WGRTEETFGESPYLVARMGVSYVKGLQ 188 >gi|269926204|ref|YP_003322827.1| glycoside hydrolase family 3 domain protein [Thermobaculum terrenum ATCC BAA-798] gi|269789864|gb|ACZ42005.1| glycoside hydrolase family 3 domain protein [Thermobaculum terrenum ATCC BAA-798] Length = 795 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + ++ G + +PVLD+ P + + P + + Sbjct: 140 IREQMLAVGARLALAPVLDVARDPR--WGRVEETYGEDPVLVGTLGTAYIKGLQ 191 >gi|88859289|ref|ZP_01133929.1| beta-hexosaminidase [Pseudoalteromonas tunicata D2] gi|88818306|gb|EAR28121.1| beta-hexosaminidase [Pseudoalteromonas tunicata D2] Length = 338 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A L G++ +F+PVLDL G I F+ P + ++A+ F Sbjct: 102 LAAELRAHGVDFSFTPVLDLN-GISQVI--TTRAFAISPIEVIDAAKHFIGGLH 152 >gi|149190345|ref|ZP_01868618.1| beta-hexosaminidase [Vibrio shilonii AK1] gi|148835834|gb|EDL52798.1| beta-hexosaminidase [Vibrio shilonii AK1] Length = 327 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + + F Sbjct: 100 MAAELIAHDIDLSFAPVLDQGHQSKAI---GNRAFGDNFQTIVQYSTAFMAGMK 150 >gi|256419885|ref|YP_003120538.1| beta-lactamase [Chitinophaga pinensis DSM 2588] gi|256034793|gb|ACU58337.1| beta-lactamase [Chitinophaga pinensis DSM 2588] Length = 1012 Score = 44.8 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A GI+V+++P +D+ P F + + + Sbjct: 174 LAMQCRRLGIHVDYAPDMDVNNNPNNP-VINDRSFGQDKFQVARMGVQVIKGMQD 227 >gi|160893018|ref|ZP_02073806.1| hypothetical protein CLOL250_00556 [Clostridium sp. L2-50] gi|156865101|gb|EDO58532.1| hypothetical protein CLOL250_00556 [Clostridium sp. L2-50] Length = 434 Score = 44.8 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + NL G N++F+PV D+ P + K +S I ++A E R + Sbjct: 216 IGDNLSYYGFNLDFAPVADVWSNPGNTVIGK-RAYSNIYSEAAELIPYAVRGFH 268 >gi|270261366|ref|ZP_06189639.1| beta-hexosaminidase [Serratia odorifera 4Rx13] gi|270044850|gb|EFA17941.1| beta-hexosaminidase [Serratia odorifera 4Rx13] Length = 343 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I F P +A A+ F Sbjct: 104 MAAEMIAQDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQALAMAERFILGMH 154 >gi|158423356|ref|YP_001524648.1| putative glycosyl hydrolase [Azorhizobium caulinodans ORS 571] gi|158330245|dbj|BAF87730.1| putative glycosyl hydrolase [Azorhizobium caulinodans ORS 571] Length = 342 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 10/42 (23%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKA 42 +A +L GI+V+ PV DL + + P+ Sbjct: 114 IAADLAALGIDVDCLPVADLRLPEGHGVIG-NRAYGSEPSTV 154 >gi|157370166|ref|YP_001478155.1| beta-hexosaminidase [Serratia proteamaculans 568] gi|157321930|gb|ABV41027.1| glycoside hydrolase family 3 domain protein [Serratia proteamaculans 568] Length = 339 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I F P +A A+ F Sbjct: 100 MAAEMIAQDIDISFAPVLDIGH-VSAAIG--ERSFHSDPQQALAMAERFILGMH 150 >gi|311279988|ref|YP_003942219.1| glycoside hydrolase family 3 domain-containing protein [Enterobacter cloacae SCF1] gi|308749183|gb|ADO48935.1| glycoside hydrolase family 3 domain protein [Enterobacter cloacae SCF1] Length = 343 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I + KA A+ Sbjct: 106 MASEMIAMDIDISFAPVLDVGH-ISAAIG--ERSYHADAQKALAMARHVIDGMH 156 >gi|160880464|ref|YP_001559432.1| Beta-N-acetylhexosaminidase [Clostridium phytofermentans ISDg] gi|160429130|gb|ABX42693.1| Beta-N-acetylhexosaminidase [Clostridium phytofermentans ISDg] Length = 409 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L++ GIN+NF+PV D+ + FI F K E L T + Sbjct: 196 ELLLSLGINLNFAPVCDVASSSKDFI--YARAFGTEVEKTSEYVTLVVETMKE 246 >gi|258512589|ref|YP_003186023.1| glycoside hydrolase family 3 domain-containing protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] gi|257479315|gb|ACV59634.1| glycoside hydrolase family 3 domain protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] Length = 782 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G +P+LD+ P + F P + + R Sbjct: 137 IRDQMRAVGARQALAPLLDVARDPR--WGRVEETFGEDPYLVAQMGIAYVRGLQ 188 >gi|284988992|ref|YP_003407546.1| beta-N-acetylhexosaminidase [Geodermatophilus obscurus DSM 43160] gi|284062237|gb|ADB73175.1| Beta-N-acetylhexosaminidase [Geodermatophilus obscurus DSM 43160] Length = 390 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Query: 1 MAKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 M +L ++GIN+N +PV D++ I + +A + Sbjct: 162 MGASLSSAGINLNLAPVADVVPSGTEDGNAAIGAWDRQYGSTAEDVVRAAGTIADGL 218 >gi|229821805|ref|YP_002883331.1| glycoside hydrolase family 3 domain protein [Beutenbergia cavernae DSM 12333] gi|229567718|gb|ACQ81569.1| glycoside hydrolase family 3 domain protein [Beutenbergia cavernae DSM 12333] Length = 813 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + ++ + G++ +PVLD+ + P E + R Sbjct: 162 IGASMRSVGVHQGLAPVLDVTRDFR--WGRTEETIGEDPHLVGEIGAAYVRGL 212 >gi|293378590|ref|ZP_06624752.1| glycosyl hydrolase family 3 N-terminal domain protein [Enterococcus faecium PC4.1] gi|292642789|gb|EFF60937.1| glycosyl hydrolase family 3 N-terminal domain protein [Enterococcus faecium PC4.1] Length = 735 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + +GI+V FSP++DL+ P + P + A + + N Sbjct: 119 IGMEASKAGIDVTFSPMVDLVRDPR--WGRCLESTGEDPFLNSQFAAAVIKGFQGN 172 >gi|297155295|gb|ADI05007.1| glycoside hydrolase family 3 domain protein [Streptomyces bingchenggensis BCW-1] Length = 782 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + GI+ +PVLD++ + S P + + R Sbjct: 148 IGRTMAGLGIHQGLAPVLDVIRDMR--WGRVEECISEDPYHVAVTGAAYVRGLQ 199 >gi|256392996|ref|YP_003114560.1| glycoside hydrolase family 3 domain-containing protein [Catenulispora acidiphila DSM 44928] gi|256359222|gb|ACU72719.1| glycoside hydrolase family 3 domain protein [Catenulispora acidiphila DSM 44928] Length = 790 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +++ G++ +PVLD+ + P + R Sbjct: 158 IGRSMRAVGVHQGLAPVLDVTRDYR--WGRTEETIGEDPHLVGVIGAAYVRGL 208 >gi|333027975|ref|ZP_08456039.1| putative beta-D-xylosidase [Streptomyces sp. Tu6071] gi|332747827|gb|EGJ78268.1| putative beta-D-xylosidase [Streptomyces sp. Tu6071] Length = 799 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +L G++ +PVLD++ + P + R Sbjct: 161 IGASLRAVGVHQGLAPVLDVVRDLR--WGRVEETIGEDPYLVGRVGAAYVRGL 211 >gi|318078475|ref|ZP_07985807.1| beta-xylosidase [Streptomyces sp. SA3_actF] Length = 653 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +L G++ +PVLD++ + P + R Sbjct: 165 IGASLRAVGVHQGLAPVLDVVRDLR--WGRVEETIGEDPYLVGRVGAAYVRGL 215 >gi|318056400|ref|ZP_07975123.1| beta-D-xylosidase [Streptomyces sp. SA3_actG] Length = 803 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +L G++ +PVLD++ + P + R Sbjct: 165 IGASLRAVGVHQGLAPVLDVVRDLR--WGRVEETIGEDPYLVGRVGAAYVRGL 215 >gi|260459785|ref|ZP_05808039.1| Beta-N-acetylhexosaminidase [Mesorhizobium opportunistum WSM2075] gi|259034587|gb|EEW35844.1| Beta-N-acetylhexosaminidase [Mesorhizobium opportunistum WSM2075] Length = 339 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A +L+ GI + PVLD+ + + + + P E + + Sbjct: 112 AFDLLRYGITADCLPVLDVPIEGASDVIGA-RAYGKEPRPVIELGRAAAEGL 162 >gi|302518353|ref|ZP_07270695.1| beta-xylosidase [Streptomyces sp. SPB78] gi|302427248|gb|EFK99063.1| beta-xylosidase [Streptomyces sp. SPB78] Length = 799 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +L G++ +PVLD++ + P + R Sbjct: 161 IGASLRAVGVHQGLAPVLDVVRDLR--WGRVEETIGEDPYLVGRVGAAYVRGL 211 >gi|257870601|ref|ZP_05650254.1| glycosyl hydrolase [Enterococcus gallinarum EG2] gi|257804765|gb|EEV33587.1| glycosyl hydrolase [Enterococcus gallinarum EG2] Length = 716 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++V FSP++DL+ P + P A+ F + Y Sbjct: 120 AREAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPYLNSRLAEAFVKGYQ 170 >gi|156973310|ref|YP_001444217.1| beta-hexosaminidase [Vibrio harveyi ATCC BAA-1116] gi|156524904|gb|ABU69990.1| hypothetical protein VIBHAR_00991 [Vibrio harveyi ATCC BAA-1116] Length = 327 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + + + Sbjct: 101 MAAELIAHDIDLSFAPVLDKGHQCKAI---GSRAFGEDLDTILRHSTAYMQGMK 151 >gi|153834678|ref|ZP_01987345.1| beta-hexosaminidase [Vibrio harveyi HY01] gi|148868930|gb|EDL67988.1| beta-hexosaminidase [Vibrio harveyi HY01] Length = 327 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + + + Sbjct: 101 MAAELIAHDIDLSFAPVLDKGHQCKAI---GSRAFGEDLDTILRHSTAYMQGMK 151 >gi|170728688|ref|YP_001762714.1| glycoside hydrolase family 3 protein [Shewanella woodyi ATCC 51908] gi|169814035|gb|ACA88619.1| glycoside hydrolase family 3 domain protein [Shewanella woodyi ATCC 51908] Length = 743 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + G+N F+P++D+ P + P E + + Sbjct: 126 AMESASVGVNWTFAPMIDISRDPR--WGRVAESLGEDPYLCSELGKAMITGFQ 176 >gi|254514843|ref|ZP_05126904.1| glucan 1,4-beta-glucosidase [gamma proteobacterium NOR5-3] gi|219677086|gb|EED33451.1| glucan 1,4-beta-glucosidase [gamma proteobacterium NOR5-3] Length = 608 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ ++ +G++ F+P L + + +S P A F + Sbjct: 132 AREILATGVDWTFAPTLAVARNI--HWGRSYESYSEDPTLVGSYAAPFVQGMQ 182 >gi|254787629|ref|YP_003075058.1| glycoside hydrolase family 3 domain-containing protein [Teredinibacter turnerae T7901] gi|237683422|gb|ACR10686.1| glycoside hydrolase family 3 domain protein [Teredinibacter turnerae T7901] Length = 1064 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 AK + +GI+ F+P + + + +S PA + + + P Sbjct: 176 AKAVRATGIDWAFAPTIAVARNYG--WGRTYESYSEDPALVAQFSGEIVKGLQGEP 229 >gi|146299874|ref|YP_001194465.1| glycoside hydrolase family 3 protein [Flavobacterium johnsoniae UW101] gi|146154292|gb|ABQ05146.1| Candidate beta-glycosidase; Glycoside hydrolase family 3 [Flavobacterium johnsoniae UW101] Length = 537 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + +L +GI N SP+ D+ P + F K + + + + + Sbjct: 132 IGLDLKAAGIQYNLSPLADINNNPNNPVIG-YRSFGENKEKVADFSIEYLKGMSE 185 >gi|325961594|ref|YP_004239500.1| beta-glucosidase-like glycosyl hydrolase [Arthrobacter phenanthrenivorans Sphe3] gi|323467681|gb|ADX71366.1| beta-glucosidase-like glycosyl hydrolase [Arthrobacter phenanthrenivorans Sphe3] Length = 789 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + ++ + GI+ +PVLD++ + P + R Sbjct: 152 IGSDMRSVGIHQGLAPVLDVVRDAR--WGRVEETIGEDPYLIGTIGTAYVRGL 202 >gi|317503000|ref|ZP_07961085.1| beta-glucosidase [Prevotella salivae DSM 15606] gi|315665888|gb|EFV05470.1| beta-glucosidase [Prevotella salivae DSM 15606] Length = 770 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ + ++ NF+P +++ + F P + ++ Y +N Sbjct: 170 AEEMRAMNMHWNFNPNVEVARDGR--WGRCGETFGEDPYLVMQMGVATNKGYQRN 222 >gi|217967241|ref|YP_002352747.1| glycoside hydrolase family 3 domain protein [Dictyoglomus turgidum DSM 6724] gi|217336340|gb|ACK42133.1| glycoside hydrolase family 3 domain protein [Dictyoglomus turgidum DSM 6724] Length = 762 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ + ++ SPVLD+ P + F P A + + Sbjct: 132 IRQHMRAANVHQGLSPVLDIPRDPR--WGRTEETFGEDPYLVSRMAAEYVKGLQ 183 >gi|222100743|ref|YP_002535311.1| Beta-N-acetylglucosaminidase CbsA [Thermotoga neapolitana DSM 4359] gi|221573133|gb|ACM23945.1| Beta-N-acetylglucosaminidase CbsA [Thermotoga neapolitana DSM 4359] Length = 310 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + T G N+ F+PVLDLL + + F P Y K Sbjct: 101 GRIMNTLGFNMVFAPVLDLLSEKGSAVVDL-RSFGSDPEVVASHGMEACMGYFK 153 >gi|13242176|gb|AAK16587.1|AF343913_2 beta-N-acetylglucosaminidase CbsA [Thermotoga neapolitana] Length = 467 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + T G N+ F+PVLDLL + + F P Y K Sbjct: 100 GRIMNTLGFNMVFAPVLDLLSEKGSAVVDL-RSFGSDPEVVASHGMEACMGYFK 152 >gi|329941638|ref|ZP_08290903.1| beta-xylosidase [Streptomyces griseoaurantiacus M045] gi|329299355|gb|EGG43255.1| beta-xylosidase [Streptomyces griseoaurantiacus M045] Length = 793 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + +++ G++ +PVLD++ + P A + + Sbjct: 156 IGRDMRGVGVHQGLAPVLDVVRDAR--WGRVEETIGEDPYLVGTVATAYVQGL 206 >gi|324497296|gb|ADY39450.1| putative glycoside hydrolase [bacterium enrichment culture clone P43-9H:P46-4G] Length = 791 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K + G +PVLD+ + F P A + + Sbjct: 150 IGKEARSVGCQQGLAPVLDVSRDVR--WGRTEETFGEDPWLVGVMATAYVKGLQ 201 >gi|296102736|ref|YP_003612882.1| putative glycoside hydrolase [Enterobacter cloacae subsp. cloacae ATCC 13047] gi|295057195|gb|ADF61933.1| putative glycoside hydrolase [Enterobacter cloacae subsp. cloacae ATCC 13047] Length = 791 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K + G +PVLD+ + F P A + + Sbjct: 150 IGKEARSVGCQQGLAPVLDVSRDVR--WGRTEETFGEDPWLVGVMATAYVKGLQ 201 >gi|258620359|ref|ZP_05715397.1| beta-N-acetylhexosaminidase [Vibrio mimicus VM573] gi|258587238|gb|EEW11949.1| beta-N-acetylhexosaminidase [Vibrio mimicus VM573] Length = 330 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + F R Sbjct: 101 MAVELIAHDVDLSFAPVLDMGFVCKAI---GNRAFGEDVQTVLNHSSAFLRGMK 151 >gi|119502835|ref|ZP_01624920.1| Beta-glucosidase [marine gamma proteobacterium HTCC2080] gi|119461181|gb|EAW42271.1| Beta-glucosidase [marine gamma proteobacterium HTCC2080] Length = 824 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +GI+ F+P + + + +S P A Sbjct: 161 AREVKATGIDWIFAPTVAVAQDYR--WGRTYESYSSDPQVVSSYAGGMVEAMQ 211 >gi|170781294|ref|YP_001709626.1| putative beta-xylosidase [Clavibacter michiganensis subsp. sepedonicus] gi|169155862|emb|CAQ00988.1| putative beta-xylosidase [Clavibacter michiganensis subsp. sepedonicus] Length = 786 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 6/54 (11%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ G++ +PVLD++ + + P +++ Sbjct: 148 IGGSMRELGVHQGLAPVLDVIRDAR--WGRVDECIAEDPYVVGTIGTAYAKGLQ 199 >gi|119952808|ref|YP_945017.1| beta-hexosaminidase [Borrelia turicatae 91E135] gi|119861579|gb|AAX17347.1| beta-hexosaminidase [Borrelia turicatae 91E135] Length = 355 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K L GINVN +PV D + P + + F + F Sbjct: 173 LGKQLRRLGINVNMAPVADAKFVPNSPLGS--RTFGYSSYNIGLMVEAFIDGIQ 224 >gi|238064627|ref|ZP_04609336.1| xylan 1,4-beta-xylosidase- Streptomyces thermoviolaceus [Micromonospora sp. ATCC 39149] gi|237886438|gb|EEP75266.1| xylan 1,4-beta-xylosidase- Streptomyces thermoviolaceus [Micromonospora sp. ATCC 39149] Length = 816 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + ++L +G++ +PVLD+ + P + + R Sbjct: 160 IGRSLRAAGVHQGLAPVLDVTRDYR--WGRTEETIGEDPYLVGTTGAAYVRGL 210 >gi|302545566|ref|ZP_07297908.1| beta-D-xylosidase [Streptomyces hygroscopicus ATCC 53653] gi|302463184|gb|EFL26277.1| beta-D-xylosidase [Streptomyces himastatinicus ATCC 53653] Length = 780 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + ++ + G++ SPVLD++ + P + R Sbjct: 146 IGGSMRSVGVHQGLSPVLDVVRDAR--WGRTEESIGEDPYLVATVGTAYVRGL 196 >gi|240949482|ref|ZP_04753822.1| beta-hexosaminidase [Actinobacillus minor NM305] gi|240296055|gb|EER46716.1| beta-hexosaminidase [Actinobacillus minor NM305] Length = 347 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLD+ + + F + + A+ F + Sbjct: 103 MAAEMFALDIDLSFAPVLDMGHECKAI---GDRAFGKSLGQILPLAEAFIDGMQE 154 >gi|260597658|ref|YP_003210229.1| hypothetical protein CTU_18660 [Cronobacter turicensis z3032] gi|260216835|emb|CBA30338.1| hypothetical protein CTU_18660 [Cronobacter turicensis z3032] Length = 789 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G + +PVLD+ + F P A + + Sbjct: 149 IGQEARAVGCHQGLAPVLDVSRDVR--WGRTEETFGEDPWLVGLMATHYVKGLQ 200 >gi|156934269|ref|YP_001438185.1| hypothetical protein ESA_02100 [Cronobacter sakazakii ATCC BAA-894] gi|156532523|gb|ABU77349.1| hypothetical protein ESA_02100 [Cronobacter sakazakii ATCC BAA-894] Length = 789 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G + +PVLD+ + F P A + + Sbjct: 149 IGQEARAVGCHQGLAPVLDVSRDVR--WGRTEETFGEDPWLVGLMATHYVKGLQ 200 >gi|251791918|ref|YP_003006638.1| beta-hexosaminidase [Aggregatibacter aphrophilus NJ8700] gi|247533305|gb|ACS96551.1| beta-hexosaminidase [Aggregatibacter aphrophilus NJ8700] Length = 348 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F A + A F R + Sbjct: 105 MAAEMTALDIDLSFAPVLDLGHQCKAI---GDRSFGCKVKSAVDLAANFIRGMHQ 156 >gi|160872867|ref|ZP_02062999.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Rickettsiella grylli] gi|159121666|gb|EDP47004.1| beta-hexosaminidase (N-acetyl-beta-glucosaminidase)(Beta-N- acetylhexosaminidase) [Rickettsiella grylli] Length = 359 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 11/39 (28%), Positives = 17/39 (43%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPA 40 A L +GI V + PV+D + I +K + P Sbjct: 118 AYELRKAGITVLYGPVMDTYHAEAAVIGKKGRSYGNPPQ 156 >gi|119963829|ref|YP_946927.1| beta-D-xylosidase [Arthrobacter aurescens TC1] gi|119950688|gb|ABM09599.1| beta-D-xylosidase [Arthrobacter aurescens TC1] Length = 785 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + + GI+ +PVLD++ + P A + + Sbjct: 150 IGATMRSLGIHQGLAPVLDVVRDLR--WGRVEETIGEDPYLVGTVATAYVQGL 200 >gi|313633027|gb|EFR99949.1| periplasmic beta-glucosidase [Listeria seeligeri FSL N1-067] Length = 756 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 +A+ + G+++ + LD+L P + + P A E + + KN K Sbjct: 151 IAEEISDKGVHLALASALDILRDPR--WGRAEECYGEDPYLAAELTAAITEGFQKNGK 206 >gi|289434894|ref|YP_003464766.1| beta-glucosidase [Listeria seeligeri serovar 1/2b str. SLCC3954] gi|289171138|emb|CBH27680.1| beta-glucosidase [Listeria seeligeri serovar 1/2b str. SLCC3954] Length = 756 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 +A+ + G+++ + LD+L P + + P A E + + KN K Sbjct: 151 IAEEISDKGVHLALASALDILRDPR--WGRAEECYGEDPYLAAELTAAITEGFQKNGK 206 >gi|219871205|ref|YP_002475580.1| beta-hexosaminidase [Haemophilus parasuis SH0165] gi|254766762|sp|B8F5N0|NAGZ_HAEPS RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|219691409|gb|ACL32632.1| beta-hexosaminidase [Haemophilus parasuis SH0165] Length = 340 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M+ + I+++F+PVLDL + + F A A+ F + Sbjct: 98 MSAEMFALDIDLSFAPVLDLGHCSKAI---GDRSFGEDVATMLPVAEAFIDGMRE 149 >gi|167855166|ref|ZP_02477937.1| beta-hexosaminidase [Haemophilus parasuis 29755] gi|167853711|gb|EDS24954.1| beta-hexosaminidase [Haemophilus parasuis 29755] Length = 340 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M+ + I+++F+PVLDL + + F A A+ F + Sbjct: 98 MSAEMFALDIDLSFAPVLDLGHCSKAI---GDRSFGEDVATMLPVAEAFIDGMRE 149 >gi|256375960|ref|YP_003099620.1| glycoside hydrolase family 3 domain protein [Actinosynnema mirum DSM 43827] gi|255920263|gb|ACU35774.1| glycoside hydrolase family 3 domain protein [Actinosynnema mirum DSM 43827] Length = 771 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + L G++ +PVLD+ + P + R Sbjct: 147 IGGQLRDVGVHQGLAPVLDVTRDYR--WGRVEETIGEDPYLVGLIGAAYVRGL 197 >gi|114568800|ref|YP_755480.1| glycoside hydrolase family 3 protein [Maricaulis maris MCS10] gi|114339262|gb|ABI64542.1| glycoside hydrolase, family 3 domain protein [Maricaulis maris MCS10] Length = 750 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 ++ T G+N F+P++D+ P + P R + Sbjct: 132 SEEASTVGVNWTFAPMIDVCRDPR--WGRIAECLGEDPVLTSVLGAAMVRGFQ 182 >gi|311031835|ref|ZP_07709925.1| glycoside hydrolase family 3 domain protein [Bacillus sp. m3-13] Length = 719 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK SG++V F+P++DL+ P + P A+ F R + Sbjct: 121 AKEASVSGVHVTFAPMVDLVRDPR--WGRVMESTGEDPYLNSVFAKAFVRGFQ 171 >gi|332830492|gb|EGK03120.1| hypothetical protein HMPREF9455_01370 [Dysgonomonas gadei ATCC BAA-286] Length = 889 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 16/56 (28%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A G++ P LDL + F P + A + N Sbjct: 153 IAAEARAHGVHFVLGPNLDLARDIR--WGRTEETFGEDPYLSSRYAVSLIKGMQGN 206 >gi|304405496|ref|ZP_07387155.1| glycoside hydrolase family 3 domain protein [Paenibacillus curdlanolyticus YK9] gi|304345535|gb|EFM11370.1| glycoside hydrolase family 3 domain protein [Paenibacillus curdlanolyticus YK9] Length = 659 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + SG N F+P++ + FS A + F + Sbjct: 171 AEEVKASGTNWAFAPMIADPQN--AKWGRTYEGFSDNEALVAQMGAAFIKGMQ 221 >gi|206901280|ref|YP_002250567.1| xylosidase/arabinosidase [Dictyoglomus thermophilum H-6-12] gi|206740383|gb|ACI19441.1| xylosidase/arabinosidase [Dictyoglomus thermophilum H-6-12] Length = 762 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ + ++ SPVLD+ P + F P A + + Sbjct: 132 IRQHMKAANVHQGLSPVLDIPRDPR--WGRTEETFGEDPYLVSRMATEYVKGLQ 183 >gi|290963264|ref|YP_003494446.1| beta-D-xylosidase [Streptomyces scabiei 87.22] gi|260652790|emb|CBG75923.1| putative beta-D-xylosidase [Streptomyces scabiei 87.22] Length = 771 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + ++ G++ SPVLD++ + P + + R Sbjct: 145 IGTSMRRVGVHQGLSPVLDVVRDYR--WGRVEETLGEDPYLVAANGTAYVRGL 195 >gi|315303407|ref|ZP_07874010.1| periplasmic beta-glucosidase [Listeria ivanovii FSL F6-596] gi|313628224|gb|EFR96754.1| periplasmic beta-glucosidase [Listeria ivanovii FSL F6-596] Length = 756 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 +A+ + G+++ + LD+L P + + P A E + + KN K Sbjct: 151 IAEEISDKGVHLALASALDILRDPR--WGRAEECYGEDPYLAAELTAAITEGFQKNGK 206 >gi|154497718|ref|ZP_02036096.1| hypothetical protein BACCAP_01694 [Bacteroides capillosus ATCC 29799] gi|150273216|gb|EDN00361.1| hypothetical protein BACCAP_01694 [Bacteroides capillosus ATCC 29799] Length = 435 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 12/46 (26%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESA 46 +A V G N++F+P LD+ PE + F E Sbjct: 189 LANECVAFGFNLDFAPSLDIWSNPENTVIGT-RAFGTTAEAVEAVG 233 >gi|88797424|ref|ZP_01113013.1| Beta-glucosidase-related Glycosidase [Reinekea sp. MED297] gi|88779596|gb|EAR10782.1| Beta-glucosidase-related Glycosidase [Reinekea sp. MED297] Length = 671 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A + SG++ F+P + + P + FS+ A+ Y + Sbjct: 177 ADQVRASGVDWTFAPTVAIADNPA--WGRSYESFSQDADAVFHFAKAVVEGYQQ 228 >gi|325567277|ref|ZP_08143944.1| beta-glucosidase [Enterococcus casseliflavus ATCC 12755] gi|325158710|gb|EGC70856.1| beta-glucosidase [Enterococcus casseliflavus ATCC 12755] Length = 716 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK SG++V FSP++DL+ P + P A+ F + Y Sbjct: 120 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPYLNSRFAEAFVKGYQ 170 >gi|257876223|ref|ZP_05655876.1| glycosyl hydrolase [Enterococcus casseliflavus EC20] gi|257810389|gb|EEV39209.1| glycosyl hydrolase [Enterococcus casseliflavus EC20] Length = 716 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK SG++V FSP++DL+ P + P A+ F + Y Sbjct: 120 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPYLNSRFAEAFVKGYQ 170 >gi|257866618|ref|ZP_05646271.1| glycosyl hydrolase [Enterococcus casseliflavus EC30] gi|257872866|ref|ZP_05652519.1| glycosyl hydrolase [Enterococcus casseliflavus EC10] gi|257800576|gb|EEV29604.1| glycosyl hydrolase [Enterococcus casseliflavus EC30] gi|257807030|gb|EEV35852.1| glycosyl hydrolase [Enterococcus casseliflavus EC10] Length = 716 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK SG++V FSP++DL+ P + P A+ F + Y Sbjct: 120 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPYLNSRFAEAFVKGYQ 170 >gi|86141717|ref|ZP_01060241.1| beta-glucosidase [Leeuwenhoekiella blandensis MED217] gi|85831280|gb|EAQ49736.1| beta-glucosidase [Leeuwenhoekiella blandensis MED217] Length = 758 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK GIN NFSP++D+ P + P A+ Y + Sbjct: 141 AKEATADGINWNFSPMVDIARDPR--WGRISEGAGEDPYLGSAIAKAMVTGYQQ 192 >gi|258624732|ref|ZP_05719666.1| beta-N-acetylhexosaminidase [Vibrio mimicus VM603] gi|258583019|gb|EEW07834.1| beta-N-acetylhexosaminidase [Vibrio mimicus VM603] Length = 330 Score = 44.4 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ ++++F+PVLD+ + + F + F Sbjct: 101 MAAELIAHDVDLSFAPVLDMGFVCKAI---GNRAFGEDVQTVLNHSSAFLHGMK 151 >gi|196230151|ref|ZP_03129014.1| Beta-N-acetylhexosaminidase [Chthoniobacter flavus Ellin428] gi|196225748|gb|EDY20255.1| Beta-N-acetylhexosaminidase [Chthoniobacter flavus Ellin428] Length = 366 Score = 44.4 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 22/53 (41%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK L G N++ PVLD+ + E + + + + +A F+ Sbjct: 107 AKLLRIFGFNLDLCPVLDISFDDEADNSLRGRCYGNNVPQVIRNAGAFNSALQ 159 >gi|121607931|ref|YP_995738.1| glycoside hydrolase family 3 protein [Verminephrobacter eiseniae EF01-2] gi|121552571|gb|ABM56720.1| glycoside hydrolase, family 3 domain protein [Verminephrobacter eiseniae EF01-2] Length = 802 Score = 44.4 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G + +PVLD+ + F P A + R Sbjct: 153 IGQECRQLGCHQGLAPVLDVSRDVR--WGRTEETFGEDPYLVGVLATRYVRGLQ 204 >gi|313637636|gb|EFS03026.1| beta-glucosidase [Listeria seeligeri FSL S4-171] Length = 532 Score = 44.4 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 +A+ + G+++ + LD+L P + + P A E + + KN K Sbjct: 151 IAEEISDKGVHLALASALDILRDPR--WGRAEECYGEDPYLAAELTAAITEGFQKNGK 206 >gi|224533088|ref|ZP_03673690.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi WI91-23] gi|224511980|gb|EEF82379.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi WI91-23] Length = 202 Score = 44.4 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSR-IPAKAEESAQLFSRTYIKN 56 +AK L GIN+N +PV D+ + P T F + F + Sbjct: 28 LAKQLRRLGINLNMAPVADIKFAPHTP--LLNRTFGGYSAYNIGLMVEAFIDGMQSH 82 >gi|300780314|ref|ZP_07090170.1| probable beta-N-acetylglucosaminidase [Corynebacterium genitalium ATCC 33030] gi|300534424|gb|EFK55483.1| probable beta-N-acetylglucosaminidase [Corynebacterium genitalium ATCC 33030] Length = 388 Score = 44.4 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L GINV+++P+LDL + F + P + E A LFS+ + Sbjct: 164 IGVTLRKHGINVDYAPLLDLDVTDLDIVG--DRAFGQTPERVSEVATLFSQGLVD 216 >gi|297196085|ref|ZP_06913483.1| xylan 1,4-beta-xylosidase [Streptomyces pristinaespiralis ATCC 25486] gi|297153068|gb|EDY63298.2| xylan 1,4-beta-xylosidase [Streptomyces pristinaespiralis ATCC 25486] Length = 798 Score = 44.0 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + ++ G++ +PVLD++ + P + Sbjct: 160 IGADMRAVGVHQGLAPVLDVVRDLR--WGRVEETIGEDPYLVGTVGTAYVEGL 210 >gi|299820588|ref|ZP_07052478.1| beta-glucosidase [Listeria grayi DSM 20601] gi|299818083|gb|EFI85317.1| beta-glucosidase [Listeria grayi DSM 20601] Length = 730 Score = 44.0 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK G++VNFSP+LDL+ P + P E R Y Sbjct: 126 AKEATADGLHVNFSPMLDLVRDPR--WGRVMESTGEDPYLNSELGVAMVRGYQ 176 >gi|241666600|ref|YP_002984684.1| Beta-N-acetylhexosaminidase [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240862057|gb|ACS59722.1| Beta-N-acetylhexosaminidase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 340 Score = 44.0 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M + G++ SPVLDL++ + + F P + ++ Sbjct: 112 MGAMMTELGLSSGCSPVLDLVFETTSAVIGA-RSFGPGPDFVAALGREVVDGLLE 165 >gi|295135996|ref|YP_003586672.1| beta-glucosidase [Zunongwangia profunda SM-A87] gi|294984011|gb|ADF54476.1| putative beta-glucosidase [Zunongwangia profunda SM-A87] Length = 796 Score = 44.0 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +AK + G N + P++D+ P ++ F P E + + Sbjct: 171 IAKEIRAQGSNTAYGPIIDIAREPR--WSRVEETFGEDPYLIAEMGKSMVTGFQ 222 >gi|238754396|ref|ZP_04615752.1| Beta-hexosaminidase [Yersinia ruckeri ATCC 29473] gi|238707429|gb|EEP99790.1| Beta-hexosaminidase [Yersinia ruckeri ATCC 29473] Length = 343 Score = 44.0 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I F P KA E A+ F Sbjct: 104 MAAEMIAMDIDISFAPVLDIGH-VSAAIG--ERSFHSEPLKALEMAERFIMGMH 154 >gi|42526730|ref|NP_971828.1| glycosy hydrolase family protein [Treponema denticola ATCC 35405] gi|41817045|gb|AAS11739.1| glycosyl hydrolase, family 3 [Treponema denticola ATCC 35405] Length = 400 Score = 44.0 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ + GI++N +P+++ + IFS + A F K Sbjct: 149 AEQIHLLGIHLNLAPIVEKERSKDAG-FLDDRIFSNDEDVLVKYADAFISGMKK 201 >gi|25169129|emb|CAD47965.1| putative beta-glucosidase [Arthrobacter nicotinovorans] Length = 583 Score = 44.0 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 M + L+ GI V P+ D+ P F P + E F P Sbjct: 138 MRQELLAMGIRVFLGPMADIFSEPRWSRGSG--TFGENPERVSELTAAFIEALRGGP 192 >gi|120434734|ref|YP_860421.1| glycoside hydrolase family protein [Gramella forsetii KT0803] gi|117576884|emb|CAL65353.1| glycoside hydrolase, family 3-likely beta-glucosidase [Gramella forsetii KT0803] Length = 757 Score = 44.0 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK GIN NFSP++D+ P + P + A + Y Sbjct: 138 AKEATADGINWNFSPMVDIARDPR--WGRIAEGAGEDPYLGSQVAIAMVQGYQ 188 >gi|256376116|ref|YP_003099776.1| glycoside hydrolase family 3 domain protein [Actinosynnema mirum DSM 43827] gi|255920419|gb|ACU35930.1| glycoside hydrolase family 3 domain protein [Actinosynnema mirum DSM 43827] Length = 807 Score = 44.0 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + ++ +G++ +PVLD+ + P A + R Sbjct: 153 IGASMRAAGVHQGLAPVLDVTRDYR--WGRTEETIGEDPLLVGVVATAYVRGLED 205 >gi|152966494|ref|YP_001362278.1| glycoside hydrolase family 3 domain protein [Kineococcus radiotolerans SRS30216] gi|151361011|gb|ABS04014.1| glycoside hydrolase family 3 domain protein [Kineococcus radiotolerans SRS30216] Length = 760 Score = 44.0 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + G+ +P+ D+ P + + P A F R + Sbjct: 97 IGGQMSALGVRQALAPLADVARDPR--WGRVEETYGEEPYLVGAMATAFVRGVQE 149 >gi|222148973|ref|YP_002549930.1| glycosyl hydrolase [Agrobacterium vitis S4] gi|221735959|gb|ACM36922.1| glycosyl hydrolase [Agrobacterium vitis S4] Length = 338 Score = 44.0 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 10/41 (24%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKA 42 A +L+ GINV+ PV+D+ + + + P Sbjct: 112 AFDLLRYGINVDCLPVVDVPVEGASNVIG-NRAYGFDPDTV 151 >gi|15642851|ref|NP_227892.1| xylosidase [Thermotoga maritima MSB8] gi|4980564|gb|AAD35170.1|AE001694_6 xylosidase [Thermotoga maritima MSB8] Length = 778 Score = 44.0 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 8/52 (15%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +++ G + +PVLD+ P + F P + + Sbjct: 139 EDMRKIGAHQGLAPVLDVARDPR--WGRTEETFGESPYLVARMGVSYVKGLQ 188 >gi|312149202|gb|ADQ29273.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi N40] Length = 342 Score = 44.0 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSR-IPAKAEESAQLFSRTYIKN 56 +AK L GIN+N +PV D+ + P T F + F + Sbjct: 168 LAKQLRRLGINLNMAPVADIKFAPHTP--LLNRTFGGYSAYNIGLMVEAFIDGMQSH 222 >gi|219847034|ref|YP_002461467.1| glycoside hydrolase family 3 domain-containing protein [Chloroflexus aggregans DSM 9485] gi|219541293|gb|ACL23031.1| glycoside hydrolase family 3 domain protein [Chloroflexus aggregans DSM 9485] Length = 702 Score = 44.0 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ GI F+P+LD+ + + P A+ R + Sbjct: 120 AREASAVGIRWTFAPMLDIARDAR--WGRIAEGYGEDPYLTSRMAEAAVRGFQ 170 >gi|322691691|ref|YP_004221261.1| beta-glucosidase [Bifidobacterium longum subsp. longum JCM 1217] gi|320456547|dbj|BAJ67169.1| putative beta-glucosidase [Bifidobacterium longum subsp. longum JCM 1217] Length = 786 Score = 44.0 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + ++G++ FSPVL + + F P E A + Y Sbjct: 131 AEEVSSTGVHWTFSPVLCIARDTR--WGRVDETFGEDPMLIGEMASAMVKGYQ 181 >gi|312134051|ref|YP_004001390.1| bglx2 [Bifidobacterium longum subsp. longum BBMN68] gi|311773361|gb|ADQ02849.1| BglX2 [Bifidobacterium longum subsp. longum BBMN68] Length = 798 Score = 44.0 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + ++G++ FSPVL + + F P E A + Y Sbjct: 131 AEEVSSTGVHWTFSPVLCIARDTR--WGRVDETFGEDPMLIGEMASAMVKGYQ 181 >gi|257464908|ref|ZP_05629279.1| beta-hexosaminidase [Actinobacillus minor 202] gi|257450568|gb|EEV24611.1| beta-hexosaminidase [Actinobacillus minor 202] Length = 347 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLD+ + + F + + A+ F + Sbjct: 103 MAAEMFALDIDLSFAPVLDMGHECKAI---GDRAFGKSLGQILPLAEAFIDGMRE 154 >gi|330502557|ref|YP_004379426.1| beta-hexosaminidase [Pseudomonas mendocina NK-01] gi|328916843|gb|AEB57674.1| beta-hexosaminidase [Pseudomonas mendocina NK-01] Length = 332 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ G++++F+PVLDL + + F +A A F R + Sbjct: 101 MATEVLAVGLDLSFAPVLDLDHQRSAVVGS--RAFEGDARRATALAAAFIRGMHQ 153 >gi|94497563|ref|ZP_01304132.1| xylosidase/arabinosidase [Sphingomonas sp. SKA58] gi|94422980|gb|EAT08012.1| xylosidase/arabinosidase [Sphingomonas sp. SKA58] Length = 774 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G+ + SPV+D+ P + + P E Sbjct: 165 IAREIRVRGVPMVLSPVVDIARDPR--WGRIEETYGEDPYLVGEMGVAAVEGLQ 216 >gi|295131165|ref|YP_003581828.1| glycosyl hydrolase family 3 N-terminal domain protein [Propionibacterium acnes SK137] gi|291376856|gb|ADE00711.1| glycosyl hydrolase family 3 N-terminal domain protein [Propionibacterium acnes SK137] Length = 412 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 188 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 245 >gi|146308257|ref|YP_001188722.1| glycoside hydrolase family 3 protein [Pseudomonas mendocina ymp] gi|145576458|gb|ABP85990.1| glycoside hydrolase, family 3 domain protein [Pseudomonas mendocina ymp] Length = 768 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+++ F+P +D+ P + F P A R + Sbjct: 140 ALEASADGLDMTFAPTVDISRDPR--WGRTSEGFGEDPYLVSRIAAAMVRGFQ 190 >gi|289178794|gb|ADC86040.1| Beta-N-acetylhexosaminidase [Bifidobacterium animalis subsp. lactis BB-12] Length = 535 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Query: 5 LVTSGINVNFSPVLD---LLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L SG+ +N +P +D + I F + E A F Sbjct: 314 LKRSGLAMNLAPSVDTVTIERAVNEPIGALYRDFGLDAQRNGEHAAAFIEGMR 366 >gi|119383844|ref|YP_914900.1| glycoside hydrolase family 3 protein [Paracoccus denitrificans PD1222] gi|119373611|gb|ABL69204.1| glycoside hydrolase, family 3 domain protein [Paracoccus denitrificans PD1222] Length = 333 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 MA+ G+ + SPV+D++ G + + F R Sbjct: 118 MAQAARGMGVTMFLSPVIDVVTGH-NPW-LQGRTLGTDAVEVARIGCAFIRG 167 >gi|192361004|ref|YP_001980728.1| glucan 1,4-beta-glucosidase cel3A [Cellvibrio japonicus Ueda107] gi|190687169|gb|ACE84847.1| glucan 1,4-beta-glucosidase cel3A [Cellvibrio japonicus Ueda107] Length = 869 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ +FSP + + + +S P A Sbjct: 193 AREIAATGLDWDFSPTVAVARDDR--WGRTYESWSEDPQIVHAFAGKMVEGLQ 243 >gi|288929238|ref|ZP_06423083.1| periplasmic beta-glucosidase [Prevotella sp. oral taxon 317 str. F0108] gi|288329340|gb|EFC67926.1| periplasmic beta-glucosidase [Prevotella sp. oral taxon 317 str. F0108] Length = 770 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ + ++ NF+P +++ + F P ++ Y +N Sbjct: 170 AEEMRAMNMHWNFNPNVEVARDGR--WGRCGETFGEDPYLVTLMGVATNKGYQRN 222 >gi|152966486|ref|YP_001362270.1| glycoside hydrolase family 3 domain protein [Kineococcus radiotolerans SRS30216] gi|151361003|gb|ABS04006.1| glycoside hydrolase family 3 domain protein [Kineococcus radiotolerans SRS30216] Length = 902 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+ SP+ D+ P + + P A F R Sbjct: 126 IGVQMTRLGVRQALSPLADVARDPR--WGRVEETYGEEPQLVGSMAAAFVRGLQ 177 >gi|149278527|ref|ZP_01884664.1| beta-glucosidase [Pedobacter sp. BAL39] gi|149230897|gb|EDM36279.1| beta-glucosidase [Pedobacter sp. BAL39] Length = 775 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ GIN FSP++D+ P + P E A+ + Y Sbjct: 154 AQEATADGINWTFSPMVDISRDPR--WGRVAEGSGEDPYLGAEIAKAMVKGYQ 204 >gi|94496951|ref|ZP_01303525.1| Beta-N-acetylhexosaminidase [Sphingomonas sp. SKA58] gi|94423627|gb|EAT08654.1| Beta-N-acetylhexosaminidase [Sphingomonas sp. SKA58] Length = 337 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 9/50 (18%), Positives = 15/50 (30%), Gaps = 1/50 (2%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 L GI V+ P+LD+ + I P + + Sbjct: 111 TLAEVGITVDALPLLDVRQDGASDIMG-DRTLGAEPMRVAALGRAVLEGL 159 >gi|325473792|gb|EGC76980.1| glycosyl hydrolase, family 3 [Treponema denticola F0402] Length = 400 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ + GI++N +P+++ + IFS + A F K Sbjct: 149 AEQIHLLGIHLNLAPIVEKESSKDAG-FLDDRIFSDDEDVLVKYADAFISGMKK 201 >gi|260593561|ref|ZP_05859019.1| xylosidase/arabinosidase [Prevotella veroralis F0319] gi|260534549|gb|EEX17166.1| xylosidase/arabinosidase [Prevotella veroralis F0319] Length = 771 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ + ++ NF+P +++ + F P ++ Y +N Sbjct: 171 AEEMRAMNMHWNFNPNVEVARDAR--WGRCGETFGEDPYLVTLMGVATNKGYQRN 223 >gi|332143188|ref|YP_004428926.1| glucan 1,4-beta-glucosidase [Alteromonas macleodii str. 'Deep ecotype'] gi|327553210|gb|AEA99928.1| glucan 1,4-beta-glucosidase [Alteromonas macleodii str. 'Deep ecotype'] Length = 850 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +GI+ F+P + ++ + +S PA E A + Sbjct: 183 AKEVMATGIDWVFAPTVAVVRDDR--WGRTYESYSEDPAIVREYAASVVKGLQ 233 >gi|289426622|ref|ZP_06428352.1| glycosyl hydrolase family 3 N-terminal domain protein [Propionibacterium acnes J165] gi|289160182|gb|EFD08356.1| glycosyl hydrolase family 3 N-terminal domain protein [Propionibacterium acnes J165] gi|332676041|gb|AEE72857.1| putative beta-hexosaminidase [Propionibacterium acnes 266] Length = 412 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 188 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 245 >gi|301163845|emb|CBW23400.1| putative exported hydrolase [Bacteroides fragilis 638R] Length = 861 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++ L G+N SP +D++ + F P + YI Sbjct: 155 ISGELNAMGVNHVLSPTIDVIRELR--WGRVEESFGEDPFLVSQMGVHEINGYID 207 >gi|265766190|ref|ZP_06094231.1| periplasmic beta-glucosidase [Bacteroides sp. 2_1_16] gi|263253858|gb|EEZ25323.1| periplasmic beta-glucosidase [Bacteroides sp. 2_1_16] Length = 861 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++ L G+N SP +D++ + F P + YI Sbjct: 155 ISGELNAMGVNHVLSPTIDVIRELR--WGRVEESFGEDPFLVSQMGVHEINGYID 207 >gi|253564851|ref|ZP_04842307.1| periplasmic beta-glucosidase [Bacteroides sp. 3_2_5] gi|251946316|gb|EES86693.1| periplasmic beta-glucosidase [Bacteroides sp. 3_2_5] Length = 861 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++ L G+N SP +D++ + F P + YI Sbjct: 155 ISGELNAMGVNHVLSPTIDVIRELR--WGRVEESFGEDPFLVSQMGVHEINGYID 207 >gi|224537102|ref|ZP_03677641.1| hypothetical protein BACCELL_01979 [Bacteroides cellulosilyticus DSM 14838] gi|224521279|gb|EEF90384.1| hypothetical protein BACCELL_01979 [Bacteroides cellulosilyticus DSM 14838] Length = 769 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A + +G + F+P +++ P + F P R N Sbjct: 172 ALEMRATGAHWAFTPNVEVARDPR--WGRTGETFGEDPHLVGVMGAATVRGLQGN 224 >gi|60682375|ref|YP_212519.1| putative exported hydrolase [Bacteroides fragilis NCTC 9343] gi|60493809|emb|CAH08599.1| putative exported hydrolase [Bacteroides fragilis NCTC 9343] Length = 861 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++ L G+N SP +D++ + F P + YI Sbjct: 155 ISGELNAMGVNHVLSPTIDVIRELR--WGRVEESFGEDPFLVSQMGVHEINGYID 207 >gi|53714357|ref|YP_100349.1| periplasmic beta-glucosidase [Bacteroides fragilis YCH46] gi|52217222|dbj|BAD49815.1| periplasmic beta-glucosidase precursor [Bacteroides fragilis YCH46] Length = 861 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++ L G+N SP +D++ + F P + YI Sbjct: 155 ISGELNAMGVNHVLSPTIDVIRELR--WGRVEESFGEDPFLVSQMGVHEINGYID 207 >gi|313811452|gb|EFS49166.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL083PA1] gi|313831192|gb|EFS68906.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL007PA1] gi|314974070|gb|EFT18166.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL053PA1] gi|314976642|gb|EFT20737.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL045PA1] gi|315095414|gb|EFT67390.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL038PA1] gi|327328527|gb|EGE70289.1| putative beta-hexosaminidase [Propionibacterium acnes HL096PA2] gi|327444315|gb|EGE90969.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL043PA2] gi|327444804|gb|EGE91458.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL043PA1] gi|328759962|gb|EGF73546.1| putative beta-hexosaminidase [Propionibacterium acnes HL099PA1] Length = 344 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|289426330|ref|ZP_06428073.1| glycosyl hydrolase family 3 N-terminal domain protein [Propionibacterium acnes SK187] gi|289153058|gb|EFD01776.1| glycosyl hydrolase family 3 N-terminal domain protein [Propionibacterium acnes SK187] Length = 412 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 188 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 245 >gi|50843113|ref|YP_056340.1| putative beta-hexosaminidase [Propionibacterium acnes KPA171202] gi|50840715|gb|AAT83382.1| putative beta-hexosaminidase [Propionibacterium acnes KPA171202] Length = 412 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 188 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 245 >gi|314984304|gb|EFT28396.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL005PA1] Length = 344 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|314919422|gb|EFS83253.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL050PA1] gi|314920671|gb|EFS84502.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL050PA3] gi|314930551|gb|EFS94382.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL067PA1] gi|314954495|gb|EFS98901.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL027PA1] gi|314957572|gb|EFT01675.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL002PA1] gi|315100427|gb|EFT72403.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL046PA1] gi|327457873|gb|EGF04528.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL083PA2] Length = 344 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|327446291|gb|EGE92945.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL013PA2] Length = 344 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|327334121|gb|EGE75835.1| putative beta-hexosaminidase [Propionibacterium acnes HL097PA1] Length = 344 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|315109114|gb|EFT81090.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL030PA2] Length = 344 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|313834216|gb|EFS71930.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL056PA1] Length = 344 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|313808075|gb|EFS46556.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL087PA2] gi|313819646|gb|EFS57360.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL046PA2] gi|313823733|gb|EFS61447.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL036PA2] gi|313826055|gb|EFS63769.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL063PA1] gi|314924773|gb|EFS88604.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL036PA3] gi|314961986|gb|EFT06087.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL002PA2] gi|314978908|gb|EFT23002.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL072PA2] gi|314986650|gb|EFT30742.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL005PA2] gi|314991006|gb|EFT35097.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL005PA3] gi|315083646|gb|EFT55622.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL027PA2] gi|315089191|gb|EFT61167.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL072PA1] gi|327329608|gb|EGE71364.1| putative beta-hexosaminidase [Propionibacterium acnes HL096PA3] gi|328752437|gb|EGF66053.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL020PA1] Length = 344 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|313793853|gb|EFS41877.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL110PA1] gi|313801245|gb|EFS42496.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL110PA2] gi|313829527|gb|EFS67241.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL063PA2] gi|313840032|gb|EFS77746.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL086PA1] gi|314963792|gb|EFT07892.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL082PA1] gi|314968382|gb|EFT12480.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL037PA1] gi|315079641|gb|EFT51634.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL053PA2] gi|315081129|gb|EFT53105.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL078PA1] gi|315099090|gb|EFT71066.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL059PA2] gi|315106881|gb|EFT78857.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL030PA1] gi|327452121|gb|EGE98775.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL092PA1] Length = 344 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|313763463|gb|EFS34827.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL013PA1] Length = 344 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|238787437|ref|ZP_04631236.1| Glycoside hydrolase, family 3 domain protein [Yersinia frederiksenii ATCC 33641] gi|238724699|gb|EEQ16340.1| Glycoside hydrolase, family 3 domain protein [Yersinia frederiksenii ATCC 33641] Length = 789 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + ++G + +PVLD+ + F P A + + Sbjct: 150 IGQEARSTGCHQGLAPVLDVSRDVR--WGRTEETFGEDPWLVGMMATHYVKGLQ 201 >gi|303231682|ref|ZP_07318405.1| glycosyl hydrolase family 3 N-terminal domain protein [Veillonella atypica ACS-049-V-Sch6] gi|302513631|gb|EFL55650.1| glycosyl hydrolase family 3 N-terminal domain protein [Veillonella atypica ACS-049-V-Sch6] Length = 382 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 19/54 (35%), Gaps = 7/54 (12%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G N+NF+P DL +S P + + A + Y + Sbjct: 166 GTELKDLGFNINFAPDADLGL-------TYGRSYSTNPDQVVKFAGAVGKAYDE 212 >gi|314914825|gb|EFS78656.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL005PA4] Length = 344 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 21/58 (36%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 AHQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|288920307|ref|ZP_06414620.1| glycoside hydrolase family 3 domain protein [Frankia sp. EUN1f] gi|288348331|gb|EFC82595.1| glycoside hydrolase family 3 domain protein [Frankia sp. EUN1f] Length = 820 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + +G SPV+D+ + + P + F R Sbjct: 134 LGRQARATGHTYVLSPVMDVARDAR--WGRVHETYGEDPYLVSAMSVAFVRGMQ 185 >gi|254461127|ref|ZP_05074543.1| beta-hexosaminidase, putative [Rhodobacterales bacterium HTCC2083] gi|206677716|gb|EDZ42203.1| beta-hexosaminidase, putative [Rhodobacteraceae bacterium HTCC2083] Length = 335 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L+ GI+ N +P++D+ K +S E Q + I Sbjct: 106 IADELMHLGIDANCAPMVDIASDETHE-FLKNRCYSNDLQSVVEIGQAVAGGLID 159 >gi|304320989|ref|YP_003854632.1| glycosyl hydrolase, family 3 [Parvularcula bermudensis HTCC2503] gi|303299891|gb|ADM09490.1| glycosyl hydrolase, family 3 [Parvularcula bermudensis HTCC2503] Length = 341 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 9/42 (21%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKA 42 +A + GI+V+ P++D+ I F+ P Sbjct: 109 LAHDCRRLGIDVDCVPMVDVRQSGAHDIVG-DRAFAEDPIVV 149 >gi|313773616|gb|EFS39582.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL074PA1] Length = 344 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|300789204|ref|YP_003769495.1| beta-glucosidase [Amycolatopsis mediterranei U32] gi|299798718|gb|ADJ49093.1| beta-glucosidase [Amycolatopsis mediterranei U32] Length = 739 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SGI+ ++P++D+ + P + + P A + A R Y Sbjct: 141 AREARGSGIHWTYAPMMDVTHEPR--WGRIAEGYGEDPYLATQFAVAKVRGYQ 191 >gi|288919735|ref|ZP_06414061.1| glycoside hydrolase family 3 domain protein [Frankia sp. EUN1f] gi|288348835|gb|EFC83086.1| glycoside hydrolase family 3 domain protein [Frankia sp. EUN1f] Length = 835 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + +GI SPV+DL P + + P A + + F R Sbjct: 154 SARMRAAGIQHALSPVMDLARDPR--WGRVHETYGEDPELAAQFSVAFVRGIQ 204 >gi|313822031|gb|EFS59745.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL036PA1] gi|315087016|gb|EFT58992.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL002PA3] Length = 344 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|310814788|ref|YP_003962752.1| putative beta-N-acetylhexosaminidase protein [Ketogulonicigenium vulgare Y25] gi|308753523|gb|ADO41452.1| putative beta-N-acetylhexosaminidase protein [Ketogulonicigenium vulgare Y25] Length = 340 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M L +N +PV+DL + + P ++ +++ Sbjct: 112 MGSMLSDLSMNSGAAPVIDLSRSYTHGVMG-NRLLDSDPDVVAALGRVIVDAFLE 165 >gi|302872724|ref|YP_003841360.1| glycoside hydrolase family 3 domain protein [Caldicellulosiruptor obsidiansis OB47] gi|302575583|gb|ADL43374.1| glycoside hydrolase family 3 domain protein [Caldicellulosiruptor obsidiansis OB47] Length = 771 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 6/54 (11%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G + +P++D+ + F P A + Sbjct: 128 IGLQMKAVGAHQALAPLIDVARDAR--WGRVEETFGEDPYLVANMAVSYVEGIQ 179 >gi|163755165|ref|ZP_02162285.1| b-glycosidase, glycoside hydrolase family 3 protein [Kordia algicida OT-1] gi|161324585|gb|EDP95914.1| b-glycosidase, glycoside hydrolase family 3 protein [Kordia algicida OT-1] Length = 927 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI+VNF+P + + F E F + K Sbjct: 106 IGEQSKRLGIHVNFAPNTAVHSFKTSVAG--NRSFGESENNVTEKTLAFHKGMQK 158 >gi|313813522|gb|EFS51236.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL025PA1] Length = 344 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|313816645|gb|EFS54359.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL059PA1] Length = 344 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|260172897|ref|ZP_05759309.1| glycoside hydrolase family 3 protein [Bacteroides sp. D2] gi|315921180|ref|ZP_07917420.1| conserved hypothetical protein [Bacteroides sp. D2] gi|313695055|gb|EFS31890.1| conserved hypothetical protein [Bacteroides sp. D2] Length = 770 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + SG++ F+P +++ + F P + R + Sbjct: 172 AIEMRASGMHWTFTPNVEVARDAR--WGRVGETFGEDPYLVGQMGAATVRGFQ 222 >gi|255693560|ref|ZP_05417235.1| periplasmic beta-glucosidase [Bacteroides finegoldii DSM 17565] gi|260620625|gb|EEX43496.1| periplasmic beta-glucosidase [Bacteroides finegoldii DSM 17565] Length = 770 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + SG++ F+P +++ + F P + R + Sbjct: 172 AIEMRASGMHWTFTPNVEVARDAR--WGRVGETFGEDPYLVGQMGAATVRGFQ 222 >gi|282854761|ref|ZP_06264096.1| glycosyl hydrolase family 3 N-terminal domain protein [Propionibacterium acnes J139] gi|282582343|gb|EFB87725.1| glycosyl hydrolase family 3 N-terminal domain protein [Propionibacterium acnes J139] Length = 412 Score = 43.2 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 188 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 245 >gi|12003433|gb|AAG43575.1|AF213463_1 cellobiase CelA precursor [Azospirillum irakense] Length = 685 Score = 43.2 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI+ F+P L ++ + FS P + Sbjct: 180 AVEMAATGIDWTFAPALSVVRDDR--WGRTYEGFSEDPEIVAAYSAAIVEGVQ 230 >gi|328886781|emb|CCA60020.1| Beta-glucosidase [Streptomyces venezuelae ATCC 10712] Length = 739 Score = 43.2 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + G++ +PVLD++ + P + + Sbjct: 146 IGAGMRRVGVHQGLAPVLDVVRDYR--WGRTEECIGEDPYLVGAIGTAYVQGL 196 >gi|325569353|ref|ZP_08145509.1| beta-N-acetylhexosaminidase [Enterococcus casseliflavus ATCC 12755] gi|325157353|gb|EGC69514.1| beta-N-acetylhexosaminidase [Enterococcus casseliflavus ATCC 12755] Length = 424 Score = 43.2 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ L GIN PV D+ P++FI + K+ Sbjct: 211 AEILKAYGINAGLFPVADVSTDPQSFI--YDRTIGMDAQGTSAFVERVVHVLQKH 263 >gi|257865550|ref|ZP_05645203.1| beta-hexosaminidase [Enterococcus casseliflavus EC30] gi|257871887|ref|ZP_05651540.1| beta-hexosaminidase [Enterococcus casseliflavus EC10] gi|257799484|gb|EEV28536.1| beta-hexosaminidase [Enterococcus casseliflavus EC30] gi|257806051|gb|EEV34873.1| beta-hexosaminidase [Enterococcus casseliflavus EC10] Length = 408 Score = 43.2 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ L GIN PV D+ P++FI + K+ Sbjct: 195 AEILKAYGINAGLFPVADVSTDPQSFI--YDRTIGMDAQGTSAFVERVVHVLQKH 247 >gi|229818089|ref|ZP_04448371.1| hypothetical protein BIFANG_03380 [Bifidobacterium angulatum DSM 20098] gi|229784693|gb|EEP20807.1| hypothetical protein BIFANG_03380 [Bifidobacterium angulatum DSM 20098] Length = 775 Score = 43.2 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + T+G++ FSPVL + + F P E A + Y Sbjct: 124 AEEVSTTGVHWTFSPVLCIARDTR--WGRVDETFGEDPYLIGEMASAIVKGYQ 174 >gi|189467304|ref|ZP_03016089.1| hypothetical protein BACINT_03692 [Bacteroides intestinalis DSM 17393] gi|189435568|gb|EDV04553.1| hypothetical protein BACINT_03692 [Bacteroides intestinalis DSM 17393] Length = 859 Score = 43.2 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 ++ L GI P +D++ + + P A R Y+ N Sbjct: 159 ISAELHYQGIRQVLGPCIDVVRDMR--WGRVEESYGEDPFLNAILACEEVRGYLDN 212 >gi|154489063|ref|ZP_02029912.1| hypothetical protein BIFADO_02373 [Bifidobacterium adolescentis L2-32] gi|154083200|gb|EDN82245.1| hypothetical protein BIFADO_02373 [Bifidobacterium adolescentis L2-32] Length = 776 Score = 43.2 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + T+G++ FSPVL + + F P E A + Y Sbjct: 125 AEEVSTTGVHWTFSPVLCIARDTR--WGRVDETFGEDPYLIGEMASAIVKGYQ 175 >gi|328758192|gb|EGF71808.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL025PA2] Length = 344 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|326389315|ref|ZP_08210883.1| glycoside hydrolase family 3 domain protein [Thermoanaerobacter ethanolicus JW 200] gi|325994678|gb|EGD53102.1| glycoside hydrolase family 3 domain protein [Thermoanaerobacter ethanolicus JW 200] Length = 784 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G +P+LD+ P + F P + R Sbjct: 137 IREQMKAVGARQALAPLLDITRDPR--WGRTEETFGEDPYLVMRMGVSYIRGLQ 188 >gi|7259476|gb|AAF43783.1|AF135015_2 xylosidase/arabinosidase [Thermoanaerobacter ethanolicus JW 200] Length = 784 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G +P+LD+ P + F P + R Sbjct: 137 IREQMKAVGARQALAPLLDITRDPR--WGRTEETFGEDPYLVMRMGVSYIRGLQ 188 >gi|83310941|ref|YP_421205.1| Beta-glucosidase-related glycosidase [Magnetospirillum magneticum AMB-1] gi|82945782|dbj|BAE50646.1| Beta-glucosidase-related glycosidase [Magnetospirillum magneticum AMB-1] Length = 401 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Query: 4 NLVTSGINVNFSPVLDLLY-GPET----FIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L G+ VNF+PV D+ GP R S P + A +S + Sbjct: 205 ELARLGVTVNFAPVADIRREGPRNRLDFHSLIARRAISHDPEIVGQIATAYSTGLL 260 >gi|167038437|ref|YP_001666015.1| glycoside hydrolase family 3 protein [Thermoanaerobacter pseudethanolicus ATCC 33223] gi|320116830|ref|YP_004186989.1| glycoside hydrolase family 3 domain-containing protein [Thermoanaerobacter brockii subsp. finnii Ako-1] gi|166857271|gb|ABY95679.1| glycoside hydrolase, family 3 domain protein [Thermoanaerobacter pseudethanolicus ATCC 33223] gi|319929921|gb|ADV80606.1| glycoside hydrolase family 3 domain protein [Thermoanaerobacter brockii subsp. finnii Ako-1] Length = 784 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G +P+LD+ P + F P + R Sbjct: 137 IREQMKAVGARQALAPLLDITRDPR--WGRTEETFGEDPYLVMRMGVSYIRGLQ 188 >gi|1749831|emb|CAA91219.1| beta-xylo-glucosidase [Thermoanaerobacter brockii] Length = 730 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G +P+LD+ P + F P + R Sbjct: 83 IREQMKAVGARQALAPLLDITRDPR--WGRTEETFGEDPYLVMRMGVSYIRGLQ 134 >gi|157363220|ref|YP_001469987.1| glycoside hydrolase family 3 protein [Thermotoga lettingae TMO] gi|157313824|gb|ABV32923.1| glycoside hydrolase family 3 domain protein [Thermotoga lettingae TMO] Length = 779 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ GI+ +PVLD++ P + F + + Sbjct: 140 IREDMRQMGIHQGLAPVLDVVRDPR--WGRTEESFGESAYLVAKMGVSYIIGLQ 191 >gi|163849391|ref|YP_001637435.1| glycoside hydrolase family 3 protein [Chloroflexus aurantiacus J-10-fl] gi|222527388|ref|YP_002571859.1| glycoside hydrolase family 3 domain-containing protein [Chloroflexus sp. Y-400-fl] gi|163670680|gb|ABY37046.1| glycoside hydrolase family 3 domain protein [Chloroflexus aurantiacus J-10-fl] gi|222451267|gb|ACM55533.1| glycoside hydrolase family 3 domain protein [Chloroflexus sp. Y-400-fl] Length = 702 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ GI F+P+LD+ + + P A R + Sbjct: 120 AREASALGIRWTFAPMLDIARDAR--WGRIAEGYGEDPLLTSRMAAAAVRGFQ 170 >gi|219683504|ref|YP_002469887.1| B-hexosaminidase [Bifidobacterium animalis subsp. lactis AD011] gi|219621154|gb|ACL29311.1| possible B-hexosaminidase [Bifidobacterium animalis subsp. lactis AD011] Length = 419 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Query: 5 LVTSGINVNFSPVLD---LLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L SG+ +N +P +D + I F + E A F Sbjct: 198 LKRSGLAMNLAPSVDTVTIERAVNEPIGALYRDFGLDAQRNGEHAAAFIEGMR 250 >gi|117929257|ref|YP_873808.1| glycoside hydrolase family 3 protein [Acidothermus cellulolyticus 11B] gi|117649720|gb|ABK53822.1| glycoside hydrolase, family 3 domain protein [Acidothermus cellulolyticus 11B] Length = 817 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + G++ +PVLD++ + P + + Sbjct: 160 IGTAMRRMGVHQGLAPVLDVVRDYR--WGRVEETIGEDPYLVGTIGSAYVKGL 210 >gi|94312923|ref|YP_586132.1| beta-D-glucoside glucohydrolase, periplasmic [Cupriavidus metallidurans CH34] gi|93356775|gb|ABF10863.1| beta-D-glucoside glucohydrolase, periplasmic [Cupriavidus metallidurans CH34] Length = 774 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ F+P++D+ P + F P + A+ + + Sbjct: 149 AVEAAADGIDATFAPMVDISRDPR--WGRTSEGFGEDPYLVSQCARASVKGFQ 199 >gi|110638668|ref|YP_678877.1| b-glucosidase [Cytophaga hutchinsonii ATCC 33406] gi|110281349|gb|ABG59535.1| candidate b-glucosidase, Glycoside Hydrolase Family 3 protein [Cytophaga hutchinsonii ATCC 33406] Length = 820 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A G+ NF PVLDL P + F P E+ Y + Sbjct: 177 ALEARACGLRWNFDPVLDLGRNPLWP--RFPETFGEDPYLVEQMGVAAISKYEE 228 >gi|303229815|ref|ZP_07316595.1| glycosyl hydrolase family 3 N-terminal domain protein [Veillonella atypica ACS-134-V-Col7a] gi|302515575|gb|EFL57537.1| glycosyl hydrolase family 3 N-terminal domain protein [Veillonella atypica ACS-134-V-Col7a] Length = 382 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 19/54 (35%), Gaps = 7/54 (12%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G N+NF+P DL +S P + + A + Y + Sbjct: 166 GTELKDLGFNINFAPDADLGL-------TYGRSYSTNPDQVVKFAGAVGKAYDE 212 >gi|15899739|ref|NP_344344.1| Beta-xylosidase [Sulfolobus solfataricus P2] gi|13816430|gb|AAK43134.1| Beta-xylosidase [Sulfolobus solfataricus P2] Length = 754 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G+N SPVLD+ P + + P + Sbjct: 126 IRSQGRLIGVNQCLSPVLDVCRDPR--WGRCEETYGEDPYLVASMGLAYITGLQ 177 >gi|315095013|gb|EFT66989.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL060PA1] gi|327328209|gb|EGE69978.1| putative beta-hexosaminidase [Propionibacterium acnes HL103PA1] Length = 344 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|314923755|gb|EFS87586.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL001PA1] Length = 344 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|284174578|ref|ZP_06388547.1| Beta-xylosidase [Sulfolobus solfataricus 98/2] Length = 754 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G+N SPVLD+ P + + P + Sbjct: 126 IRSQGRLIGVNQCLSPVLDVCRDPR--WGRCEETYGEDPYLVASMGLAYITGLQ 177 >gi|111114824|ref|YP_709442.1| hypothetical protein BAPKO_0001 [Borrelia afzelii PKo] gi|110890098|gb|ABH01266.1| hypothetical protein BAPKO_0001 [Borrelia afzelii PKo] Length = 339 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSR-IPAKAEESAQLFSRTYIKN 56 +AK L GIN+N +PV D+ + P T F + F + Sbjct: 165 LAKQLRRLGINLNMAPVADIKFVPHTP--LLNRTFGGYSAYNIGLMVEAFIDGMQNH 219 >gi|315104350|gb|EFT76326.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL050PA2] Length = 344 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|217968103|ref|YP_002353609.1| glycoside hydrolase family 3 domain protein [Dictyoglomus turgidum DSM 6724] gi|217337202|gb|ACK42995.1| glycoside hydrolase family 3 domain protein [Dictyoglomus turgidum DSM 6724] Length = 756 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K + GI+ SP +++ P + + P A A + + + Sbjct: 173 IGKETRSRGIHQVLSPTINIARDPRC--GRTEETYGEDPYLASRMAVAYIKGVQE 225 >gi|206901921|ref|YP_002251428.1| xylosidase/arabinosidase [Dictyoglomus thermophilum H-6-12] gi|206741024|gb|ACI20082.1| xylosidase/arabinosidase [Dictyoglomus thermophilum H-6-12] Length = 756 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K + GI+ SP +++ P + + P A A + + + Sbjct: 173 IGKETRSRGIHQVLSPTINIARDPRC--GRTEETYGEDPYLASRMAVAYIKGVQE 225 >gi|170782085|ref|YP_001710418.1| putative glycosyl hydrolase [Clavibacter michiganensis subsp. sepedonicus] gi|169156654|emb|CAQ01809.1| putative glycosyl hydrolase [Clavibacter michiganensis subsp. sepedonicus] Length = 912 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + GI SP+ D+ P + + P A F Sbjct: 172 IGLQMSRMGIRQALSPLADVARDPR--WGRVEETYGEEPYLVGTMASAFVDGLQ 223 >gi|312794525|ref|YP_004027448.1| glycoside hydrolase family 3 domain-containing protein [Caldicellulosiruptor kristjanssonii 177R1B] gi|312181665|gb|ADQ41835.1| glycoside hydrolase family 3 domain protein [Caldicellulosiruptor kristjanssonii 177R1B] Length = 770 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 6/54 (11%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G + +P++D+ + F P A + + Sbjct: 128 IRTQMKAVGAHQALAPLIDVARDAR--WGRVEETFGEDPYLVANMAVSYVKGLQ 179 >gi|146295632|ref|YP_001179403.1| glycoside hydrolase family 3 protein [Caldicellulosiruptor saccharolyticus DSM 8903] gi|145409208|gb|ABP66212.1| glycoside hydrolase, family 3 domain protein [Caldicellulosiruptor saccharolyticus DSM 8903] Length = 770 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 6/54 (11%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G + +P++D+ + F P A + + Sbjct: 128 IRTQMKAVGAHQALAPLIDVARDAR--WGRVEETFGEDPYLVANMAVSYVKGLQ 179 >gi|302684753|ref|XP_003032057.1| glycoside hydrolase family 3 protein [Schizophyllum commune H4-8] gi|300105750|gb|EFI97154.1| glycoside hydrolase family 3 protein [Schizophyllum commune H4-8] Length = 806 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A GIN F+PVLDL + F P E F Sbjct: 183 IADESEPLGINHIFAPVLDLARELR--WGRVEEGFGEDPFLTGELGAAFVEGLQ 234 >gi|58176836|pdb|1TR9|A Chain A, Structure Of Beta-Hexosaminidase From Vibrio Cholerae Length = 341 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A L+ ++++F+PVLD + + F + + F R Sbjct: 103 AAELIAHDVDLSFAPVLDXGFACKAI---GNRAFGEDVQTVLKHSSAFLRGXK 152 >gi|323139506|ref|ZP_08074553.1| glycoside hydrolase family 3 domain protein [Methylocystis sp. ATCC 49242] gi|322395241|gb|EFX97795.1| glycoside hydrolase family 3 domain protein [Methylocystis sp. ATCC 49242] Length = 366 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ GI++ F+P+LD+ P + P A A+ R + Sbjct: 113 AEEAAIDGIDLTFAPMLDVARDPR--WGRIAESPGEDPLVAARFAEAKIRGFQ 163 >gi|290475842|ref|YP_003468734.1| beta N-acetyl-glucosaminidase [Xenorhabdus bovienii SS-2004] gi|289175167|emb|CBJ81970.1| beta N-acetyl-glucosaminidase [Xenorhabdus bovienii SS-2004] Length = 339 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLDL + F A A+ F + Sbjct: 104 MASEMIAMDIDISFAPVLDLGHQCTAI---GERSFHGELELAVMMAEKFIKGMH 154 >gi|314982034|gb|EFT26127.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL110PA3] gi|315090799|gb|EFT62775.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL110PA4] Length = 344 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|315038019|ref|YP_004031587.1| beta-N-acetylhexosaminidase [Lactobacillus amylovorus GRL 1112] gi|325956472|ref|YP_004291884.1| beta-N-acetylhexosaminidase [Lactobacillus acidophilus 30SC] gi|312276152|gb|ADQ58792.1| Beta-N-acetylhexosaminidase [Lactobacillus amylovorus GRL 1112] gi|325333037|gb|ADZ06945.1| beta-N-acetylhexosaminidase [Lactobacillus acidophilus 30SC] gi|327183299|gb|AEA31746.1| beta-N-acetylhexosaminidase [Lactobacillus amylovorus GRL 1118] Length = 380 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEES 45 AK L +GIN+NF+PV D+ +FI + + Sbjct: 164 AKILHQNGINMNFAPVADVAKDKNSFI--YDRTLGQDYETTAKY 205 >gi|256831448|ref|YP_003160175.1| glycoside hydrolase family 3 domain-containing protein [Jonesia denitrificans DSM 20603] gi|256684979|gb|ACV07872.1| glycoside hydrolase family 3 domain protein [Jonesia denitrificans DSM 20603] Length = 749 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +GI+ FSPVL + + F P E A R Y Sbjct: 121 AVEASATGIHWTFSPVLCIARDLR--WGRVNETFGEDPHLIGELASAMVRGYQ 171 >gi|103486628|ref|YP_616189.1| Beta-N-acetylhexosaminidase [Sphingopyxis alaskensis RB2256] gi|98976705|gb|ABF52856.1| Beta-N-acetylhexosaminidase [Sphingopyxis alaskensis RB2256] Length = 335 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 7/48 (14%), Positives = 14/48 (29%), Gaps = 1/48 (2%) Query: 7 TSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 GI V+ P+LD+ + + P + + Sbjct: 114 EVGITVDCLPLLDVRQPGASDVIG-DRALGSEPMRVAALGRAILSGLQ 160 >gi|319899198|ref|YP_004159291.1| Glycoside hydrolase, family 3-like [Bartonella clarridgeiae 73] gi|319403162|emb|CBI76721.1| Glycoside hydrolase, family 3-like [Bartonella clarridgeiae 73] Length = 343 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKA 42 A +L+ GIN N PVLD+ + +S+ P Sbjct: 112 AFDLMRYGINANCLPVLDVPVAGAHDVIGM-RAYSQDPKVV 151 >gi|209809362|ref|YP_002264900.1| beta-hexosaminidase [Aliivibrio salmonicida LFI1238] gi|208010924|emb|CAQ81329.1| beta-hexosaminidase (beta-N-acetylhexosaminidase) [Aliivibrio salmonicida LFI1238] Length = 331 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + LV I++ F+PVLD + + F + + F + Sbjct: 101 LCAELVAHDIDLTFAPVLDSGFDCKAI---GNRAFGDDINTIVKYSTAFMQGMK 151 >gi|290770115|gb|ADD61876.1| putative carbohydrate-active enzyme [uncultured organism] Length = 834 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+ FSP +D+ P + P A + + + Sbjct: 222 AYETRACGVRWLFSPSMDICRKPSWP--RLYESMGEDPYAASVMGEAYLKGLQ 272 >gi|239995361|ref|ZP_04715885.1| glucan 1,4-beta-glucosidase [Alteromonas macleodii ATCC 27126] Length = 850 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +GI+ F+P + ++ + +S PA E A + Sbjct: 183 AKEVMATGIDWVFAPTVAVVRDDR--WGRTYESYSEDPAIVREYAASVVKGLQ 233 >gi|256392767|ref|YP_003114331.1| glycoside hydrolase family 3 domain-containing protein [Catenulispora acidiphila DSM 44928] gi|256358993|gb|ACU72490.1| glycoside hydrolase family 3 domain protein [Catenulispora acidiphila DSM 44928] Length = 811 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + G++ +PVLD+ + + P + + Sbjct: 152 IGTTMRRLGVHQGLAPVLDVARDLR--WGRVEETIAEDPYLVGTLGAAYVQGL 202 >gi|216263865|ref|ZP_03435859.1| glycosyl hydrolase family 3 N domain protein [Borrelia afzelii ACA-1] gi|215979909|gb|EEC20731.1| glycosyl hydrolase family 3 N domain protein [Borrelia afzelii ACA-1] Length = 339 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSR-IPAKAEESAQLFSRTYIKN 56 +AK L GIN+N +PV D+ + P T F + F + Sbjct: 165 LAKQLRRLGINLNMAPVADIKFVPHTP--LLNRTFGGYSAYNIGLMVEAFIDGMQNH 219 >gi|329849024|ref|ZP_08264052.1| 1,4-B-D-glucan glucohydrolase [Asticcacaulis biprosthecum C19] gi|328844087|gb|EGF93656.1| 1,4-B-D-glucan glucohydrolase [Asticcacaulis biprosthecum C19] Length = 635 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 K + +G+N F+P L ++ + FS P + A+ + N Sbjct: 161 GKAVRATGVNWAFAPTLAVVEDGR--WGRTYEGFSSDPQLIHDYARAYVDGMQGN 213 >gi|302562173|ref|ZP_07314515.1| LOW QUALITY PROTEIN: beta-D-xylosidase [Streptomyces griseoflavus Tu4000] gi|302479791|gb|EFL42884.1| LOW QUALITY PROTEIN: beta-D-xylosidase [Streptomyces griseoflavus Tu4000] Length = 708 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 7/52 (13%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A ++ + G++ +PVLD++ + P + + Sbjct: 76 AAHMRSVGVHQGLAPVLDVVRDAR--WGRVEETIGEDPYLVGTIGTAYVQGL 125 >gi|324962840|gb|ADY62498.1| beta-D-glucosidase [Bifidobacterium longum] Length = 787 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ FSPVL + + F P E A + Y Sbjct: 132 AEEVSCTGVHWTFSPVLCIARDTR--WGRVDETFGEDPMLIGELASAMVKGYQ 182 >gi|319404552|emb|CBI78158.1| Glycoside hydrolase, family 3-like [Bartonella rochalimae ATCC BAA-1498] Length = 344 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 15/77 (19%), Positives = 25/77 (32%), Gaps = 24/77 (31%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEE----------------- 44 A +L+ GIN N PVLD+ + +S+ P Sbjct: 113 AFDLMKYGINANCLPVLDVPVVGAHDVIGT-RAYSQDPQVVAALGGAAAQGLLDGGVLPV 171 Query: 45 ------SAQLFSRTYIK 55 + FS T+++ Sbjct: 172 IKHIPGHGRAFSDTHLE 188 >gi|317482893|ref|ZP_07941900.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bifidobacterium sp. 12_1_47BFAA] gi|316915667|gb|EFV37082.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bifidobacterium sp. 12_1_47BFAA] Length = 787 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ FSPVL + + F P E A + Y Sbjct: 132 AEEVSCTGVHWTFSPVLCIARDTR--WGRVDETFGEDPMLIGELASAMVKGYQ 182 >gi|296454670|ref|YP_003661813.1| beta-glucosidase [Bifidobacterium longum subsp. longum JDM301] gi|296184101|gb|ADH00983.1| Beta-glucosidase [Bifidobacterium longum subsp. longum JDM301] Length = 787 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ FSPVL + + F P E A + Y Sbjct: 132 AEEVSCTGVHWTFSPVLCIARDTR--WGRVDETFGEDPMLIGELASAMVKGYQ 182 >gi|291457380|ref|ZP_06596770.1| beta-glucosidase [Bifidobacterium breve DSM 20213] gi|291381215|gb|EFE88733.1| beta-glucosidase [Bifidobacterium breve DSM 20213] Length = 787 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ FSPVL + + F P E A + Y Sbjct: 132 AEEVSCTGVHWTFSPVLCIARDTR--WGRVDETFGEDPMLIGELASAMVKGYQ 182 >gi|23466301|ref|NP_696904.1| hypothetical protein BL1757 [Bifidobacterium longum NCC2705] gi|227546657|ref|ZP_03976706.1| possible beta-glucosidase [Bifidobacterium longum subsp. infantis ATCC 55813] gi|239621691|ref|ZP_04664722.1| beta-D-glucosideglucohydrolase [Bifidobacterium longum subsp. infantis CCUG 52486] gi|23327054|gb|AAN25540.1| BglX [Bifidobacterium longum NCC2705] gi|227212974|gb|EEI80853.1| possible beta-glucosidase [Bifidobacterium longum subsp. infantis ATCC 55813] gi|239515566|gb|EEQ55433.1| beta-D-glucosideglucohydrolase [Bifidobacterium longum subsp. infantis CCUG 52486] gi|291516286|emb|CBK69902.1| Beta-glucosidase-related glycosidases [Bifidobacterium longum subsp. longum F8] Length = 787 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ FSPVL + + F P E A + Y Sbjct: 132 AEEVSCTGVHWTFSPVLCIARDTR--WGRVDETFGEDPMLIGELASAMVKGYQ 182 >gi|46190967|ref|ZP_00206627.1| COG1472: Beta-glucosidase-related glycosidases [Bifidobacterium longum DJO10A] Length = 321 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ FSPVL + + F P E A + Y Sbjct: 99 AEEVSCTGVHWTFSPVLCIARDTR--WGRVDETFGEDPMLIGELASAMVKGYQ 149 >gi|322689743|ref|YP_004209477.1| beta-glucosidase [Bifidobacterium longum subsp. infantis 157F] gi|320461079|dbj|BAJ71699.1| putative beta-glucosidase [Bifidobacterium longum subsp. infantis 157F] Length = 787 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ FSPVL + + F P E A + Y Sbjct: 132 AEEVSCTGVHWTFSPVLCIARDTR--WGRVDETFGEDPMLIGELASAMVKGYQ 182 >gi|189440796|ref|YP_001955877.1| beta-glucosidase-like glycosidase [Bifidobacterium longum DJO10A] gi|189429231|gb|ACD99379.1| Beta-glucosidase-related glycosidase [Bifidobacterium longum DJO10A] Length = 787 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ FSPVL + + F P E A + Y Sbjct: 132 AEEVSCTGVHWTFSPVLCIARDTR--WGRVDETFGEDPMLIGELASAMVKGYQ 182 >gi|219685967|ref|ZP_03540759.1| putative beta-N-acetylhexosaminidase [Borrelia garinii Far04] gi|219672492|gb|EED29539.1| putative beta-N-acetylhexosaminidase [Borrelia garinii Far04] Length = 339 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSR-IPAKAEESAQLFSRTYIKN 56 +AK L GIN+N +PV D+ + P T F + F + Sbjct: 165 LAKQLRRLGINLNMAPVADIKFIPHTP--LLNRTFGGYSAYNIGLMVEAFIDGMQNH 219 >gi|329957815|ref|ZP_08298290.1| glycosyl hydrolase family 3 protein [Bacteroides clarus YIT 12056] gi|328522692|gb|EGF49801.1| glycosyl hydrolase family 3 protein [Bacteroides clarus YIT 12056] Length = 749 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI F+P++D+ P + P + + Sbjct: 137 AVEASADGIRWTFAPMIDISRDPR--WGRIAESCGEDPYLTSVMGTAMIKGFQ 187 >gi|119774541|ref|YP_927281.1| beta-glucosidase [Shewanella amazonensis SB2B] gi|119767041|gb|ABL99611.1| beta-glucosidase [Shewanella amazonensis SB2B] Length = 859 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +GI+ F+P + L+ + ++R P E A+ F Sbjct: 180 EVRATGIDWVFAPTVALVDNLR--WGRTYEGYARDPELIERYAEAFVDGMQ 228 >gi|323340353|ref|ZP_08080612.1| beta-N-acetylhexosaminidase [Lactobacillus ruminis ATCC 25644] gi|323092242|gb|EFZ34855.1| beta-N-acetylhexosaminidase [Lactobacillus ruminis ATCC 25644] Length = 359 Score = 42.8 bits (100), Expect = 0.013, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEES-AQLFSRTYIKN 56 AK L + G N N +PV D+ +FI + A+ +N Sbjct: 150 AKILHSLGFNWNLAPVADISQNQNSFI--YDRTLGQNTKTTAAYVAKTVCAIQKQN 203 >gi|198277570|ref|ZP_03210101.1| hypothetical protein BACPLE_03792 [Bacteroides plebeius DSM 17135] gi|198270068|gb|EDY94338.1| hypothetical protein BACPLE_03792 [Bacteroides plebeius DSM 17135] Length = 753 Score = 42.8 bits (100), Expect = 0.013, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI F+P++D+ P + P + Y Sbjct: 141 AIEASADGIRWTFAPMIDVSRDPR--WGRIAESCGEDPYLNAVIGTAMIKGYQ 191 >gi|299136776|ref|ZP_07029959.1| glycoside hydrolase family 3 domain protein [Acidobacterium sp. MP5ACTX8] gi|298601291|gb|EFI57446.1| glycoside hydrolase family 3 domain protein [Acidobacterium sp. MP5ACTX8] Length = 773 Score = 42.8 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A +G+ + +PVLDL P + F P + + R Sbjct: 183 IAAEARATGVGMILAPVLDLARDPR--WGRIEEDFGEDPYLTGQMGLAYVRGAQ 234 >gi|221134658|ref|ZP_03560961.1| beta-hexosaminidase [Glaciecola sp. HTCC2999] Length = 349 Score = 42.8 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G++++F+PVLD+ I FS P+ A F Sbjct: 103 IATECIGHGVDISFAPVLDIN-AISDVIGT--RSFSNAPSTILSLATEFIHGLK 153 >gi|183601449|ref|ZP_02962819.1| possible B-hexosaminidase [Bifidobacterium animalis subsp. lactis HN019] gi|241191051|ref|YP_002968445.1| B-hexosaminidase [Bifidobacterium animalis subsp. lactis Bl-04] gi|241196457|ref|YP_002970012.1| B-hexosaminidase [Bifidobacterium animalis subsp. lactis DSM 10140] gi|183219055|gb|EDT89696.1| possible B-hexosaminidase [Bifidobacterium animalis subsp. lactis HN019] gi|240249443|gb|ACS46383.1| B-hexosaminidase [Bifidobacterium animalis subsp. lactis Bl-04] gi|240251011|gb|ACS47950.1| B-hexosaminidase [Bifidobacterium animalis subsp. lactis DSM 10140] gi|295794040|gb|ADG33575.1| B-hexosaminidase [Bifidobacterium animalis subsp. lactis V9] Length = 479 Score = 42.8 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Query: 5 LVTSGINVNFSPVLD---LLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L SG+ +N +P +D + I F + E A F Sbjct: 258 LKRSGLAMNLAPSVDTVTIERAVNEPIGALYRDFGLDAQRNGEHAAAFIEGMR 310 >gi|71282619|ref|YP_269083.1| xylosidase/arabinosidase [Colwellia psychrerythraea 34H] gi|71148359|gb|AAZ28832.1| xylosidase/arabinosidase [Colwellia psychrerythraea 34H] Length = 759 Score = 42.8 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K L +G+ NF PVLDL P ++ + + + Y + Sbjct: 165 GKELRATGVRWNFDPVLDLGVNP--IWSRFSETYGEDTYLTTQMGVGVIQAYEE 216 >gi|323475656|gb|ADX86262.1| glycoside hydrolase family 3 domain protein [Sulfolobus islandicus REY15A] Length = 754 Score = 42.8 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 16/57 (28%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 + G+N SPVLD+ P + + P + N Sbjct: 126 IRSQARLVGVNQCLSPVLDVCKDPR--WGRCEETYGEDPYLVASMGLAYITGLQGDN 180 >gi|224533262|ref|ZP_03673857.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi CA-11.2a] gi|224513585|gb|EEF83941.1| glycosyl hydrolase family 3 N domain protein [Borrelia burgdorferi CA-11.2a] Length = 221 Score = 42.8 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSR-IPAKAEESAQLFSRTYIK 55 +AK L GIN+N +PV D+ + P T F + F Sbjct: 168 LAKQLRRLGINLNMAPVADIKFAPHTP--LLNRTFGGYSAYNIGLMVEAFIDGMQN 221 >gi|145652280|gb|ABP88199.1| putative beta-N-acetylhexoseaminidase [Borrelia lonestari] Length = 346 Score = 42.8 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L GIN+N +PV D + + F + F K Sbjct: 164 LGKQLRRLGINLNMAPVADAKLDNGSPLGS--RTFGSSYYNIGLMVEAFIDGIQK 216 >gi|225156248|ref|ZP_03724726.1| beta-N-acetylhexosaminidase [Opitutaceae bacterium TAV2] gi|224802980|gb|EEG21225.1| beta-N-acetylhexosaminidase [Opitutaceae bacterium TAV2] Length = 558 Score = 42.8 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + GIN+ +P+ D+ + F PA A R Y Sbjct: 144 GRQMRAIGINLVQAPITDVFSYEGRTTMKAA-SFGEDPALVTRHALAMMRGYH 195 >gi|327393943|dbj|BAK11365.1| periplasmic beta-glucosidase precursor BglX [Pantoea ananatis AJ13355] Length = 537 Score = 42.8 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 14/54 (25%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G +PVLD+ + F P A + Sbjct: 150 IGTEARSVGCKQGLAPVLDVSRDVR--WGRTEETFGEDPWLVGVMATAYVEGLQ 201 >gi|291617506|ref|YP_003520248.1| BglX [Pantoea ananatis LMG 20103] gi|291152536|gb|ADD77120.1| BglX [Pantoea ananatis LMG 20103] Length = 791 Score = 42.8 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 14/54 (25%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G +PVLD+ + F P A + Sbjct: 150 IGTEARSVGCKQGLAPVLDVSRDVR--WGRTEETFGEDPWLVGVMATAYVEGLQ 201 >gi|148271275|ref|YP_001220836.1| glycosyl hydrolase family beta-glucosidase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] gi|147829205|emb|CAN00117.1| putative beta-glucosidase, glycosyl hydrolase family 3 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] Length = 874 Score = 42.8 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+ SP+ D+ P + + P A F R Sbjct: 130 IGVQMARLGVRQALSPLADVSRDPR--WGRVEETYGEEPYLVGSMATAFVRGLQ 181 >gi|313124297|ref|YP_004034556.1| glycoside hydrolase family protein [Lactobacillus delbrueckii subsp. bulgaricus ND02] gi|312280860|gb|ADQ61579.1| Glycoside hydrolase family protein [Lactobacillus delbrueckii subsp. bulgaricus ND02] Length = 315 Score = 42.8 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L GIN+NF+PV DL P +FI + + F + Y + Sbjct: 109 ALKLKDLGINLNFAPVADLALDPASFI--YSRTLQAGAEETGPAIAAFIKLYRQ 160 >gi|254787938|ref|YP_003075367.1| 1,4-B-D-glycosidase [Teredinibacter turnerae T7901] gi|237685830|gb|ACR13094.1| 1,4-B-D-glycosidase [Teredinibacter turnerae T7901] Length = 851 Score = 42.8 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 8/46 (17%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 GI+ F+P + ++ + FS P A+ + Sbjct: 191 GIDWVFAPTVAVVRDDR--WGRTYEGFSEDPQLVTAYAKAYVNGMQ 234 >gi|312885398|ref|ZP_07745039.1| glycoside hydrolase family 3 domain protein [Mucilaginibacter paludis DSM 18603] gi|311302096|gb|EFQ79124.1| glycoside hydrolase family 3 domain protein [Mucilaginibacter paludis DSM 18603] Length = 823 Score = 42.8 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 6/55 (10%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G ++P+LD+ + ++ P ++ +N Sbjct: 218 GMEARALGYTNVYAPILDVARDQR--WGRLEEVYGEDPYLVARLGVEMAKGMQQN 270 >gi|154248331|ref|YP_001419289.1| Beta-N-acetylhexosaminidase [Xanthobacter autotrophicus Py2] gi|154162416|gb|ABS69632.1| Beta-N-acetylhexosaminidase [Xanthobacter autotrophicus Py2] Length = 337 Score = 42.8 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 10/42 (23%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKA 42 +A +L GI+V+ P DL + I + P Sbjct: 109 IAADLYALGIDVDCLPCADLRHPDGHGIIG-NRAYGTAPEPV 149 >gi|301300944|ref|ZP_07207112.1| conserved hypothetical protein [Lactobacillus salivarius ACS-116-V-Col5a] gi|300851456|gb|EFK79172.1| conserved hypothetical protein [Lactobacillus salivarius ACS-116-V-Col5a] Length = 51 Score = 42.8 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 12/42 (28%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAE 43 A+ L GIN +F+PV D+ P +FI + Sbjct: 12 AEILRNLGINWDFAPVADVSNDPNSFI--YDRTLGQNYQLTA 51 >gi|119476117|ref|ZP_01616469.1| periplasmic beta-glucosidase [marine gamma proteobacterium HTCC2143] gi|119450744|gb|EAW31978.1| periplasmic beta-glucosidase [marine gamma proteobacterium HTCC2143] Length = 748 Score = 42.8 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A T G+N F+P++D+ P + P E R + Sbjct: 126 ALEAATVGVNWTFAPMIDITRDPR--WGRIAESLGEDPYLCGELGAAMVRGFQ 176 >gi|302677594|ref|XP_003028480.1| glycoside hydrolase family 3 protein [Schizophyllum commune H4-8] gi|300102168|gb|EFI93577.1| glycoside hydrolase family 3 protein [Schizophyllum commune H4-8] Length = 951 Score = 42.8 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + K + GI+ +PVLDL P + + + F+ KN Sbjct: 175 IGKEARSVGIHACLAPVLDLGKEPR--WGRTQEAWGEDHVLTSHMGVAFAGGLSKN 228 >gi|51598265|ref|YP_072453.1| beta-N-acetylhexosaminidase, putative [Borrelia garinii PBi] gi|51572836|gb|AAU06861.1| beta-N-acetylhexosaminidase, putative [Borrelia garinii PBi] Length = 339 Score = 42.8 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSR-IPAKAEESAQLFSRTYIKN 56 +AK L GIN+N +PV D+ + P T F + F + Sbjct: 165 LAKQLRRLGINLNMAPVADIKFIPHTP--LLNRTFGGYSAYNIGLMVEAFIDGMQNH 219 >gi|297543748|ref|YP_003676050.1| glycoside hydrolase family 3 domain-containing protein [Thermoanaerobacter mathranii subsp. mathranii str. A3] gi|296841523|gb|ADH60039.1| glycoside hydrolase family 3 domain protein [Thermoanaerobacter mathranii subsp. mathranii str. A3] Length = 787 Score = 42.8 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 10/59 (16%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 + + + G +P+LD+ P + F P + R +N K Sbjct: 139 IREQMKAVGARQALAPLLDVTRDPR--WGRTEETFGEDPYLVMHMGVSYIRGLQTENLK 195 >gi|289577460|ref|YP_003476087.1| glycoside hydrolase [Thermoanaerobacter italicus Ab9] gi|289527173|gb|ADD01525.1| glycoside hydrolase family 3 domain protein [Thermoanaerobacter italicus Ab9] Length = 787 Score = 42.8 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 10/59 (16%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 + + + G +P+LD+ P + F P + R +N K Sbjct: 139 IREQMKAVGARQALAPLLDVTRDPR--WGRTEETFGEDPYLVMHMGVSYIRGLQTENLK 195 >gi|300772731|ref|ZP_07082601.1| beta-glucosidase [Sphingobacterium spiritivorum ATCC 33861] gi|300761034|gb|EFK57860.1| beta-glucosidase [Sphingobacterium spiritivorum ATCC 33861] Length = 747 Score = 42.8 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A GIN FSP++D+ P + P + + A + Y N Sbjct: 127 ATEATADGINWTFSPMVDISRDPR--WGRFSEGNGEDPYLSSKIAVEMVKGYQGN 179 >gi|227538105|ref|ZP_03968154.1| beta-glucosidase [Sphingobacterium spiritivorum ATCC 33300] gi|227242010|gb|EEI92025.1| beta-glucosidase [Sphingobacterium spiritivorum ATCC 33300] Length = 701 Score = 42.8 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A GIN FSP++D+ P + P + + A + Y N Sbjct: 127 ATEATADGINWTFSPMVDISRDPR--WGRFSEGNGEDPYLSSKIAVEMVKGYQGN 179 >gi|328755327|gb|EGF68943.1| glycosyl hydrolase family 3 protein [Propionibacterium acnes HL087PA1] Length = 243 Score = 42.8 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+++ FSPV ++ IA+ F P + + + K Sbjct: 120 ARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRK 177 >gi|59713676|ref|YP_206451.1| beta-hexosaminidase [Vibrio fischeri ES114] gi|59481924|gb|AAW87563.1| beta N-acetyl-glucosaminidase [Vibrio fischeri ES114] Length = 331 Score = 42.8 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + LV I++ F+PVLD + + F + + F + Sbjct: 101 LCAELVAHDIDLTFAPVLDNGFDCKAI---GNRAFGDDINTIVKYSTAFMQGMK 151 >gi|260909849|ref|ZP_05916541.1| xylosidase/arabinosidase [Prevotella sp. oral taxon 472 str. F0295] gi|260636080|gb|EEX54078.1| xylosidase/arabinosidase [Prevotella sp. oral taxon 472 str. F0295] Length = 770 Score = 42.8 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ + ++ NF+P +++ + F P + ++ Y +N Sbjct: 170 AEEMRAMNMHWNFNPNVEVARDGR--WGRCGETFGEGPYLVTQMGVATNKGYQRN 222 >gi|224532145|ref|ZP_03672777.1| glycosyl hydrolase family 3 N domain protein [Borrelia valaisiana VS116] gi|224511610|gb|EEF82016.1| glycosyl hydrolase family 3 N domain protein [Borrelia valaisiana VS116] Length = 343 Score = 42.8 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSR-IPAKAEESAQLFSRTYIKN 56 +AK L GIN+N +PV D+ + P T F + F + Sbjct: 165 LAKQLRRLGINLNMAPVADIKFVPHTP--LLNRTFGGYSAYDIGLMVEAFIDGMQNH 219 >gi|299144785|ref|ZP_07037853.1| periplasmic beta-glucosidase [Bacteroides sp. 3_1_23] gi|298515276|gb|EFI39157.1| periplasmic beta-glucosidase [Bacteroides sp. 3_1_23] Length = 725 Score = 42.8 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ +G++ FSP++D+ P + + P A + Y N Sbjct: 139 AREARLAGLDWTFSPMIDVARDPR--WGRVSEGYGEDPYTNGVFAVASVKGYQGN 191 >gi|293372478|ref|ZP_06618862.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides ovatus SD CMC 3f] gi|292632661|gb|EFF51255.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides ovatus SD CMC 3f] Length = 735 Score = 42.8 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ +G++ FSP++D+ P + + P A + Y N Sbjct: 149 AREARLAGLDWTFSPMIDVARDPR--WGRVSEGYGEDPYTNGVFAVASVKGYQGN 201 >gi|237721786|ref|ZP_04552267.1| glycoside hydrolase [Bacteroides sp. 2_2_4] gi|229448655|gb|EEO54446.1| glycoside hydrolase [Bacteroides sp. 2_2_4] Length = 739 Score = 42.8 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ +G++ FSP++D+ P + + P A + Y N Sbjct: 153 AREARLAGLDWTFSPMIDVARDPR--WGRVSEGYGEDPYTNGVFAVASVKGYQGN 205 >gi|157363899|ref|YP_001470666.1| Beta-glucosidase [Thermotoga lettingae TMO] gi|157314503|gb|ABV33602.1| Beta-glucosidase [Thermotoga lettingae TMO] Length = 910 Score = 42.8 bits (100), Expect = 0.017, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A GI++ P +++ P + +S P + A + + +N Sbjct: 296 IASEAKYYGIDIMLGPGMNIHRDPLG--GRVFEYYSEDPHVTGKIAAAWIKGLQEN 349 >gi|86142611|ref|ZP_01061050.1| beta-glucosidase [Leeuwenhoekiella blandensis MED217] gi|85830643|gb|EAQ49101.1| beta-glucosidase [Leeuwenhoekiella blandensis MED217] Length = 785 Score = 42.8 bits (100), Expect = 0.017, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 M + + G++V +P L++ P + +S P A + A + R + Sbjct: 140 MGEEVKEYGVDVLLAPALNIHRNPLN--GRNFEYYSEDPLVAGKIASAYVRGIQSH 193 >gi|332187181|ref|ZP_08388921.1| glycosyl hydrolase family 3 N terminal domain protein [Sphingomonas sp. S17] gi|332012881|gb|EGI54946.1| glycosyl hydrolase family 3 N terminal domain protein [Sphingomonas sp. S17] Length = 334 Score = 42.8 bits (100), Expect = 0.017, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + L GI V+ +P+LD+ T + P + + Sbjct: 108 LGLMLREVGITVDCAPLLDVAQADTTEAIAS-RAYGAEPMQVAALGRAMLEGL 159 >gi|315639863|ref|ZP_07894995.1| beta-N-acetylhexosaminidase [Enterococcus italicus DSM 15952] gi|315484397|gb|EFU74861.1| beta-N-acetylhexosaminidase [Enterococcus italicus DSM 15952] Length = 414 Score = 42.5 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +K L GI PV D+ P+ FI E + +T + Sbjct: 199 SKILKAFGIQTGLFPVADVATDPQAFI--YDRTLGMDAQTTSEYVKTVVQTLKE 250 >gi|325286191|ref|YP_004261981.1| beta-glucosidase [Cellulophaga lytica DSM 7489] gi|324321645|gb|ADY29110.1| Beta-glucosidase [Cellulophaga lytica DSM 7489] Length = 754 Score = 42.5 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 13/48 (27%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 GIN NFSP++D+ P + P A+ Y N Sbjct: 144 GINWNFSPMVDVARDPR--WGRIAEGAGEDPYLGSAIAKAMVHGYQGN 189 >gi|89070013|ref|ZP_01157344.1| putative beta-glucosidase [Oceanicola granulosus HTCC2516] gi|89044350|gb|EAR50488.1| putative beta-glucosidase [Oceanicola granulosus HTCC2516] Length = 807 Score = 42.5 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A +V +P ++L GP + +S P A + R N Sbjct: 87 LADEARDKSCHVLLAPTINLQRGPLN--GRNFECYSEDPYLTARLAVGYIRGLQDN 140 >gi|297565144|ref|YP_003684116.1| glycoside hydrolase family 3 domain-containing protein [Meiothermus silvanus DSM 9946] gi|296849593|gb|ADH62608.1| glycoside hydrolase family 3 domain protein [Meiothermus silvanus DSM 9946] Length = 736 Score = 42.5 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L +G NF+PV DL P + F P A R Sbjct: 167 GQELRATGTLWNFAPVADLGRDPR--WGRFYETFGEDPLLAGSLVAATVRGLQ 217 >gi|89899914|ref|YP_522385.1| glycoside hydrolase family protein [Rhodoferax ferrireducens T118] gi|89344651|gb|ABD68854.1| glycoside hydrolase, family 3-like [Rhodoferax ferrireducens T118] Length = 866 Score = 42.5 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + +GIN F P L + + FS A + Sbjct: 176 GRQVRATGINWVFGPTLAVARDDR--WGRTYESFSEDATLVNAYAGAYVTGMQ 226 >gi|299141474|ref|ZP_07034610.1| beta-glucosidase [Prevotella oris C735] gi|298576810|gb|EFI48680.1| beta-glucosidase [Prevotella oris C735] Length = 818 Score = 42.5 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A+ + G +++F PVLDL P ++ P + Sbjct: 212 IARQIRLQGAHISFGPVLDLTRDPR--WSRVEESMGEDPVLTACMGAAMVKGL 262 >gi|302338605|ref|YP_003803811.1| beta-glucosidase [Spirochaeta smaragdinae DSM 11293] gi|301635790|gb|ADK81217.1| Beta-glucosidase [Spirochaeta smaragdinae DSM 11293] Length = 760 Score = 42.5 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + +GI++ P +++ P + S P E A F + +N Sbjct: 91 LGRMAKRAGIHMVLGPAINIKRSPLC--GRNFEYLSEDPYLTGELATAFVKAMQEN 144 >gi|318604125|emb|CBY25623.1| beta-hexosaminidase [Yersinia enterocolitica subsp. palearctica Y11] Length = 623 Score = 42.5 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L + G N NF PV+D+ + +S P E A+ + K Sbjct: 162 SYELSSLGFNFNFGPVVDVNNNQNNPVIGV-RSYSNDPVLVAELARSYISGIHK 214 >gi|197337779|ref|YP_002158089.1| beta-hexosaminidase [Vibrio fischeri MJ11] gi|197315031|gb|ACH64480.1| beta-hexosaminidase [Vibrio fischeri MJ11] Length = 331 Score = 42.5 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + LV I++ F+PVLD + + F + + F + Sbjct: 101 LCTELVAHDIDLTFAPVLDNGFDCKAI---GNRAFGDDINTIVKYSTAFMQGMK 151 >gi|152967423|ref|YP_001363207.1| glycoside hydrolase family 3 domain protein [Kineococcus radiotolerans SRS30216] gi|151361940|gb|ABS04943.1| glycoside hydrolase family 3 domain protein [Kineococcus radiotolerans SRS30216] Length = 778 Score = 42.5 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ + G++ +PVLD++ + S P + R Sbjct: 148 IGASMRSLGVHQGLAPVLDVVRDAR--WGRVEECVSEDPYVVGTITSAYVRGVQ 199 >gi|225871719|ref|YP_002753173.1| glycosyl hydrolase family, 3 [Acidobacterium capsulatum ATCC 51196] gi|225793416|gb|ACO33506.1| glycosyl hydrolase family, 3 [Acidobacterium capsulatum ATCC 51196] Length = 776 Score = 42.5 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + GI+ F+P++D+ P + P A R + Sbjct: 158 AMEARSVGIDWAFAPMVDIARDPR--WGRMVEGAGSDPYLGAAMAAAQVRGFQ 208 >gi|322832438|ref|YP_004212465.1| glycoside hydrolase family 3 domain protein [Rahnella sp. Y9602] gi|321167639|gb|ADW73338.1| glycoside hydrolase family 3 domain protein [Rahnella sp. Y9602] Length = 792 Score = 42.5 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G + +PVLD+ + F P A + R Sbjct: 150 IRQEAQSVGCHQGLAPVLDVSRDVR--WGRTEETFGEDPYLVGVMATAYVRGLQ 201 >gi|332163005|ref|YP_004299582.1| glycosyl hydrolase family protein [Yersinia enterocolitica subsp. palearctica 105.5R(r)] gi|325667235|gb|ADZ43879.1| glycosyl hydrolase family protein [Yersinia enterocolitica subsp. palearctica 105.5R(r)] gi|330863695|emb|CBX73797.1| hypothetical protein YEW_LL48610 [Yersinia enterocolitica W22703] Length = 623 Score = 42.5 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L + G N NF PV+D+ + +S P E A+ + K Sbjct: 162 SYELSSLGFNFNFGPVVDVNNNQNNPVIGV-RSYSNDPVLVAELARSYISGIHK 214 >gi|332290053|ref|YP_004420905.1| beta-hexosaminidase [Gallibacterium anatis UMN179] gi|330432949|gb|AEC18008.1| beta-hexosaminidase [Gallibacterium anatis UMN179] Length = 343 Score = 42.5 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA ++ I+++F+PVLD+ + + F + + A+ F ++ Sbjct: 104 MASEMIAMDIDLSFAPVLDVGHQCKAI---GDRSFHQDWRQLLPLAEAFCDGMLQ 155 >gi|87301787|ref|ZP_01084621.1| putative beta-glucosidase [Synechococcus sp. WH 5701] gi|87283355|gb|EAQ75310.1| putative beta-glucosidase [Synechococcus sp. WH 5701] Length = 550 Score = 42.5 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 14/53 (26%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G+N +PV D+ + + A A F Sbjct: 136 GRQARQLGLNGVLAPVCDVNNNSRNPVINV-RAWGETAGTAAALAVAFLEGAQ 187 >gi|312126424|ref|YP_003991298.1| glycoside hydrolase family 3 domain-containing protein [Caldicellulosiruptor hydrothermalis 108] gi|311776443|gb|ADQ05929.1| glycoside hydrolase family 3 domain protein [Caldicellulosiruptor hydrothermalis 108] Length = 771 Score = 42.5 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 11/61 (18%), Positives = 19/61 (31%), Gaps = 7/61 (11%) Query: 1 MAK----NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-K 55 MAK + G + +P++D+ + F P A + K Sbjct: 124 MAKVIRLQMKAVGAHQALAPLIDVARDAR--WGRVEETFGEDPYLVANMAVSYVEGIQGK 181 Query: 56 N 56 N Sbjct: 182 N 182 >gi|238793364|ref|ZP_04636990.1| Glycosyl hydrolase family protein [Yersinia intermedia ATCC 29909] gi|238727333|gb|EEQ18861.1| Glycosyl hydrolase family protein [Yersinia intermedia ATCC 29909] Length = 627 Score = 42.5 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L + G N NF PV+D+ + +S P E A+ + K Sbjct: 166 GYELSSLGFNFNFGPVVDVNNNQNNPVIGV-RSYSNDPVLVGELARSYINGIHK 218 >gi|222530315|ref|YP_002574197.1| glycoside hydrolase family 3 domain-containing protein [Caldicellulosiruptor bescii DSM 6725] gi|222457162|gb|ACM61424.1| glycoside hydrolase family 3 domain protein [Caldicellulosiruptor bescii DSM 6725] Length = 771 Score = 42.5 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 11/61 (18%), Positives = 19/61 (31%), Gaps = 7/61 (11%) Query: 1 MAK----NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-K 55 MAK + G + +P++D+ + F P A + K Sbjct: 124 MAKVIRLQMKAVGAHQALAPLIDVARDAR--WGRVEETFGEDPYLVANMAVSYVEGIQGK 181 Query: 56 N 56 N Sbjct: 182 N 182 >gi|157961265|ref|YP_001501299.1| glycoside hydrolase family 3 protein [Shewanella pealeana ATCC 700345] gi|157846265|gb|ABV86764.1| glycoside hydrolase family 3 domain protein [Shewanella pealeana ATCC 700345] Length = 850 Score = 42.5 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +GI+ F+P + ++ + +S P + A R Sbjct: 186 AKEVMVTGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPQIVKAYAGAIVRGLQ 236 >gi|294146774|ref|YP_003559440.1| beta-glucosidase [Sphingobium japonicum UT26S] gi|292677191|dbj|BAI98708.1| beta-glucosidase [Sphingobium japonicum UT26S] Length = 790 Score = 42.5 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G+++ SPV+D+ P + F P E R Sbjct: 183 IAREVRARGVHLALSPVVDIARDPR--WGRIEETFGEDPYLCGEMGVAAVRGLQ 234 >gi|315498957|ref|YP_004087761.1| glycoside hydrolase family 3 domain protein [Asticcacaulis excentricus CB 48] gi|315416969|gb|ADU13610.1| glycoside hydrolase family 3 domain protein [Asticcacaulis excentricus CB 48] Length = 863 Score = 42.5 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G++ F+P + + + +S PA A Sbjct: 198 AYEMSLAGVDWTFAPTVAVSRDKR--WGRAYESYSENPADVAAYAGKVVEGLQ 248 >gi|329893570|ref|ZP_08269735.1| Periplasmic beta-glucosidase [gamma proteobacterium IMCC3088] gi|328923650|gb|EGG30961.1| Periplasmic beta-glucosidase [gamma proteobacterium IMCC3088] Length = 813 Score = 42.5 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 ++ + +GI+ F+P + ++ + + +S P + A+ R Sbjct: 158 SREVRATGIDGIFAPTVAIV--KDNRWGRTYESYSDRPDIVADYAEAVVRGLQ 208 >gi|330504450|ref|YP_004381319.1| glycoside hydrolase family 3 protein [Pseudomonas mendocina NK-01] gi|328918736|gb|AEB59567.1| glycoside hydrolase family 3 protein [Pseudomonas mendocina NK-01] Length = 764 Score = 42.5 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+++ F+P +D+ P + F P A Y Sbjct: 136 AFEASADGLDMTFAPTVDISRDPR--WGRTSEGFGEDPYLVSRIAAAMVHGYQ 186 >gi|307299485|ref|ZP_07579285.1| glycoside hydrolase family 3 domain protein [Thermotogales bacterium mesG1.Ag.4.2] gi|306914884|gb|EFN45271.1| glycoside hydrolase family 3 domain protein [Thermotogales bacterium mesG1.Ag.4.2] Length = 685 Score = 42.5 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ GIN+ F+P++D+ P + P E A+ R Y +N Sbjct: 99 AREAAMEGINMIFAPMVDISRDPR--WGRVAEGAGEDPYLGSEVARARVRGYQRN 151 >gi|269955728|ref|YP_003325517.1| glycoside hydrolase family 3 domain-containing protein [Xylanimonas cellulosilytica DSM 15894] gi|269304409|gb|ACZ29959.1| glycoside hydrolase family 3 domain protein [Xylanimonas cellulosilytica DSM 15894] Length = 780 Score = 42.5 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +GI+ FSPVL + + F P E A R Y Sbjct: 120 AVETAATGIHWTFSPVLCIARDLR--WGRVDETFGEDPHLIGELASAAVRGYQ 170 >gi|310821122|ref|YP_003953480.1| 1,4-beta-d-glucan glucohydrolase [Stigmatella aurantiaca DW4/3-1] gi|309394194|gb|ADO71653.1| 1,4-beta-D-glucan glucohydrolase [Stigmatella aurantiaca DW4/3-1] Length = 1084 Score = 42.1 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI+ F P + ++ + +S P A + Sbjct: 199 ASEVARTGIDWAFGPTVAVVRDDR--WGRTYEGYSEDPQIVAAYAGKITEGLQ 249 >gi|115375441|ref|ZP_01462702.1| 1,4-beta-D-glucan glucohydrolase D [Stigmatella aurantiaca DW4/3-1] gi|115367568|gb|EAU66542.1| 1,4-beta-D-glucan glucohydrolase D [Stigmatella aurantiaca DW4/3-1] Length = 1100 Score = 42.1 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI+ F P + ++ + +S P A + Sbjct: 215 ASEVARTGIDWAFGPTVAVVRDDR--WGRTYEGYSEDPQIVAAYAGKITEGLQ 265 >gi|87120992|ref|ZP_01076884.1| glucan 1,4-beta-glucosidase [Marinomonas sp. MED121] gi|86163830|gb|EAQ65103.1| glucan 1,4-beta-glucosidase [Marinomonas sp. MED121] Length = 828 Score = 42.1 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK + +GI FSP + + +S P E A+ + Sbjct: 148 AKEVRATGIEWTFSPSVSTPRHYG--WGRVYEGYSEDPEVVEAYAKAMVQGLQ 198 >gi|295136217|ref|YP_003586893.1| beta-glucosidase [Zunongwangia profunda SM-A87] gi|294984232|gb|ADF54697.1| beta-glucosidase [Zunongwangia profunda SM-A87] Length = 766 Score = 42.1 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 21/63 (33%), Gaps = 8/63 (12%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY------IK 55 A S I+ NFSPVLDL P F P E Y + Sbjct: 163 AYETRASSISWNFSPVLDLGMDPRFPRI--WESFGEDPYLISELGVEMINGYEGEDNDLS 220 Query: 56 NPK 58 NP+ Sbjct: 221 NPE 223 >gi|225377045|ref|ZP_03754266.1| hypothetical protein ROSEINA2194_02689 [Roseburia inulinivorans DSM 16841] gi|225211102|gb|EEG93456.1| hypothetical protein ROSEINA2194_02689 [Roseburia inulinivorans DSM 16841] Length = 469 Score = 42.1 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI SPV+D+ P + + + + R Sbjct: 139 IGQESRAVGITSAMSPVIDVSRDPR--WGRTYETYGEDQYLISQMGIHYVRGMQN 191 >gi|225375711|ref|ZP_03752932.1| hypothetical protein ROSEINA2194_01343 [Roseburia inulinivorans DSM 16841] gi|225212481|gb|EEG94835.1| hypothetical protein ROSEINA2194_01343 [Roseburia inulinivorans DSM 16841] Length = 823 Score = 42.1 bits (98), Expect = 0.024, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++ GI F+PVLD+ + ++ + P +++ K Sbjct: 153 SRQEAACGITHVFAPVLDISRDSR--MGRQGETYGEDPVLTASLGSAYTKGCQK 204 >gi|182679248|ref|YP_001833394.1| glycoside hydrolase family 3 protein [Beijerinckia indica subsp. indica ATCC 9039] gi|182635131|gb|ACB95905.1| glycoside hydrolase family 3 domain protein [Beijerinckia indica subsp. indica ATCC 9039] Length = 429 Score = 42.1 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 22/60 (36%), Gaps = 9/60 (15%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKR-------SIFSRIPAKAEESAQLFSRTYI 54 L GI ++ +PV DL+ P++ S P A A FS+ + Sbjct: 208 GSALREIGITMDLAPVCDLM--PQSPPGIFDRHTRIAARSISDDPTIAAVIASGFSKGLL 265 >gi|163802415|ref|ZP_02196308.1| beta-hexosaminidase [Vibrio sp. AND4] gi|159173716|gb|EDP58531.1| beta-hexosaminidase [Vibrio sp. AND4] Length = 327 Score = 42.1 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA L+ I+++F+PVLD + + F + + Sbjct: 101 MAAELIAHDIDLSFAPVLDKGHQCKAI---GSRAFGEDIDTILRHSSAYMLGMR 151 >gi|270295789|ref|ZP_06201989.1| conserved hypothetical protein [Bacteroides sp. D20] gi|270273193|gb|EFA19055.1| conserved hypothetical protein [Bacteroides sp. D20] Length = 736 Score = 42.1 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++ FSP++D+ + + P + Y Sbjct: 148 AQEARMSGVDWTFSPMIDVARDGR--WGRVAEGYGEDPYTNAVFGVASIKGYQ 198 >gi|160890694|ref|ZP_02071697.1| hypothetical protein BACUNI_03139 [Bacteroides uniformis ATCC 8492] gi|317479776|ref|ZP_07938897.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bacteroides sp. 4_1_36] gi|156859693|gb|EDO53124.1| hypothetical protein BACUNI_03139 [Bacteroides uniformis ATCC 8492] gi|316904069|gb|EFV25902.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bacteroides sp. 4_1_36] Length = 736 Score = 42.1 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++ FSP++D+ + + P + Y Sbjct: 148 AQEARMSGVDWTFSPMIDVARDGR--WGRVAEGYGEDPYTNAVFGVASIKGYQ 198 >gi|302407830|ref|XP_003001750.1| periplasmic beta-glucosidase [Verticillium albo-atrum VaMs.102] gi|261359471|gb|EEY21899.1| periplasmic beta-glucosidase [Verticillium albo-atrum VaMs.102] Length = 774 Score = 42.1 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + G+N F+PV+DL + ++ P A E + + + Sbjct: 158 IGVESRALGVNQIFAPVVDLAREMR--FGRVEECYTEDPYLAGEYGYAYVKGLQE 210 >gi|146299801|ref|YP_001194392.1| glycoside hydrolase family 3 protein [Flavobacterium johnsoniae UW101] gi|146154219|gb|ABQ05073.1| Candidate beta-glycosidase; Glycoside hydrolase family 3 [Flavobacterium johnsoniae UW101] Length = 886 Score = 42.1 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G++ F P LDL P + F E F + Sbjct: 157 IGMEARAHGVHFGFGPNLDLGREPR--WGRVAETFGEDAYLNSEIGLAFIKGIQ 208 >gi|302547025|ref|ZP_07299367.1| LOW QUALITY PROTEIN: beta-glucosidase [Streptomyces hygroscopicus ATCC 53653] gi|302464643|gb|EFL27736.1| LOW QUALITY PROTEIN: beta-glucosidase [Streptomyces himastatinicus ATCC 53653] Length = 418 Score = 42.1 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ G++V P ++L P + FS P A + R N Sbjct: 100 IAQEARGKGVDVALGPTINLHRSPLG--GRHFEAFSEDPLLTGHLAAAYVRGIQDN 153 >gi|260642727|ref|ZP_05417108.2| periplasmic beta-glucosidase [Bacteroides finegoldii DSM 17565] gi|260620819|gb|EEX43690.1| periplasmic beta-glucosidase [Bacteroides finegoldii DSM 17565] Length = 768 Score = 42.1 bits (98), Expect = 0.027, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI F+P++D+ P + P + + Sbjct: 156 AIEASADGIRWTFAPMIDISRDPR--WGRIAESCGEDPYLTSVMGVAMIKGFQ 206 >gi|288925426|ref|ZP_06419360.1| beta-glucosidase [Prevotella buccae D17] gi|288337897|gb|EFC76249.1| beta-glucosidase [Prevotella buccae D17] Length = 763 Score = 42.1 bits (98), Expect = 0.027, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ GIN +SP++D+ P + P + R + N Sbjct: 137 AREASAQGINWVYSPMVDIALDPR--WGRIAEGNGEDPFLGSRIGEAMIRGFQGN 189 >gi|329577241|gb|EGG58707.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX1467] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|323480470|gb|ADX79909.1| glycosyl hydrolase family 3 N terminal domain protein [Enterococcus faecalis 62] Length = 716 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 120 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 175 >gi|315606864|ref|ZP_07881873.1| beta-glucosidase [Prevotella buccae ATCC 33574] gi|315251529|gb|EFU31509.1| beta-glucosidase [Prevotella buccae ATCC 33574] Length = 763 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ GIN +SP++D+ P + P + R + N Sbjct: 137 AREASAQGINWVYSPMVDIALDPR--WGRIAEGNGEDPFLGSRIGEAMIRGFQGN 189 >gi|315173181|gb|EFU17198.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX1346] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|315169919|gb|EFU13936.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX1342] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|315151421|gb|EFT95437.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0012] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|315145548|gb|EFT89564.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX2141] gi|315162611|gb|EFU06628.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0645] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|312899299|ref|ZP_07758634.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0470] gi|311293547|gb|EFQ72103.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0470] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|307288461|ref|ZP_07568447.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0109] gi|306500536|gb|EFM69867.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0109] gi|315165455|gb|EFU09472.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX1302] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|295112782|emb|CBL31419.1| Beta-glucosidase-related glycosidases [Enterococcus sp. 7L76] Length = 716 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 120 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 175 >gi|257415860|ref|ZP_05592854.1| glycosyl hydrolase [Enterococcus faecalis AR01/DG] gi|257157688|gb|EEU87648.1| glycosyl hydrolase [Enterococcus faecalis ARO1/DG] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|257085498|ref|ZP_05579859.1| glycosyl hydrolase [Enterococcus faecalis Fly1] gi|256993528|gb|EEU80830.1| glycosyl hydrolase [Enterococcus faecalis Fly1] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|257082797|ref|ZP_05577158.1| glycosyl hydrolase [Enterococcus faecalis E1Sol] gi|256990827|gb|EEU78129.1| glycosyl hydrolase [Enterococcus faecalis E1Sol] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|256962166|ref|ZP_05566337.1| glycosyl hydrolase [Enterococcus faecalis Merz96] gi|293383193|ref|ZP_06629109.1| beta-glucosidase [Enterococcus faecalis R712] gi|293387653|ref|ZP_06632199.1| beta-glucosidase [Enterococcus faecalis S613] gi|312907220|ref|ZP_07766211.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis DAPTO 512] gi|312909838|ref|ZP_07768686.1| glycosyl hydrolase family 3 N-terminal domain protein [Enterococcus faecalis DAPTO 516] gi|256952662|gb|EEU69294.1| glycosyl hydrolase [Enterococcus faecalis Merz96] gi|291079371|gb|EFE16735.1| beta-glucosidase [Enterococcus faecalis R712] gi|291082985|gb|EFE19948.1| beta-glucosidase [Enterococcus faecalis S613] gi|310626248|gb|EFQ09531.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis DAPTO 512] gi|311289796|gb|EFQ68352.1| glycosyl hydrolase family 3 N-terminal domain protein [Enterococcus faecalis DAPTO 516] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|256958728|ref|ZP_05562899.1| glycosyl hydrolase [Enterococcus faecalis DS5] gi|257078757|ref|ZP_05573118.1| glycosyl hydrolase [Enterococcus faecalis JH1] gi|257419062|ref|ZP_05596056.1| glycosyl hydrolase [Enterococcus faecalis T11] gi|307268650|ref|ZP_07550019.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX4248] gi|256949224|gb|EEU65856.1| glycosyl hydrolase [Enterococcus faecalis DS5] gi|256986787|gb|EEU74089.1| glycosyl hydrolase [Enterococcus faecalis JH1] gi|257160890|gb|EEU90850.1| glycosyl hydrolase [Enterococcus faecalis T11] gi|306514962|gb|EFM83508.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX4248] gi|315031566|gb|EFT43498.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0017] gi|315035018|gb|EFT46950.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0027] gi|315166552|gb|EFU10569.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX1341] gi|315575704|gb|EFU87895.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0309B] gi|315579852|gb|EFU92043.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0309A] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|256762239|ref|ZP_05502819.1| glycosyl hydrolase [Enterococcus faecalis T3] gi|256683490|gb|EEU23185.1| glycosyl hydrolase [Enterococcus faecalis T3] gi|327534862|gb|AEA93696.1| putative beta-glucosidase [Enterococcus faecalis OG1RF] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|256618820|ref|ZP_05475666.1| glycosyl hydrolase [Enterococcus faecalis ATCC 4200] gi|257086589|ref|ZP_05580950.1| glycosyl hydrolase [Enterococcus faecalis D6] gi|256598347|gb|EEU17523.1| glycosyl hydrolase [Enterococcus faecalis ATCC 4200] gi|256994619|gb|EEU81921.1| glycosyl hydrolase [Enterococcus faecalis D6] gi|315027791|gb|EFT39723.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX2137] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|255976086|ref|ZP_05426672.1| glycosyl hydrolase [Enterococcus faecalis T2] gi|307279056|ref|ZP_07560114.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0860] gi|255968958|gb|EET99580.1| glycosyl hydrolase [Enterococcus faecalis T2] gi|306504181|gb|EFM73393.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0860] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|300860071|ref|ZP_07106159.1| glycosyl hydrolase family 3 N-terminal domain protein [Enterococcus faecalis TUSoD Ef11] gi|300850889|gb|EFK78638.1| glycosyl hydrolase family 3 N-terminal domain protein [Enterococcus faecalis TUSoD Ef11] Length = 716 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 120 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 175 >gi|229550273|ref|ZP_04438998.1| possible beta-glucosidase [Enterococcus faecalis ATCC 29200] gi|255973047|ref|ZP_05423633.1| glycosyl hydrolase [Enterococcus faecalis T1] gi|256965364|ref|ZP_05569535.1| glycosyl hydrolase [Enterococcus faecalis HIP11704] gi|257089646|ref|ZP_05584007.1| glycosyl hydrolase [Enterococcus faecalis CH188] gi|307273474|ref|ZP_07554718.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0855] gi|307274439|ref|ZP_07555622.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX2134] gi|312903990|ref|ZP_07763159.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0635] gi|312951001|ref|ZP_07769909.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0102] gi|229304536|gb|EEN70532.1| possible beta-glucosidase [Enterococcus faecalis ATCC 29200] gi|255964065|gb|EET96541.1| glycosyl hydrolase [Enterococcus faecalis T1] gi|256955860|gb|EEU72492.1| glycosyl hydrolase [Enterococcus faecalis HIP11704] gi|256998458|gb|EEU84978.1| glycosyl hydrolase [Enterococcus faecalis CH188] gi|306508833|gb|EFM77920.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX2134] gi|306509813|gb|EFM78839.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0855] gi|310630956|gb|EFQ14239.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0102] gi|310632710|gb|EFQ15993.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0635] gi|315147720|gb|EFT91736.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX4244] gi|315154038|gb|EFT98054.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0031] gi|315157325|gb|EFU01342.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0043] gi|315158388|gb|EFU02405.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0312] gi|315578338|gb|EFU90529.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0630] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|227553024|ref|ZP_03983073.1| possible beta-glucosidase [Enterococcus faecalis HH22] gi|227177856|gb|EEI58828.1| possible beta-glucosidase [Enterococcus faecalis HH22] Length = 274 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|227518499|ref|ZP_03948548.1| possible beta-glucosidase [Enterococcus faecalis TX0104] gi|227074177|gb|EEI12140.1| possible beta-glucosidase [Enterococcus faecalis TX0104] Length = 722 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 181 >gi|29375811|ref|NP_814965.1| glycosy hydrolase family protein [Enterococcus faecalis V583] gi|294781152|ref|ZP_06746502.1| glycosyl hydrolase family 3 N-terminal domain protein [Enterococcus faecalis PC1.1] gi|29343272|gb|AAO81035.1| glycosyl hydrolase, family 3 [Enterococcus faecalis V583] gi|294451830|gb|EFG20282.1| glycosyl hydrolase family 3 N-terminal domain protein [Enterococcus faecalis PC1.1] Length = 716 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 AK SG++V FSP++DL+ P + P A R Y +N K Sbjct: 120 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQGENLK 175 >gi|333026299|ref|ZP_08454363.1| putative glycoside hydrolase family 3 domain protein [Streptomyces sp. Tu6071] gi|332746151|gb|EGJ76592.1| putative glycoside hydrolase family 3 domain protein [Streptomyces sp. Tu6071] Length = 724 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ ++G++ F+P++D+ + P + P R Y Sbjct: 124 AEEARSAGVHWTFNPMMDVCHEPR--WGRIAESAGEDPYLTAVLTAAKVRGYQ 174 >gi|318056991|ref|ZP_07975714.1| beta-glucosidase [Streptomyces sp. SA3_actG] gi|318078792|ref|ZP_07986124.1| beta-glucosidase [Streptomyces sp. SA3_actF] Length = 724 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ ++G++ F+P++D+ + P + P R Y Sbjct: 124 AEEARSAGVHWTFNPMMDVCHEPR--WGRIAESAGEDPYLTAVLTAAKVRGYQ 174 >gi|302519956|ref|ZP_07272298.1| periplasmic beta-glucosidase [Streptomyces sp. SPB78] gi|302428851|gb|EFL00667.1| periplasmic beta-glucosidase [Streptomyces sp. SPB78] Length = 724 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ ++G++ F+P++D+ + P + P R Y Sbjct: 124 AEEARSAGVHWTFNPMMDVCHEPR--WGRIAESAGEDPYLTAVLTAAKVRGYQ 174 >gi|162450873|ref|YP_001613240.1| Beta-glucosidase [Sorangium cellulosum 'So ce 56'] gi|161161455|emb|CAN92760.1| Beta-glucosidase [Sorangium cellulosum 'So ce 56'] Length = 728 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G+ FSPVL L + F P E A + Y Sbjct: 121 AAEMRATGLKWTFSPVLCLTRDLR--WGRVGETFGEDPYLIGELACAMIKGYQ 171 >gi|295395175|ref|ZP_06805383.1| beta-N-acetylhexosaminidase [Brevibacterium mcbrellneri ATCC 49030] gi|294971937|gb|EFG47804.1| beta-N-acetylhexosaminidase [Brevibacterium mcbrellneri ATCC 49030] Length = 536 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L +G +++F+PV D+ G + ++ Y K Sbjct: 185 GAELRDAGFSIDFAPVADVTVGAKDPAINV-RSAGDKSDAVSDTVAAAVSGYSK 237 >gi|146276953|ref|YP_001167112.1| Beta-N-acetylhexosaminidase [Rhodobacter sphaeroides ATCC 17025] gi|145555194|gb|ABP69807.1| Beta-N-acetylhexosaminidase [Rhodobacter sphaeroides ATCC 17025] Length = 338 Score = 42.1 bits (98), Expect = 0.029, Method: Composition-based stats. Identities = 10/38 (26%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRI 38 +A+ L GI+ N +PV D+L S Sbjct: 109 IAEELRAVGIDGNCAPVADVLTPATHP-FLANRCLSDE 145 >gi|154253464|ref|YP_001414288.1| beta-N-acetylhexosaminidase [Parvibaculum lavamentivorans DS-1] gi|154157414|gb|ABS64631.1| Beta-N-acetylhexosaminidase [Parvibaculum lavamentivorans DS-1] Length = 337 Score = 42.1 bits (98), Expect = 0.029, Method: Composition-based stats. Identities = 10/42 (23%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKA 42 +A L +GI N PVLD+ + +++ P Sbjct: 109 IAAELYAAGITANCLPVLDVPVPGAHDVIG-DRAYAQAPGPV 149 >gi|88857683|ref|ZP_01132326.1| glucan 1,4-beta-glucosidase [Pseudoalteromonas tunicata D2] gi|88820880|gb|EAR30692.1| glucan 1,4-beta-glucosidase [Pseudoalteromonas tunicata D2] Length = 854 Score = 42.1 bits (98), Expect = 0.029, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 A ++ +GI+ F+P + ++ + +S PA E A+ + K Sbjct: 189 ATEVMVTGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPAIVREYAKAIVNGLQGHAK 243 >gi|163840108|ref|YP_001624513.1| beta-N-acetylhexosaminidase [Renibacterium salmoninarum ATCC 33209] gi|162953584|gb|ABY23099.1| beta-N-acetylhexosaminidase [Renibacterium salmoninarum ATCC 33209] Length = 327 Score = 41.7 bits (97), Expect = 0.030, Method: Composition-based stats. Identities = 12/48 (25%), Positives = 17/48 (35%), Gaps = 5/48 (10%) Query: 2 AKNLVTSGINVNFSPVLDLLYGP-----ETFIAQKRSIFSRIPAKAEE 44 + L +G+NVNF PVLD + I + P Sbjct: 103 GQQLAAAGVNVNFGPVLDTVPSAAFAPQNAPIGYFGREYGFTPQDVSA 150 >gi|33151740|ref|NP_873093.1| beta-hexosaminidase [Haemophilus ducreyi 35000HP] gi|47605835|sp|Q7VNI8|NAGZ_HAEDU RecName: Full=Beta-hexosaminidase; AltName: Full=Beta-N-acetylhexosaminidase; AltName: Full=N-acetyl-beta-glucosaminidase gi|33147961|gb|AAP95482.1| Beta-hexosaminidase [Haemophilus ducreyi 35000HP] Length = 344 Score = 41.7 bits (97), Expect = 0.030, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 MA + I+++F+PVLDL + + F + A+ F + Sbjct: 103 MAAEMFALDIDLSFAPVLDLGHKCKAI---GDRSFGEKVTQILPIAEGFIDGMRE 154 >gi|256852884|ref|ZP_05558254.1| glycosyl hydrolase, family 3 [Enterococcus faecalis T8] gi|256711343|gb|EEU26381.1| glycosyl hydrolase, family 3 [Enterococcus faecalis T8] Length = 716 Score = 41.7 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK SG++V FSP++DL+ P + P A R Y Sbjct: 120 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQ 170 >gi|229546084|ref|ZP_04434809.1| possible beta-glucosidase [Enterococcus faecalis TX1322] gi|307291221|ref|ZP_07571106.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0411] gi|229308780|gb|EEN74767.1| possible beta-glucosidase [Enterococcus faecalis TX1322] gi|306497875|gb|EFM67407.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX0411] gi|315029117|gb|EFT41049.1| glycosyl hydrolase family 3 protein [Enterococcus faecalis TX4000] Length = 722 Score = 41.7 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK SG++V FSP++DL+ P + P A R Y Sbjct: 126 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDPLLNSRLAAAMVRGYQ 176 >gi|325971984|ref|YP_004248175.1| beta-glucosidase [Spirochaeta sp. Buddy] gi|324027222|gb|ADY13981.1| Beta-glucosidase [Spirochaeta sp. Buddy] Length = 785 Score = 41.7 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L + GI+ +PVLD+ + F P + + Sbjct: 139 IGDELRSLGIHQGLAPVLDVARDAR--WGRLEETFGEDPYLCGVMGIGYVKGLQ 190 >gi|300786388|ref|YP_003766679.1| beta-glucosidase [Amycolatopsis mediterranei U32] gi|299795902|gb|ADJ46277.1| beta-glucosidase [Amycolatopsis mediterranei U32] Length = 765 Score = 41.7 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + + G++ +PVLD+ + P + Sbjct: 152 IGRTMRGLGVHQGLAPVLDVARDLR--WGRVEETIGEDPYLVGTIGSAYVAGL 202 >gi|295135520|ref|YP_003586196.1| beta-glucosidase [Zunongwangia profunda SM-A87] gi|294983535|gb|ADF54000.1| beta-glucosidase [Zunongwangia profunda SM-A87] Length = 748 Score = 41.7 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 7/55 (12%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + +G++ F+P++D+ + P + A + + N Sbjct: 137 GRETAAAGVHWTFAPMMDISRDAR--WGRIMEGAGEDPYLNSKIAVARIKGFQGN 189 >gi|226324059|ref|ZP_03799577.1| hypothetical protein COPCOM_01837 [Coprococcus comes ATCC 27758] gi|225207608|gb|EEG89962.1| hypothetical protein COPCOM_01837 [Coprococcus comes ATCC 27758] Length = 819 Score = 41.7 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK GI +PVLD+ + ++ + PA A +++ Sbjct: 138 AKQEAACGITHILAPVLDISRDSR--MGRQGETYGEDPALAAALGTAYTKGIQ 188 >gi|206900603|ref|YP_002250145.1| beta-D-glucosidase [Dictyoglomus thermophilum H-6-12] gi|206739706|gb|ACI18764.1| beta-D-glucosidase [Dictyoglomus thermophilum H-6-12] Length = 589 Score = 41.7 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI +F+P + ++ + FS P R + Sbjct: 146 AIETSAIGIRWSFAPCVAVVQDVR--WGRTYESFSENPDVVALLGSAVVRGFQ 196 >gi|312136056|ref|YP_004003394.1| glycoside hydrolase family 3 domain-containing protein [Caldicellulosiruptor owensensis OL] gi|311776107|gb|ADQ05594.1| glycoside hydrolase family 3 domain protein [Caldicellulosiruptor owensensis OL] Length = 771 Score = 41.7 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 9/58 (15%), Positives = 17/58 (29%), Gaps = 6/58 (10%) Query: 1 MAK----NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MAK + G + +P++D+ + F P A + Sbjct: 124 MAKVIRLQMKAVGAHQALAPLIDVARDAR--WGRVEETFGEDPYLVANMAVSYVEGIQ 179 >gi|170725511|ref|YP_001759537.1| glycoside hydrolase family 3 protein [Shewanella woodyi ATCC 51908] gi|169810858|gb|ACA85442.1| glycoside hydrolase family 3 domain protein [Shewanella woodyi ATCC 51908] Length = 862 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +GI+ F+P + ++ + +S P + Sbjct: 194 AKEVMVTGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPEIVLAYSAAIVEGLQ 244 >gi|298479985|ref|ZP_06998184.1| periplasmic beta-glucosidase [Bacteroides sp. D22] gi|298273794|gb|EFI15356.1| periplasmic beta-glucosidase [Bacteroides sp. D22] Length = 735 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++ FSP++D+ P + + P A R Y Sbjct: 149 AQEARMSGVDWTFSPMIDVARDPR--WGRVAEGYGEDPYTNGVFAAASVRGYQ 199 >gi|295085572|emb|CBK67095.1| Beta-glucosidase-related glycosidases [Bacteroides xylanisolvens XB1A] Length = 444 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++ FSP++D+ P + + P A R Y Sbjct: 149 AQEARMSGVDWTFSPMIDVARDPR--WGRVAEGYGEDPYTNGVFAAASVRGYQ 199 >gi|294806351|ref|ZP_06765198.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides xylanisolvens SD CC 1b] gi|294446607|gb|EFG15227.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides xylanisolvens SD CC 1b] Length = 402 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++ FSP++D+ P + + P A R Y Sbjct: 149 AQEARMSGVDWTFSPMIDVARDPR--WGRVAEGYGEDPYTNGVFAAASVRGYQ 199 >gi|294647953|ref|ZP_06725505.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides ovatus SD CC 2a] gi|292636861|gb|EFF55327.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides ovatus SD CC 2a] Length = 221 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++ FSP++D+ P + + P A R Y Sbjct: 150 AQEARMSGVDWTFSPMIDVARDPR--WGRVAEGYGEDPYTNGVFAAASVRGYQ 200 >gi|262405981|ref|ZP_06082531.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] gi|262356856|gb|EEZ05946.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] Length = 735 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++ FSP++D+ P + + P A R Y Sbjct: 149 AQEARMSGVDWTFSPMIDVARDPR--WGRVAEGYGEDPYTNGVFAAASVRGYQ 199 >gi|260173082|ref|ZP_05759494.1| beta-glucosidase [Bacteroides sp. D2] gi|315921359|ref|ZP_07917599.1| conserved hypothetical protein [Bacteroides sp. D2] gi|313695234|gb|EFS32069.1| conserved hypothetical protein [Bacteroides sp. D2] Length = 735 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++ FSP++D+ P + + P A R Y Sbjct: 149 AQEARMSGVDWTFSPMIDVARDPR--WGRVAEGYGEDPYTNGVFAAASVRGYQ 199 >gi|237717213|ref|ZP_04547694.1| beta-glucosidase [Bacteroides sp. D1] gi|229443196|gb|EEO48987.1| beta-glucosidase [Bacteroides sp. D1] Length = 740 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++ FSP++D+ P + + P A R Y Sbjct: 154 AQEARMSGVDWTFSPMIDVARDPR--WGRVAEGYGEDPYTNGVFAAASVRGYQ 204 >gi|255689951|ref|ZP_05413626.1| beta-glucosidase [Bacteroides finegoldii DSM 17565] gi|260624557|gb|EEX47428.1| beta-glucosidase [Bacteroides finegoldii DSM 17565] Length = 735 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++ FSP++D+ P + + P A R Y Sbjct: 149 AQEARMSGVDWTFSPMIDVARDPR--WGRVAEGYGEDPYTNGVFAAASVRGYQ 199 >gi|160884133|ref|ZP_02065136.1| hypothetical protein BACOVA_02110 [Bacteroides ovatus ATCC 8483] gi|156110475|gb|EDO12220.1| hypothetical protein BACOVA_02110 [Bacteroides ovatus ATCC 8483] Length = 735 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++ FSP++D+ P + + P A R Y Sbjct: 149 AQEARMSGVDWTFSPMIDVARDPR--WGRVAEGYGEDPYTNGVFAAASVRGYQ 199 >gi|225351536|ref|ZP_03742559.1| hypothetical protein BIFPSEUDO_03132 [Bifidobacterium pseudocatenulatum DSM 20438] gi|225157880|gb|EEG71163.1| hypothetical protein BIFPSEUDO_03132 [Bifidobacterium pseudocatenulatum DSM 20438] Length = 809 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ FSPVL + + F P E A + Y Sbjct: 158 AEEVSATGVHWTFSPVLCIARDTR--WGRVGETFGEDPYLIGEMASSIVKGYQ 208 >gi|212715462|ref|ZP_03323590.1| hypothetical protein BIFCAT_00358 [Bifidobacterium catenulatum DSM 16992] gi|212661637|gb|EEB22212.1| hypothetical protein BIFCAT_00358 [Bifidobacterium catenulatum DSM 16992] Length = 809 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ FSPVL + + F P E A + Y Sbjct: 158 AEEVSATGVHWTFSPVLCIARDTR--WGRVGETFGEDPYLIGEMASSIVKGYQ 208 >gi|119026215|ref|YP_910060.1| beta-D-glucosideglucohydrolase [Bifidobacterium adolescentis ATCC 15703] gi|118765799|dbj|BAF39978.1| beta-D-glucosideglucohydrolase [Bifidobacterium adolescentis ATCC 15703] Length = 809 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ FSPVL + + F P E A + Y Sbjct: 158 AEEVSATGVHWTFSPVLCIARDTR--WGRVGETFGEDPYLIGEMASSIVKGYQ 208 >gi|319953334|ref|YP_004164601.1| beta-glucosidase [Cellulophaga algicola DSM 14237] gi|319421994|gb|ADV49103.1| Beta-glucosidase [Cellulophaga algicola DSM 14237] Length = 756 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GIN NFSP++D+ P + P + A+ Y Sbjct: 139 ALEATADGINWNFSPMVDISRDPR--WGRISEGAGEDPYLGSQIAKAMVTGYQ 189 >gi|302532580|ref|ZP_07284922.1| xylan 1,4-beta-xylosidase [Streptomyces sp. C] gi|302441475|gb|EFL13291.1| xylan 1,4-beta-xylosidase [Streptomyces sp. C] Length = 739 Score = 41.7 bits (97), Expect = 0.033, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + +G++ +PVLD++ + P + + Sbjct: 146 IGTGMRRAGVHQGLAPVLDVVRDYR--WGRTEECIGEDPFLVGAIGTAYVQGL 196 >gi|310817374|ref|YP_003949732.1| periplasmic beta-glucosidase [Stigmatella aurantiaca DW4/3-1] gi|309390446|gb|ADO67905.1| Periplasmic beta-glucosidase [Stigmatella aurantiaca DW4/3-1] Length = 763 Score = 41.7 bits (97), Expect = 0.034, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI FSP++D+ + P A+ + R Y Sbjct: 150 ASEAAAEGIRWAFSPMVDIARDAR--WGRVAESSGEDPHLGSAMARAYVRGYQ 200 >gi|115372244|ref|ZP_01459554.1| periplasmic beta-glucosidase [Stigmatella aurantiaca DW4/3-1] gi|115370709|gb|EAU69634.1| periplasmic beta-glucosidase [Stigmatella aurantiaca DW4/3-1] Length = 702 Score = 41.7 bits (97), Expect = 0.034, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI FSP++D+ + P A+ + R Y Sbjct: 89 ASEAAAEGIRWAFSPMVDIARDAR--WGRVAESSGEDPHLGSAMARAYVRGYQ 139 >gi|91793956|ref|YP_563607.1| Beta-glucosidase [Shewanella denitrificans OS217] gi|91715958|gb|ABE55884.1| exo-1,4-beta-glucosidase [Shewanella denitrificans OS217] Length = 866 Score = 41.7 bits (97), Expect = 0.034, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +GI+ F+P + ++ + +S P + A Sbjct: 192 AKEVMVTGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPQIVKAYAYAIVEGLQ 242 >gi|329849782|ref|ZP_08264628.1| 1,4-B-D-glucan glucohydrolase [Asticcacaulis biprosthecum C19] gi|328841693|gb|EGF91263.1| 1,4-B-D-glucan glucohydrolase [Asticcacaulis biprosthecum C19] Length = 898 Score = 41.7 bits (97), Expect = 0.034, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK + +G++ F+P + + + +S PA + Sbjct: 233 AKEMAVAGVDWTFAPTVAVARDKR--WGRAYESYSENPADVAAYSGYMVEGLQ 283 >gi|268612262|pdb|3F93|A Chain A, Crystal Structure Of Exo-1,31,4-Beta-Glucanase (Exop) From Pseudoalteromonas Sp. Bb1 gi|268612263|pdb|3F93|B Chain B, Crystal Structure Of Exo-1,31,4-Beta-Glucanase (Exop) From Pseudoalteromonas Sp. Bb1 gi|268612264|pdb|3F93|C Chain C, Crystal Structure Of Exo-1,31,4-Beta-Glucanase (Exop) From Pseudoalteromonas Sp. Bb1 gi|268612265|pdb|3F93|D Chain D, Crystal Structure Of Exo-1,31,4-Beta-Glucanase (Exop) From Pseudoalteromonas Sp. Bb1 gi|268612266|pdb|3F94|A Chain A, Crystal Structure Of Truncated Exo-1,31,4-Beta-Glucanase (Exop) From Pseudoalteromonas Sp. Bb1 Length = 822 Score = 41.7 bits (97), Expect = 0.034, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK + +GI +F+P + ++ + +S P + A Sbjct: 147 AKEVAATGIEWSFAPTVAVVRDDR--WGRTYESYSEDPDLVKRYAGEMVTGIQ 197 >gi|86277468|gb|ABC88234.1| exo-1,3/1,4-beta-glucanase [Pseudoalteromonas sp. BB1] Length = 840 Score = 41.7 bits (97), Expect = 0.034, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK + +GI +F+P + ++ + +S P + A Sbjct: 173 AKEVAATGIEWSFAPTVAVVRDDR--WGRTYESYSEDPDLVKRYAGEMVTGIQ 223 >gi|257456932|ref|ZP_05622113.1| glycosyl hydrolase, family 3 [Treponema vincentii ATCC 35580] gi|257445641|gb|EEV20703.1| glycosyl hydrolase, family 3 [Treponema vincentii ATCC 35580] Length = 451 Score = 41.7 bits (97), Expect = 0.034, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + + G+ +N +PV + FS P +A + A R K Sbjct: 198 LGQQMRELGLRLNLAPVAEAGTEETAAALGT-RTFSSEPEQAGQYAAAAVRGMQK 251 >gi|326800527|ref|YP_004318346.1| beta-glucosidase [Sphingobacterium sp. 21] gi|326551291|gb|ADZ79676.1| Beta-glucosidase [Sphingobacterium sp. 21] Length = 795 Score = 41.7 bits (97), Expect = 0.034, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A G +V + P+LDL P ++ + P + + + Sbjct: 175 IAAETRAVGGHVGYGPILDLAREPR--WSRLEETYGEDPVLNAKMGRAMVTGFQ 226 >gi|315640488|ref|ZP_07895596.1| beta-glucosidase [Enterococcus italicus DSM 15952] gi|315483692|gb|EFU74180.1| beta-glucosidase [Enterococcus italicus DSM 15952] Length = 708 Score = 41.7 bits (97), Expect = 0.035, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK +GI+V FSP+ D + + P A + R Y Sbjct: 119 AKEAADAGIHVTFSPMADHVTDAR--WGRVLESSGEDPRLAARLTAAYVRGYQ 169 >gi|315923712|ref|ZP_07919952.1| periplasmic beta-glucosidase [Bacteroides sp. D2] gi|313697587|gb|EFS34422.1| periplasmic beta-glucosidase [Bacteroides sp. D2] Length = 605 Score = 41.7 bits (97), Expect = 0.035, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A GIN FSP++D+ + P A+ + R Y N Sbjct: 52 AIEASADGINWTFSPMVDICRDAR--WGRIAEGSGEDPYLGSLMAKAYVRGYQGN 104 >gi|298243983|ref|ZP_06967790.1| glycoside hydrolase family 3 domain protein [Ktedonobacter racemifer DSM 44963] gi|297557037|gb|EFH90901.1| glycoside hydrolase family 3 domain protein [Ktedonobacter racemifer DSM 44963] Length = 604 Score = 41.7 bits (97), Expect = 0.035, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A++L+ GIN N +P +D+ Q F A + R+ + Sbjct: 370 AQDLLALGINTNLAPSVDVALVQG--PGQATRTFGYTADSVINFAGPYIRSMQQ 421 >gi|295085473|emb|CBK66996.1| Beta-glucosidase-related glycosidases [Bacteroides xylanisolvens XB1A] Length = 730 Score = 41.7 bits (97), Expect = 0.035, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A GIN FSP++D+ + P A+ + R Y N Sbjct: 114 AIEASADGINWTFSPMVDICRDAR--WGRIAEGSGEDPYLGSLMAKAYVRGYQGN 166 >gi|260175480|ref|ZP_05761892.1| periplasmic beta-glucosidase precursor [Bacteroides sp. D2] Length = 607 Score = 41.7 bits (97), Expect = 0.035, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A GIN FSP++D+ + P A+ + R Y N Sbjct: 54 AIEASADGINWTFSPMVDICRDAR--WGRIAEGSGEDPYLGSLMAKAYVRGYQGN 106 >gi|255931085|ref|XP_002557099.1| Pc12g02050 [Penicillium chrysogenum Wisconsin 54-1255] gi|211581718|emb|CAP79832.1| Pc12g02050 [Penicillium chrysogenum Wisconsin 54-1255] Length = 358 Score = 41.7 bits (97), Expect = 0.035, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 16/53 (30%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A L T NVN +PVLD+ F FS F Sbjct: 136 ASTLATYKNNVNLAPVLDVYREAGDFADASERSFSNSSRVVGTCGSAFISAQQ 188 >gi|158315093|ref|YP_001507601.1| glycoside hydrolase family 3 protein [Frankia sp. EAN1pec] gi|158110498|gb|ABW12695.1| glycoside hydrolase family 3 domain protein [Frankia sp. EAN1pec] Length = 1037 Score = 41.7 bits (97), Expect = 0.035, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + G V+ PVLDL P + F P R Sbjct: 157 AREARSVGSTVSLGPVLDLARDPRY--GRVEEFFGEDPYLVGRMGVAAVRGLQ 207 >gi|312621303|ref|YP_004022916.1| glycoside hydrolase family 3 domain-containing protein [Caldicellulosiruptor kronotskyensis 2002] gi|312201770|gb|ADQ45097.1| glycoside hydrolase family 3 domain protein [Caldicellulosiruptor kronotskyensis 2002] Length = 770 Score = 41.7 bits (97), Expect = 0.035, Method: Composition-based stats. Identities = 6/54 (11%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G + +P++D+ + F P A + + Sbjct: 128 IKTQMKAVGAHQALAPLIDVARDAR--WGRVEETFGEDPYLVANMAVSYVKGIQ 179 >gi|323359365|ref|YP_004225761.1| beta-glucosidase-related glycosidase [Microbacterium testaceum StLB037] gi|323275736|dbj|BAJ75881.1| beta-glucosidase-related glycosidase [Microbacterium testaceum StLB037] Length = 385 Score = 41.7 bits (97), Expect = 0.036, Method: Composition-based stats. Identities = 11/46 (23%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Query: 2 AKNLVTSGINVNFSPVLDLLYGP-----ETFIAQKRSIFSRIPAKA 42 L +G+N+N +PV D++ P I Q + A Sbjct: 163 GGQLAQAGVNMNLAPVADVVTSPETAQSNPPIGQLDRQYGYDGATV 208 >gi|322368904|ref|ZP_08043471.1| glycoside hydrolase family 3 domain protein [Haladaptatus paucihalophilus DX253] gi|320551635|gb|EFW93282.1| glycoside hydrolase family 3 domain protein [Haladaptatus paucihalophilus DX253] Length = 749 Score = 41.7 bits (97), Expect = 0.036, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++ + +G + NFSPV DL P + FS P A + R Y + Sbjct: 148 SRTMRVTGTHWNFSPVADLQRDPR--WGRFYEGFSEDPYLASQLVAAKVRGYEE 199 >gi|224025503|ref|ZP_03643869.1| hypothetical protein BACCOPRO_02243 [Bacteroides coprophilus DSM 18228] gi|224018739|gb|EEF76737.1| hypothetical protein BACCOPRO_02243 [Bacteroides coprophilus DSM 18228] Length = 787 Score = 41.7 bits (97), Expect = 0.036, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G N+ + PVLD+ P ++ F P F + Sbjct: 170 IGLEARLQGANIGYGPVLDIAREPR--WSRVEETFGEDPYLTGILGTAFVQGMQ 221 >gi|215778405|ref|YP_002261545.1| putative beta-N-acetylhexosaminidase precursor [Aliivibrio salmonicida LFI1238] gi|208011450|emb|CAQ81914.1| putative beta-N-acetylhexosaminidase precursor [Aliivibrio salmonicida LFI1238] Length = 729 Score = 41.7 bits (97), Expect = 0.036, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 15/57 (26%), Gaps = 2/57 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYG--PETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + L G+NV PVLD F A F R N Sbjct: 155 GRQLENVGVNVILGPVLDKDSKLQGTRNTNLMNRSFGSDSKVISVFASEFIRGVSNN 211 >gi|332883853|gb|EGK04133.1| hypothetical protein HMPREF9456_01161 [Dysgonomonas mossii DSM 22836] Length = 780 Score = 41.7 bits (97), Expect = 0.036, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 ++K + G ++ + PVLDL ++ + P + + F + Sbjct: 170 ISKEARSQGSHIGYGPVLDLAREAR--WSRVEETYGEDPVLISKMGEAFVTGF 220 >gi|255690486|ref|ZP_05414161.1| periplasmic beta-glucosidase [Bacteroides finegoldii DSM 17565] gi|260623937|gb|EEX46808.1| periplasmic beta-glucosidase [Bacteroides finegoldii DSM 17565] Length = 1365 Score = 41.7 bits (97), Expect = 0.037, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A L G+ SP +D++ + F P + Y+ N Sbjct: 665 IADELHAVGMRQVLSPCIDVVRDLR--WGRVEESFGEDPYLCGRFGIAEVKGYMDN 718 >gi|284045073|ref|YP_003395413.1| glycoside hydrolase [Conexibacter woesei DSM 14684] gi|283949294|gb|ADB52038.1| glycoside hydrolase family 3 domain protein [Conexibacter woesei DSM 14684] Length = 367 Score = 41.7 bits (97), Expect = 0.037, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+NL G+NVN +PVLDL P ++ ++ A F+ Sbjct: 151 ARNLSGVGVNVNLAPVLDLGL-PGSYQRSTERSYAATAAGVSRIGGAFADGLRD 203 >gi|227821247|ref|YP_002825217.1| beta-glucosidase [Sinorhizobium fredii NGR234] gi|227340246|gb|ACP24464.1| beta-glucosidase [Sinorhizobium fredii NGR234] Length = 814 Score = 41.7 bits (97), Expect = 0.037, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + + G +V+ +P +++ + +S P E A F Sbjct: 85 LAEEVQSKGAHVSLAPTINIQRSVTN--GRNFECYSEDPVLTAELAVGFIEGMQ 136 >gi|297172333|gb|ADI23309.1| beta-glucosidase-related glycosidases [uncultured nuHF2 cluster bacterium HF0770_19K18] Length = 344 Score = 41.7 bits (97), Expect = 0.038, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N+ F+PV+D+ P+ + P F R Sbjct: 137 AIEAKAFGVNMIFAPVVDINNNPDNP-IINFRSYGDDPRLVSIFGNSFIRGVQ 188 >gi|239995512|ref|ZP_04716036.1| glucan 1,4-beta-glucosidase [Alteromonas macleodii ATCC 27126] Length = 841 Score = 41.7 bits (97), Expect = 0.038, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G++ F+P L + + FS PA A+ Sbjct: 180 ATEMRVTGLDWTFAPTLAVARNSR--WGRTYESFSEDPAIVASYAEPLVSGIQ 230 >gi|332883159|gb|EGK03442.1| hypothetical protein HMPREF9456_01509 [Dysgonomonas mossii DSM 22836] Length = 777 Score = 41.7 bits (97), Expect = 0.038, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK GI SP +DL P F F P A + A+ + + Sbjct: 230 AKEYRALGIATALSPQIDLGTEPRWFRINM--TFGESPELATDMARAYIDGFQ 280 >gi|319407546|emb|CBI81196.1| Glycoside hydrolase, family 3-like [Bartonella sp. 1-1C] Length = 344 Score = 41.3 bits (96), Expect = 0.039, Method: Composition-based stats. Identities = 14/77 (18%), Positives = 26/77 (33%), Gaps = 24/77 (31%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAK-------------------A 42 A +L+ GIN N P+LD+ + +S+ P Sbjct: 113 AFDLMKYGINANCLPILDVPVAGAHDVIGT-RAYSQDPQAVAALGRAAAQGLLDGGVLPV 171 Query: 43 EE----SAQLFSRTYIK 55 + + FS T+++ Sbjct: 172 IKHIPGHGRAFSDTHLE 188 >gi|298244529|ref|ZP_06968335.1| glycoside hydrolase family 3 domain protein [Ktedonobacter racemifer DSM 44963] gi|297552010|gb|EFH85875.1| glycoside hydrolase family 3 domain protein [Ktedonobacter racemifer DSM 44963] Length = 783 Score = 41.3 bits (96), Expect = 0.039, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ G +PVLD+ P + + P + R Sbjct: 138 IRAQMLAVGARHALAPVLDVARDPR--WGRVEETYGEDPVLIGALGSAYVRGLQ 189 >gi|220930769|ref|YP_002507678.1| glycoside hydrolase [Clostridium cellulolyticum H10] gi|220001097|gb|ACL77698.1| glycoside hydrolase family 3 domain protein [Clostridium cellulolyticum H10] Length = 639 Score = 41.3 bits (96), Expect = 0.039, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L G++ FSP + + + FS P A Sbjct: 177 ADELKAIGVDWTFSPCVAVSNDIR--WGRDYECFSETPDLVTMMATALITELQN 228 >gi|294847486|gb|ADF43753.1| beta-glucosidase [uncultured bacterium] Length = 844 Score = 41.3 bits (96), Expect = 0.039, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +GI+ F+P + ++ + +S P + Sbjct: 182 AKEVLATGIDWIFAPTVAVVRNDR--WGRTYEGYSEDPDIVRAYSAAIVHGLQ 232 >gi|302539932|ref|ZP_07292274.1| periplasmic beta-glucosidase [Streptomyces hygroscopicus ATCC 53653] gi|302457550|gb|EFL20643.1| periplasmic beta-glucosidase [Streptomyces himastatinicus ATCC 53653] Length = 764 Score = 41.3 bits (96), Expect = 0.040, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++G++ FSP++D+ + P + P A +R Y Sbjct: 157 AKEARSNGVHWAFSPMMDVTHEPR--WGRISEGSGEDPHLTAAIAAAKTRGYQ 207 >gi|160884966|ref|ZP_02065969.1| hypothetical protein BACOVA_02958 [Bacteroides ovatus ATCC 8483] gi|156109316|gb|EDO11061.1| hypothetical protein BACOVA_02958 [Bacteroides ovatus ATCC 8483] Length = 774 Score = 41.3 bits (96), Expect = 0.040, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A GIN FSP++D+ + P A+ + R Y N Sbjct: 158 AIEASADGINWTFSPMVDICRDAR--WGRIAEGSGEDPYLGSLMARAYVRGYQGN 210 >gi|221133597|ref|ZP_03559902.1| glucan 1,4-beta-glucosidase [Glaciecola sp. HTCC2999] Length = 844 Score = 41.3 bits (96), Expect = 0.040, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +GI+ F+P + ++ + +S P + Sbjct: 182 AKEVLATGIDWIFAPTVAVVRNDR--WGRTYEGYSEDPDIVRAYSAAIVHGLQ 232 >gi|332829860|gb|EGK02502.1| hypothetical protein HMPREF9455_01459 [Dysgonomonas gadei ATCC BAA-286] Length = 796 Score = 41.3 bits (96), Expect = 0.040, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A ++G+N F+P+LD+ + P + R + N Sbjct: 185 AIEARSTGVNWTFAPMLDISRDAR--WGRIAESLGEDPYLGGQLGAAMVRGFQGN 237 >gi|323478365|gb|ADX83603.1| glycoside hydrolase family 3 domain protein [Sulfolobus islandicus HVE10/4] Length = 754 Score = 41.3 bits (96), Expect = 0.040, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 16/57 (28%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 + G+N SPVLD+ P + + P + N Sbjct: 126 IRSQGRLVGVNQCLSPVLDVCKDPR--WGRCEETYGEDPYLVASMGLAYITGLQGDN 180 >gi|190574495|ref|YP_001972340.1| putative glucan 1,4-beta-glucosidase [Stenotrophomonas maltophilia K279a] gi|190012417|emb|CAQ46045.1| putative glucan 1,4-beta-glucosidase [Stenotrophomonas maltophilia K279a] Length = 862 Score = 41.3 bits (96), Expect = 0.040, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +G+ F+P + + + + +S PA A F Sbjct: 194 AAETRVTGMEWTFAPTVAV--PQDDRWGRTYEGYSEDPALVASYAGAFVEGLQ 244 >gi|225571237|ref|ZP_03780235.1| hypothetical protein CLOHYLEM_07326 [Clostridium hylemonae DSM 15053] gi|225160068|gb|EEG72687.1| hypothetical protein CLOHYLEM_07326 [Clostridium hylemonae DSM 15053] Length = 716 Score = 41.3 bits (96), Expect = 0.041, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++V FSP+ DL+ P + P A F + Y Sbjct: 120 AREASVSGVHVVFSPMADLVRDPR--WGRVMESTGEDPLLNSFFATAFVKGYQ 170 >gi|325193408|emb|CCA27737.1| unnamed protein product [Albugo laibachii Nc14] Length = 812 Score = 41.3 bits (96), Expect = 0.041, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 ++ + +GI+ F+P+LD+ + A+ F R N Sbjct: 198 GRDTLAAGISWVFAPILDVSRNV--YWARTYETFGEDSHLVSVMGDASIRGLQNN 250 >gi|284998833|ref|YP_003420601.1| glycoside hydrolase, family 3 domain protein [Sulfolobus islandicus L.D.8.5] gi|284446729|gb|ADB88231.1| glycoside hydrolase, family 3 domain protein [Sulfolobus islandicus L.D.8.5] Length = 754 Score = 41.3 bits (96), Expect = 0.041, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 16/57 (28%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 + G+N SPVLD+ P + + P + N Sbjct: 126 IRSQGRLVGVNQCLSPVLDVCKDPR--WGRCEETYGEDPYLVASMGLAYITGLQGDN 180 >gi|260888543|ref|ZP_05899806.1| beta-hexosaminidase [Selenomonas sputigena ATCC 35185] gi|260861740|gb|EEX76240.1| beta-hexosaminidase [Selenomonas sputigena ATCC 35185] Length = 408 Score = 41.3 bits (96), Expect = 0.041, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 19/54 (35%), Gaps = 7/54 (12%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L G N+NF+PV DL A ++ A A + + Sbjct: 185 AHGLKAMGFNLNFAPVADLG-------ATYGRSYADDAATATKFVAAALEGHAD 231 >gi|229580225|ref|YP_002838625.1| glycoside hydrolase family 3 domain protein [Sulfolobus islandicus Y.G.57.14] gi|229581131|ref|YP_002839530.1| glycoside hydrolase family 3 domain protein [Sulfolobus islandicus Y.N.15.51] gi|228010941|gb|ACP46703.1| glycoside hydrolase family 3 domain protein [Sulfolobus islandicus Y.G.57.14] gi|228011847|gb|ACP47608.1| glycoside hydrolase family 3 domain protein [Sulfolobus islandicus Y.N.15.51] Length = 754 Score = 41.3 bits (96), Expect = 0.041, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 16/57 (28%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 + G+N SPVLD+ P + + P + N Sbjct: 126 IRSQGRLVGVNQCLSPVLDVCKDPR--WGRCEETYGEDPYLVASMGLAYITGLQGDN 180 >gi|227831319|ref|YP_002833099.1| glycoside hydrolase family 3 domain protein [Sulfolobus islandicus L.S.2.15] gi|227457767|gb|ACP36454.1| glycoside hydrolase family 3 domain protein [Sulfolobus islandicus L.S.2.15] Length = 754 Score = 41.3 bits (96), Expect = 0.041, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 16/57 (28%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 + G+N SPVLD+ P + + P + N Sbjct: 126 IRSQGRLVGVNQCLSPVLDVCKDPR--WGRCEETYGEDPYLVASMGLAYITGLQGDN 180 >gi|332669102|ref|YP_004452110.1| glycoside hydrolase family 3 domain-containing protein [Cellulomonas fimi ATCC 484] gi|332338140|gb|AEE44723.1| glycoside hydrolase family 3 domain protein [Cellulomonas fimi ATCC 484] Length = 1745 Score = 41.3 bits (96), Expect = 0.043, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G+ F+P L + + F PA A+ Sbjct: 955 AAEVRATGVPWTFAPCLCVTRDER--WGRSYESFGEDPALVTAMARAAVTGLQ 1005 >gi|330838156|ref|YP_004412736.1| glycoside hydrolase family 3 domain protein [Selenomonas sputigena ATCC 35185] gi|329745920|gb|AEB99276.1| glycoside hydrolase family 3 domain protein [Selenomonas sputigena ATCC 35185] Length = 398 Score = 41.3 bits (96), Expect = 0.045, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 19/54 (35%), Gaps = 7/54 (12%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L G N+NF+PV DL A ++ A A + + Sbjct: 175 AHGLKAMGFNLNFAPVADLG-------ATYGRSYADDAATATKFVAAALEGHAD 221 >gi|315639879|ref|ZP_07895010.1| beta-glucosidase [Enterococcus italicus DSM 15952] gi|315484304|gb|EFU74769.1| beta-glucosidase [Enterococcus italicus DSM 15952] Length = 716 Score = 41.3 bits (96), Expect = 0.045, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK SG++V FSP++DL+ P + A+ F + Y Sbjct: 120 AKEAAVSGLHVTFSPMVDLVRDPR--WGRVMESTGEDAFLNARFAEAFVKGYQ 170 >gi|295838202|ref|ZP_06825135.1| periplasmic beta-glucosidase [Streptomyces sp. SPB74] gi|295826910|gb|EDY43592.2| periplasmic beta-glucosidase [Streptomyces sp. SPB74] Length = 801 Score = 41.3 bits (96), Expect = 0.045, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ ++G++ F+P++D+ + P + P R Y Sbjct: 201 AEEARSTGVHWTFNPMMDVCHEPR--WGRIAESAGEDPYLTSVLTAAKVRGYQ 251 >gi|167623453|ref|YP_001673747.1| glycoside hydrolase family 3 protein [Shewanella halifaxensis HAW-EB4] gi|167353475|gb|ABZ76088.1| glycoside hydrolase family 3 domain protein [Shewanella halifaxensis HAW-EB4] Length = 849 Score = 41.3 bits (96), Expect = 0.045, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +GI+ F+P + ++ + +S P + A R Sbjct: 185 AKEVMVTGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPQIVKAYAASIVRGLQ 235 >gi|294647020|ref|ZP_06724634.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides ovatus SD CC 2a] gi|294807809|ref|ZP_06766598.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides xylanisolvens SD CC 1b] gi|292637629|gb|EFF56033.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides ovatus SD CC 2a] gi|294444985|gb|EFG13663.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides xylanisolvens SD CC 1b] Length = 730 Score = 41.3 bits (96), Expect = 0.045, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A GIN FSP++D+ + P A+ + R Y N Sbjct: 114 AIEASADGINWTFSPMVDICRDGR--WGRIAEGNGEDPYLGSLMAKAYVRGYQGN 166 >gi|237717352|ref|ZP_04547833.1| periplasmic beta-glucosidase [Bacteroides sp. D1] gi|262406117|ref|ZP_06082667.1| periplasmic beta-glucosidase [Bacteroides sp. 2_1_22] gi|229443335|gb|EEO49126.1| periplasmic beta-glucosidase [Bacteroides sp. D1] gi|262356992|gb|EEZ06082.1| periplasmic beta-glucosidase [Bacteroides sp. 2_1_22] Length = 759 Score = 41.3 bits (96), Expect = 0.045, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A GIN FSP++D+ + P A+ + R Y N Sbjct: 143 AIEASADGINWTFSPMVDICRDGR--WGRIAEGNGEDPYLGSLMAKAYVRGYQGN 195 >gi|294506264|ref|YP_003570322.1| beta-N-acetylglucosaminidase [Salinibacter ruber M8] gi|294342592|emb|CBH23370.1| beta-N-acetylglucosaminidase [Salinibacter ruber M8] Length = 979 Score = 41.3 bits (96), Expect = 0.046, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ G++ ++PV D+ P+ I F P+ A F+R Sbjct: 173 AREARALGVHQLYAPVADVNNNPKNPIINV-RSFGESPSLVGTMASAFTRGAQ 224 >gi|255689965|ref|ZP_05413640.1| beta-glucosidase [Bacteroides finegoldii DSM 17565] gi|260624572|gb|EEX47443.1| beta-glucosidase [Bacteroides finegoldii DSM 17565] Length = 688 Score = 41.3 bits (96), Expect = 0.046, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A+ SG++ FSP++D+ P + + P R Y N Sbjct: 102 AQEARMSGVDWTFSPMIDVARDPR--WGRVAEGYGEDPYANGVFGAASVRGYQGDN 155 >gi|261406977|ref|YP_003243218.1| glycoside hydrolase family 3 domain-containing protein [Paenibacillus sp. Y412MC10] gi|261283440|gb|ACX65411.1| glycoside hydrolase family 3 domain protein [Paenibacillus sp. Y412MC10] Length = 734 Score = 41.3 bits (96), Expect = 0.046, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A SGINV F+P+ DL+ P + P A R + Sbjct: 133 AAEGAASGINVTFAPMADLVRDPR--WGRVMESPGEDPYLNGLMAAAMVRGFQ 183 >gi|146340887|ref|YP_001205935.1| putative beta-hexosaminidase [Bradyrhizobium sp. ORS278] gi|146193693|emb|CAL77710.1| putative Beta-hexosaminidase [Bradyrhizobium sp. ORS278] Length = 449 Score = 41.3 bits (96), Expect = 0.046, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 22/57 (38%), Gaps = 5/57 (8%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPET-----FIAQKRSIFSRIPAKAEESAQLFSRTY 53 ++L +GI +N +PV+DL R S PA + A + R Sbjct: 209 GRSLAAAGITLNLAPVVDLRPRWTHNRFDFHTLINRRAISSDPAVVADIALGYVRGL 265 >gi|83815520|ref|YP_444518.1| beta-N-acetylglucosaminidase [Salinibacter ruber DSM 13855] gi|83756914|gb|ABC45027.1| beta-N-acetylglucosaminidase [Salinibacter ruber DSM 13855] Length = 979 Score = 41.3 bits (96), Expect = 0.046, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ G++ ++PV D+ P+ I F P+ A F+R Sbjct: 173 AREARALGVHQLYAPVADVNNNPKNPIINV-RSFGESPSLVGTMASAFTRGAQ 224 >gi|332886013|gb|EGK06257.1| hypothetical protein HMPREF9456_00131 [Dysgonomonas mossii DSM 22836] Length = 796 Score = 41.3 bits (96), Expect = 0.046, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A ++G+ F+P+LD+ + P A + + N Sbjct: 185 AVEARSTGVTWTFAPMLDISRDAR--WGRIAESLGEDPYLAGILGAAMVKGFQGN 237 >gi|323358163|ref|YP_004224559.1| beta-glucosidase-related glycosidase [Microbacterium testaceum StLB037] gi|323274534|dbj|BAJ74679.1| beta-glucosidase-related glycosidase [Microbacterium testaceum StLB037] Length = 715 Score = 41.3 bits (96), Expect = 0.046, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + G+ FSP+ D+ P + F P R Y Sbjct: 106 ATEARSGGVTWTFSPMADVSRDPR--WGRVSEGFGEDPWLTSLLVAAMVRGYQ 156 >gi|268593381|ref|ZP_06127602.1| beta-hexosaminidase A [Providencia rettgeri DSM 1131] gi|291311079|gb|EFE51532.1| beta-hexosaminidase A [Providencia rettgeri DSM 1131] Length = 626 Score = 41.3 bits (96), Expect = 0.046, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L + G N+NF PV+D+ + +S A + + K Sbjct: 163 GYELSSLGFNINFGPVVDVNNNQNNPVIGV-RSYSDDKNLVGTLATSYIQGIHK 215 >gi|220931263|ref|YP_002508171.1| beta-N-acetylhexosaminidase [Halothermothrix orenii H 168] gi|219992573|gb|ACL69176.1| beta-N-acetylhexosaminidase [Halothermothrix orenii H 168] Length = 618 Score = 41.3 bits (96), Expect = 0.046, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK + +G + NF P + + + F P + A + R Sbjct: 167 AKEVSATGPDWNFGPCVAVARDER--WGRTYESFGEHPELQKLLAGAYVRGLQ 217 >gi|329962701|ref|ZP_08300624.1| glycosyl hydrolase family 3 protein [Bacteroides fluxus YIT 12057] gi|328529535|gb|EGF56438.1| glycosyl hydrolase family 3 protein [Bacteroides fluxus YIT 12057] Length = 775 Score = 41.3 bits (96), Expect = 0.046, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 M + ++ GI+V +P +++ P + +S P + A F R KN Sbjct: 137 MGEEVLDYGIDVLLAPGMNIHRSPLC--GRNFEYYSEDPLVTGKMAAAFVRGIQKN 190 >gi|317509174|ref|ZP_07966798.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Segniliparus rugosus ATCC BAA-974] gi|316252531|gb|EFV11977.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Segniliparus rugosus ATCC BAA-974] Length = 412 Score = 41.3 bits (96), Expect = 0.047, Method: Composition-based stats. Identities = 10/38 (26%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIP 39 + L G+ V+F+P D+ G + FS P Sbjct: 145 GRKLRGLGVTVDFAPDADVFAGDANTVIG-DRSFSGDP 181 >gi|295133459|ref|YP_003584135.1| beta-glucosidase [Zunongwangia profunda SM-A87] gi|294981474|gb|ADF51939.1| beta-glucosidase [Zunongwangia profunda SM-A87] Length = 782 Score = 41.3 bits (96), Expect = 0.047, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 M + + G++V +P L++ P + +S P + + A + + + Sbjct: 138 MGEEVKEYGVDVLLAPALNIHRNPLN--GRNFEYYSEDPLVSGKIASAYIKGIQSH 191 >gi|301117000|ref|XP_002906228.1| lysosomal beta glucosidase, putative [Phytophthora infestans T30-4] gi|262107577|gb|EEY65629.1| lysosomal beta glucosidase, putative [Phytophthora infestans T30-4] Length = 1148 Score = 41.3 bits (96), Expect = 0.047, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 ++ +GI F P+LDL P A+ F P + R N Sbjct: 559 GRDTEAAGIPWVFGPILDLSQNPL--WARTYETFGEDPYLSSVMGDAIIRGLQSN 611 >gi|293377275|ref|ZP_06623480.1| glycosyl hydrolase family 3 C-terminal domain protein [Enterococcus faecium PC4.1] gi|292644136|gb|EFF62241.1| glycosyl hydrolase family 3 C-terminal domain protein [Enterococcus faecium PC4.1] Length = 766 Score = 41.3 bits (96), Expect = 0.047, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MAK L G+++ LDL P + F P + ++ R + Sbjct: 153 MAKELAAKGVHLALVSTLDLAKDPR--WGRTEECFGEDPILSARFSEAVVRGFQ 204 >gi|257892824|ref|ZP_05672477.1| beta-glucosidase [Enterococcus faecium 1,231,408] gi|257829203|gb|EEV55810.1| beta-glucosidase [Enterococcus faecium 1,231,408] Length = 766 Score = 41.3 bits (96), Expect = 0.047, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MAK L G+++ LDL P + F P + ++ R + Sbjct: 153 MAKELAAKGVHLALVSTLDLAKDPR--WGRTEECFGEDPILSARFSEAVVRGFQ 204 >gi|257886613|ref|ZP_05666266.1| beta-glucosidase [Enterococcus faecium 1,141,733] gi|257822667|gb|EEV49599.1| beta-glucosidase [Enterococcus faecium 1,141,733] Length = 766 Score = 41.3 bits (96), Expect = 0.047, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MAK L G+++ LDL P + F P + ++ R + Sbjct: 153 MAKELAAKGVHLALVSTLDLAKDPR--WGRTEECFGEDPILSARFSEAVVRGFQ 204 >gi|227552218|ref|ZP_03982267.1| beta-glucosidase [Enterococcus faecium TX1330] gi|257895194|ref|ZP_05674847.1| beta-glucosidase [Enterococcus faecium Com12] gi|257897815|ref|ZP_05677468.1| beta-glucosidase [Enterococcus faecium Com15] gi|227178650|gb|EEI59622.1| beta-glucosidase [Enterococcus faecium TX1330] gi|257831759|gb|EEV58180.1| beta-glucosidase [Enterococcus faecium Com12] gi|257835727|gb|EEV60801.1| beta-glucosidase [Enterococcus faecium Com15] Length = 766 Score = 41.3 bits (96), Expect = 0.047, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MAK L G+++ LDL P + F P + ++ R + Sbjct: 153 MAKELAAKGVHLALVSTLDLAKDPR--WGRTEECFGEDPILSARFSEAVVRGFQ 204 >gi|90416747|ref|ZP_01224677.1| 1,4-beta-D-glucan glucohydrolase D [marine gamma proteobacterium HTCC2207] gi|90331500|gb|EAS46736.1| 1,4-beta-D-glucan glucohydrolase D [marine gamma proteobacterium HTCC2207] Length = 931 Score = 41.3 bits (96), Expect = 0.048, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI+ F+P L ++ + +S P A Sbjct: 311 ALEVAVTGIDWVFAPTLAVVRNDS--WGRTYESYSEDPEIVRAYAGEVVSGLQ 361 >gi|329963878|ref|ZP_08301220.1| glycosyl hydrolase family 3 protein [Bacteroides fluxus YIT 12057] gi|328527131|gb|EGF54137.1| glycosyl hydrolase family 3 protein [Bacteroides fluxus YIT 12057] Length = 766 Score = 41.3 bits (96), Expect = 0.049, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK + ++ F+P +++ + F P + Y Sbjct: 169 AKEMRAMNMHWTFNPNVEVARDAR--WGRVGETFGEDPYLVTRMGVQSVKGYQ 219 >gi|295133457|ref|YP_003584133.1| BglY [Zunongwangia profunda SM-A87] gi|294981472|gb|ADF51937.1| BglY [Zunongwangia profunda SM-A87] Length = 771 Score = 41.3 bits (96), Expect = 0.050, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK GI SP +DL P + +FS P + + + + Sbjct: 226 AKEYRALGITTALSPQIDLGTEPRWYRIAY--VFSESPELVKAMGKAYVEGFQ 276 >gi|296806455|ref|XP_002844037.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Arthroderma otae CBS 113480] gi|238845339|gb|EEQ35001.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Arthroderma otae CBS 113480] Length = 374 Score = 41.3 bits (96), Expect = 0.050, Method: Composition-based stats. Identities = 11/40 (27%), Positives = 15/40 (37%) Query: 11 NVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 N N +PVLD+ FI + F E F+ Sbjct: 160 NGNLAPVLDIYREEGNFIDEFGRSFGNNAEIVSECGSAFA 199 >gi|212634477|ref|YP_002311002.1| family 3 glycoside hydrolase [Shewanella piezotolerans WP3] gi|212555961|gb|ACJ28415.1| Glycoside hydrolase, family 3 [Shewanella piezotolerans WP3] Length = 856 Score = 41.3 bits (96), Expect = 0.050, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +GI+ F+P + ++ + +S P A R Sbjct: 190 AKEVMVTGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPEIVGAYAASIVRGLQ 240 >gi|196250449|ref|ZP_03149141.1| glycoside hydrolase family 3 domain protein [Geobacillus sp. G11MC16] gi|196210108|gb|EDY04875.1| glycoside hydrolase family 3 domain protein [Geobacillus sp. G11MC16] Length = 457 Score = 41.3 bits (96), Expect = 0.050, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 16/54 (29%), Gaps = 7/54 (12%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L GI VNF+PVLDL F P A Q Sbjct: 223 GTELAAMGIQVNFAPVLDLSATDS-------RSFGEDPVLAGRLGQQVVTGLTD 269 >gi|237724508|ref|ZP_04554989.1| xylosidase/arabinosidase [Bacteroides sp. D4] gi|229437067|gb|EEO47144.1| xylosidase/arabinosidase [Bacteroides dorei 5_1_36/D4] Length = 769 Score = 40.9 bits (95), Expect = 0.051, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G N++ SP LDL P + + P A Sbjct: 153 IARETRSRGSNLSLSPNLDLARDPRY--GRTEETYGEDPYLASRMGVAIISGMQ 204 >gi|299147232|ref|ZP_07040297.1| beta-glucosidase [Bacteroides sp. 3_1_23] gi|298514510|gb|EFI38394.1| beta-glucosidase [Bacteroides sp. 3_1_23] Length = 759 Score = 40.9 bits (95), Expect = 0.052, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A GIN FSP++D+ + P A+ + R Y N Sbjct: 143 AIEASADGINWTFSPMVDICRDAR--WGRIAEGNGEDPYLGSLMAKAYVRGYQGN 195 >gi|300773468|ref|ZP_07083337.1| possible beta-glucosidase [Sphingobacterium spiritivorum ATCC 33861] gi|300759639|gb|EFK56466.1| possible beta-glucosidase [Sphingobacterium spiritivorum ATCC 33861] Length = 777 Score = 40.9 bits (95), Expect = 0.052, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 AK + G ++++ PVLDL P ++ + P A R Sbjct: 172 AKEVRQQGAHISYGPVLDLSRDPR--WSRVEESYGEDPVLTGTLAAAIVRGL 221 >gi|237720303|ref|ZP_04550784.1| periplasmic beta-glucosidase [Bacteroides sp. 2_2_4] gi|229450054|gb|EEO55845.1| periplasmic beta-glucosidase [Bacteroides sp. 2_2_4] Length = 759 Score = 40.9 bits (95), Expect = 0.052, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A GIN FSP++D+ + P A+ + R Y N Sbjct: 143 AIEASADGINWTFSPMVDICRDAR--WGRIAEGNGEDPYLGSLMAKAYVRGYQGN 195 >gi|325104888|ref|YP_004274542.1| glycoside hydrolase family 3 domain protein [Pedobacter saltans DSM 12145] gi|324973736|gb|ADY52720.1| glycoside hydrolase family 3 domain protein [Pedobacter saltans DSM 12145] Length = 768 Score = 40.9 bits (95), Expect = 0.052, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ G+N FSP++D+ P + P E A+ + Y Sbjct: 151 AQEATADGLNWTFSPMVDVSRDPR--WGRVSEGNGEDPFLGAEIAKAMVKGYQ 201 >gi|78926980|gb|ABB51613.1| beta-glucosidase [uncultured bacterium] Length = 852 Score = 40.9 bits (95), Expect = 0.052, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A+ L +G F+P + + + +S P A R NP Sbjct: 188 ARELRVTGQEWTFAPTIAVARDVR--WGRSYESYSENPEIFPAYAAAMVRGLQGNP 241 >gi|261416373|ref|YP_003250056.1| glycoside hydrolase family 3 domain protein [Fibrobacter succinogenes subsp. succinogenes S85] gi|261372829|gb|ACX75574.1| glycoside hydrolase family 3 domain protein [Fibrobacter succinogenes subsp. succinogenes S85] Length = 422 Score = 40.9 bits (95), Expect = 0.053, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Query: 1 MAKNLVTSGINVNFSPVLD---LLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + L IN+N +PVLD G +F+ + R + A + + F N Sbjct: 189 IGRALKDIRINMNLAPVLDPSKDHRGTNSFMEESRRSWGNDTTNAYKI-RAFVHGMRDN 246 >gi|325680688|ref|ZP_08160226.1| glycosyl hydrolase family 3 N-terminal domain protein [Ruminococcus albus 8] gi|324107468|gb|EGC01746.1| glycosyl hydrolase family 3 N-terminal domain protein [Ruminococcus albus 8] Length = 428 Score = 40.9 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L + G+NV+ +P D+ + I FS K Sbjct: 206 IGKYLASYGVNVDIAPCADISLNSDKVI---DKNFSADAGIVSNMVSAEIDGLHK 257 >gi|307266878|ref|ZP_07548398.1| glycoside hydrolase family 3 domain protein [Thermoanaerobacter wiegelii Rt8.B1] gi|306918087|gb|EFN48341.1| glycoside hydrolase family 3 domain protein [Thermoanaerobacter wiegelii Rt8.B1] Length = 639 Score = 40.9 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G +P+LD+ P + F P + R Sbjct: 138 IREQMKVVGARQALAPLLDVTRDPR--WGRTEETFGEDPYLVMSMGVSYIRGLQ 189 >gi|297191865|ref|ZP_06909263.1| glycosyl hydrolase [Streptomyces pristinaespiralis ATCC 25486] gi|297151104|gb|EDY67130.2| glycosyl hydrolase [Streptomyces pristinaespiralis ATCC 25486] Length = 1004 Score = 40.9 bits (95), Expect = 0.055, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK + +GI +F+P L + + F PA + + Sbjct: 453 AKEVRATGIPWDFAPCLCVTRDER--WGRSYEAFGEDPALVTAM-ETVIQGMQ 502 >gi|150003144|ref|YP_001297888.1| glycoside hydrolase family beta-glycosidase [Bacteroides vulgatus ATCC 8482] gi|149931568|gb|ABR38266.1| glycoside hydrolase family 3, candidate beta-glycosidase [Bacteroides vulgatus ATCC 8482] Length = 785 Score = 40.9 bits (95), Expect = 0.055, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A G N+ + PVLD+ P ++ F P + Sbjct: 176 IALEARLQGANIGYGPVLDVAREPR--WSRMEETFGEDPVLTTIMGVAMMKGMQ 227 >gi|317504940|ref|ZP_07962889.1| beta-glucosidase [Prevotella salivae DSM 15606] gi|315663932|gb|EFV03650.1| beta-glucosidase [Prevotella salivae DSM 15606] Length = 790 Score = 40.9 bits (95), Expect = 0.055, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A+ + G +++F PVLDL P ++ P + Sbjct: 175 IARQIRQQGAHISFGPVLDLTRDPR--WSRVEECMGEDPVLTAVIGASMVKGL 225 >gi|109900031|ref|YP_663286.1| glycoside hydrolase family protein [Pseudoalteromonas atlantica T6c] gi|109702312|gb|ABG42232.1| glycoside hydrolase, family 3-like protein [Pseudoalteromonas atlantica T6c] Length = 805 Score = 40.9 bits (95), Expect = 0.057, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ + G N +P+LD+ P + P E + + N Sbjct: 161 AQEVRARGGNQALTPILDVARDPR--WGRIEETMGEDPYLIGELGVSAVKGFQGN 213 >gi|319901343|ref|YP_004161071.1| glycoside hydrolase family 3 domain protein [Bacteroides helcogenes P 36-108] gi|319416374|gb|ADV43485.1| glycoside hydrolase family 3 domain protein [Bacteroides helcogenes P 36-108] Length = 781 Score = 40.9 bits (95), Expect = 0.058, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A G N+ + PVLD+ P ++ F P + Sbjct: 172 IALEARLQGANIGYGPVLDVAREPR--WSRMEETFGEDPVLTSVMGVALMKGMQ 223 >gi|297821180|ref|XP_002878473.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. lyrata] gi|297324311|gb|EFH54732.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. lyrata] Length = 644 Score = 40.9 bits (95), Expect = 0.058, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ + +G+ F+P + + P + +S PA + N Sbjct: 166 AQEVRATGVAQVFAPCVAVCRDPR--WGRCYESYSEDPAVVNMMTESIIDGLQGN 218 >gi|293372493|ref|ZP_06618877.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides ovatus SD CMC 3f] gi|299144770|ref|ZP_07037838.1| periplasmic beta-glucosidase [Bacteroides sp. 3_1_23] gi|292632676|gb|EFF51270.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides ovatus SD CMC 3f] gi|298515261|gb|EFI39142.1| periplasmic beta-glucosidase [Bacteroides sp. 3_1_23] Length = 735 Score = 40.9 bits (95), Expect = 0.058, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++ FSP++D+ P + + P + Y Sbjct: 149 AQEARMSGVDWTFSPMIDVARDPR--WGRVAEGYGEDPYTNGVFGAASVKGYQ 199 >gi|260173099|ref|ZP_05759511.1| glycoside hydrolase family 3 protein [Bacteroides sp. D2] gi|315921375|ref|ZP_07917615.1| conserved hypothetical protein [Bacteroides sp. D2] gi|313695250|gb|EFS32085.1| conserved hypothetical protein [Bacteroides sp. D2] Length = 735 Score = 40.9 bits (95), Expect = 0.058, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++ FSP++D+ P + + P + Y Sbjct: 149 AQEARMSGVDWTFSPMIDVARDPR--WGRVAEGYGEDPYTNGVFGAASVKGYQ 199 >gi|237721771|ref|ZP_04552252.1| glycoside hydrolase [Bacteroides sp. 2_2_4] gi|229448640|gb|EEO54431.1| glycoside hydrolase [Bacteroides sp. 2_2_4] Length = 735 Score = 40.9 bits (95), Expect = 0.058, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++ FSP++D+ P + + P + Y Sbjct: 149 AQEARMSGVDWTFSPMIDVARDPR--WGRVAEGYGEDPYTNGVFGAASVKGYQ 199 >gi|190895118|ref|YP_001985411.1| putative glycoside hydrolase [Rhizobium etli CIAT 652] gi|190700779|gb|ACE94861.1| putative glycoside hydrolase protein [Rhizobium etli CIAT 652] Length = 333 Score = 40.9 bits (95), Expect = 0.058, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA G+ + +PV D++ G ++ S P + Q F Sbjct: 120 MAVAARALGVALFLAPVADVVTG-TNPW-LEKRTMSSDPIEVARLVQAFVTGVQ 171 >gi|284036177|ref|YP_003386107.1| glycoside hydrolase [Spirosoma linguale DSM 74] gi|283815470|gb|ADB37308.1| glycoside hydrolase family 3 domain protein [Spirosoma linguale DSM 74] Length = 779 Score = 40.9 bits (95), Expect = 0.059, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 18/56 (32%), Gaps = 8/56 (14%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRS---IFSRIPAKAEESAQLFSRTYI 54 A GI SP +DL P + F P A + A+ + + Sbjct: 232 ATEYRALGIATALSPQVDLATDP-----RWNRVSGTFGEDPNLATDMARAYIDGFQ 282 >gi|43409|emb|CAA46499.1| 1,4-B-D-glucan glucohydrolase [Cellvibrio japonicus] Length = 869 Score = 40.9 bits (95), Expect = 0.059, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ FSP + + + +S P A Sbjct: 193 AREIAATGLDWYFSPTVAVARDDR--WGRTYESWSEDPQIVHAFAGKMVEGLQ 243 >gi|116624091|ref|YP_826247.1| glycoside hydrolase family 3 protein [Candidatus Solibacter usitatus Ellin6076] gi|116227253|gb|ABJ85962.1| glycoside hydrolase, family 3 domain protein [Candidatus Solibacter usitatus Ellin6076] Length = 601 Score = 40.9 bits (95), Expect = 0.059, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +GI F P + + + FS P E + R + Sbjct: 155 AEEIRATGIQWAFGPCVTVPQDIR--WGRTYEGFSEDPKLVRELSGPAVRGFQ 205 >gi|138896874|ref|YP_001127327.1| putative anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Geobacillus thermodenitrificans NG80-2] gi|134268387|gb|ABO68582.1| Putative anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase [Geobacillus thermodenitrificans NG80-2] Length = 460 Score = 40.9 bits (95), Expect = 0.061, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 15/54 (27%), Gaps = 7/54 (12%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L GI +NF+PVLDL F P Q Sbjct: 226 GTELAAMGIQINFAPVLDLSATDS-------RSFGEDPVLTGRLGQQVVTGLTD 272 >gi|148272221|ref|YP_001221782.1| beta-glucosidase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] gi|147830151|emb|CAN01080.1| putative beta-glucosidase (glycosyl hydrolase,family3) [Clavibacter michiganensis subsp. michiganensis NCPPB 382] Length = 828 Score = 40.9 bits (95), Expect = 0.063, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A G++V P ++L P + FS P + A + R +N Sbjct: 102 AVEARRKGVDVVLGPTINLHRSPYG--GRHFEAFSEDPLLTADLAAAYVRGVQEN 154 >gi|23009712|ref|ZP_00050660.1| COG1472: Beta-glucosidase-related glycosidases [Magnetospirillum magnetotacticum MS-1] Length = 498 Score = 40.9 bits (95), Expect = 0.063, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G++V +P +++ P + + +S P + R Sbjct: 99 AREARAHGVDVVLAPQVNIQRTP--VVGRHFECYSEDPYLTAQIGTGVVRGLQD 150 >gi|322833636|ref|YP_004213663.1| glycoside hydrolase family 3 domain protein [Rahnella sp. Y9602] gi|321168837|gb|ADW74536.1| glycoside hydrolase family 3 domain protein [Rahnella sp. Y9602] Length = 342 Score = 40.9 bits (95), Expect = 0.063, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA ++ I+++F+PVLD+ + I F P KA E A+ + Sbjct: 100 MASEMIVMDIDISFAPVLDIGH-ISAAIG--ERSFHAEPRKALEMAEQYILGMH 150 >gi|332308067|ref|YP_004435918.1| glycoside hydrolase family 3 domain protein [Glaciecola agarilytica 4H-3-7+YE-5] gi|332175396|gb|AEE24650.1| glycoside hydrolase family 3 domain protein [Glaciecola agarilytica 4H-3-7+YE-5] Length = 803 Score = 40.9 bits (95), Expect = 0.064, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + G N +P+LD+ P + P E + + Sbjct: 159 AEEVRARGGNQALTPILDVARDPR--WGRIEETMGEDPYLIAELGVSAVKGFQ 209 >gi|326385923|ref|ZP_08207548.1| glucan 1,4-beta-glucosidase precursor [Novosphingobium nitrogenifigens DSM 19370] gi|326209595|gb|EGD60387.1| glucan 1,4-beta-glucosidase precursor [Novosphingobium nitrogenifigens DSM 19370] Length = 762 Score = 40.9 bits (95), Expect = 0.065, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + G++ F+P L ++ + FS P + + Sbjct: 116 AEEIAVIGVDWAFAPTLAVVQDTR--WGRSYESFSEDPEQVAQMGVAEVEGLQ 166 >gi|290770114|gb|ADD61875.1| putative carbohydrate-active enzyme [uncultured organism] Length = 745 Score = 40.5 bits (94), Expect = 0.067, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A + G+N FSP++D+ + + P E A+ + R Y N Sbjct: 117 AIEASSDGVNWVFSPMVDVCHDAR--WGRIAESAGEDPYLGGEIAKAWVRGYQTN 169 >gi|296395200|ref|YP_003660084.1| family 3 glycoside hydrolase domain-containing protein [Segniliparus rotundus DSM 44985] gi|296182347|gb|ADG99253.1| glycoside hydrolase family 3 domain protein [Segniliparus rotundus DSM 44985] Length = 414 Score = 40.5 bits (94), Expect = 0.067, Method: Composition-based stats. Identities = 9/40 (22%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAK 41 + L G+ +F+P D+ G + FS P Sbjct: 143 GRQLRALGVTADFAPDADVFAGDADTVIG-DRSFSGDPHT 181 >gi|158314998|ref|YP_001507506.1| glycoside hydrolase family 3 protein [Frankia sp. EAN1pec] gi|158110403|gb|ABW12600.1| glycoside hydrolase family 3 domain protein [Frankia sp. EAN1pec] Length = 811 Score = 40.5 bits (94), Expect = 0.067, Method: Composition-based stats. Identities = 9/59 (15%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 + + G + SPV+D+ + + P + F R +P+ Sbjct: 134 LRRQARAIGHPLVLSPVMDVARDAR--WGRVHETYGEDPYLVSAMSVAFVRGIQGDDPR 190 >gi|301117132|ref|XP_002906294.1| glycoside hydrolase, putative [Phytophthora infestans T30-4] gi|262107643|gb|EEY65695.1| glycoside hydrolase, putative [Phytophthora infestans T30-4] Length = 682 Score = 40.5 bits (94), Expect = 0.068, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 ++ +GI F P+L++ P A+ F P R N Sbjct: 191 GQDTQAAGIPSIFCPILEISSNPL--WARTYETFGEDPHLVSVMGDAVIRGLQSN 243 >gi|238750313|ref|ZP_04611815.1| Glycosyl hydrolase family protein [Yersinia rohdei ATCC 43380] gi|238711546|gb|EEQ03762.1| Glycosyl hydrolase family protein [Yersinia rohdei ATCC 43380] Length = 623 Score = 40.5 bits (94), Expect = 0.069, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L + G N NF PV+D+ + +S P E A+ + K Sbjct: 162 GYELSSLGFNFNFGPVVDVNNNQNNPVIGV-RSYSNDPVLVGELARSYISGIHK 214 >gi|2323355|gb|AAB66561.1| beta-glucosidase [Elizabethkingia meningoseptica] Length = 726 Score = 40.5 bits (94), Expect = 0.069, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK GIN FSP++D+ P + P E A+ Y Sbjct: 103 AKEASADGINWTFSPMVDVSREPR--WGRVSEGSGEDPYLGSEIAKAMVYGYQ 153 >gi|325105543|ref|YP_004275197.1| glycoside hydrolase family 3 domain protein [Pedobacter saltans DSM 12145] gi|324974391|gb|ADY53375.1| glycoside hydrolase family 3 domain protein [Pedobacter saltans DSM 12145] Length = 570 Score = 40.5 bits (94), Expect = 0.069, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK+ G+ +NF+PV+D+ P F + + + N Sbjct: 149 AKDFKRIGMQMNFAPVVDINNNPNNP-VINYRSFGENKYNVADKGVAYMKGMQDN 202 >gi|29350122|ref|NP_813625.1| periplasmic beta-glucosidase , xylosidase/arabinosidase [Bacteroides thetaiotaomicron VPI-5482] gi|29342034|gb|AAO79819.1| periplasmic beta-glucosidase precursor, xylosidase/arabinosidase [Bacteroides thetaiotaomicron VPI-5482] Length = 769 Score = 40.5 bits (94), Expect = 0.069, Method: Composition-based stats. Identities = 11/50 (22%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 +AK + + G ++++ PVLDL P ++ F P + Sbjct: 159 IAKEIRSQGAHISYGPVLDLSRDPR--WSRVEETFGEDPVLSGRLGAAMI 206 >gi|304406707|ref|ZP_07388362.1| glycoside hydrolase family 3 domain protein [Paenibacillus curdlanolyticus YK9] gi|304344240|gb|EFM10079.1| glycoside hydrolase family 3 domain protein [Paenibacillus curdlanolyticus YK9] Length = 733 Score = 40.5 bits (94), Expect = 0.071, Method: Composition-based stats. Identities = 8/56 (14%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 + +T G+ F+P++D+ P + P + + N Sbjct: 137 STEALTDGVTWVFAPMIDVSRDPR--WGRIAESIGEDPYLTAAYGRAWVEGSQIDN 190 >gi|296130859|ref|YP_003638109.1| glycoside hydrolase family 3 domain protein [Cellulomonas flavigena DSM 20109] gi|296022674|gb|ADG75910.1| glycoside hydrolase family 3 domain protein [Cellulomonas flavigena DSM 20109] Length = 765 Score = 40.5 bits (94), Expect = 0.071, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G++ FSPV+ + + F P E A R Y Sbjct: 120 AVEVSATGLHWTFSPVVCITRDLR--WGRVNETFGEDPYLIGELAAAMVRGYQ 170 >gi|238789201|ref|ZP_04632989.1| Glycosyl hydrolase family protein [Yersinia frederiksenii ATCC 33641] gi|238722733|gb|EEQ14385.1| Glycosyl hydrolase family protein [Yersinia frederiksenii ATCC 33641] Length = 623 Score = 40.5 bits (94), Expect = 0.072, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L + G N NF PV+D+ + +S P E A+ + K Sbjct: 162 GYELSSLGFNFNFGPVVDVNNNQNNPVIGV-RSYSNDPVLVGELARSYISGIHK 214 >gi|224588245|gb|ACN58869.1| xylosidase/arabinosidase [uncultured bacterium BLR13] Length = 794 Score = 40.5 bits (94), Expect = 0.074, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + G N+ +PV+D+ P + + P E + + Sbjct: 185 AREMRARGANLALAPVVDVAREPR--WGRIEETYGEDPHLCGEMGKAAVLGFQ 235 >gi|15228841|ref|NP_191830.1| glycosyl hydrolase family 3 protein [Arabidopsis thaliana] gi|7362751|emb|CAB83121.1| beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana] gi|17065160|gb|AAL32734.1| beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana] gi|20259922|gb|AAM13308.1| beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana] gi|332646861|gb|AEE80382.1| glycosyl hydrolase-like protein [Arabidopsis thaliana] Length = 650 Score = 40.5 bits (94), Expect = 0.074, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ + +G+ F+P + + P + +S PA + N Sbjct: 172 AQEVRATGVAQAFAPCVAVCRDPR--WGRCYESYSEDPAVVNMMTESIIDGLQGN 224 >gi|148255690|ref|YP_001240275.1| putative beta-hexosaminidase [Bradyrhizobium sp. BTAi1] gi|146407863|gb|ABQ36369.1| putative Beta-hexosaminidase [Bradyrhizobium sp. BTAi1] Length = 476 Score = 40.5 bits (94), Expect = 0.074, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 22/57 (38%), Gaps = 5/57 (8%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPET-----FIAQKRSIFSRIPAKAEESAQLFSRTY 53 ++L +GI +N +PV+DL R S PA + A + R Sbjct: 209 GRSLADAGITLNLAPVVDLRPSWTHNRFDFHTLISRRAISNDPAVVGDIALGYVRGL 265 >gi|332668669|ref|YP_004451676.1| glycoside hydrolase family 3 domain-containing protein [Cellulomonas fimi ATCC 484] gi|332337706|gb|AEE44289.1| glycoside hydrolase family 3 domain protein [Cellulomonas fimi ATCC 484] Length = 758 Score = 40.5 bits (94), Expect = 0.074, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI+ FSPVL + + F P E A Y Sbjct: 119 AVEVAATGIHWTFSPVLCITRDLR--WGRVDETFGEDPFLIGELASAMVAGYQ 169 >gi|295689822|ref|YP_003593515.1| glycoside hydrolase family 3 domain-containing protein [Caulobacter segnis ATCC 21756] gi|295431725|gb|ADG10897.1| glycoside hydrolase family 3 domain protein [Caulobacter segnis ATCC 21756] Length = 656 Score = 40.5 bits (94), Expect = 0.074, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Query: 1 MAK-NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ GI+ SP+ DL P F P A + + + + Sbjct: 197 IARQEYRAVGIHQALSPMADLATEPRWSRISG--TFGEDPDLAGRMVKAYIQGFQ 249 >gi|16331026|ref|NP_441754.1| beta-glucosidase [Synechocystis sp. PCC 6803] gi|1653521|dbj|BAA18434.1| beta-glucosidase [Synechocystis sp. PCC 6803] Length = 538 Score = 40.5 bits (94), Expect = 0.074, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 +A+ + G+N +P+ D+ P F P + F + P Sbjct: 129 IAQEALAVGLNWILAPIADVNNNPNNP-VINVRAFGETPEIVGTLVREFITGTQQFP 184 >gi|116625978|ref|YP_828134.1| glycoside hydrolase family 3 protein [Candidatus Solibacter usitatus Ellin6076] gi|116229140|gb|ABJ87849.1| glycoside hydrolase, family 3 domain protein [Candidatus Solibacter usitatus Ellin6076] Length = 752 Score = 40.5 bits (94), Expect = 0.074, Method: Composition-based stats. Identities = 10/48 (20%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 GI F+P++D+ P + P A A R + + Sbjct: 154 GIRWTFAPMVDIARDPR--WGRVAESLGEDPRLAGTLAAAMVRGFQGH 199 >gi|327481417|gb|AEA84727.1| periplasmic beta-glucosidase [Pseudomonas stutzeri DSM 4166] Length = 765 Score = 40.5 bits (94), Expect = 0.076, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+++ F+P++D+ P + F P + A R Y Sbjct: 140 AIEASADGLDLTFAPMVDITRDPR--WGRTSEGFGEDPYLVSQIAGTLVRAYQ 190 >gi|326403084|ref|YP_004283165.1| beta-hexosaminidase [Acidiphilium multivorum AIU301] gi|325049945|dbj|BAJ80283.1| beta-hexosaminidase [Acidiphilium multivorum AIU301] Length = 308 Score = 40.5 bits (94), Expect = 0.076, Method: Composition-based stats. Identities = 8/47 (17%), Positives = 15/47 (31%), Gaps = 1/47 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQ 47 + +G +V +PVLD+ + + PA Sbjct: 107 IGAMARDAGFDVVAAPVLDVPVPGAHDVIG-DRAIAADPAVVGALGA 152 >gi|146283065|ref|YP_001173218.1| periplasmic beta-glucosidase [Pseudomonas stutzeri A1501] gi|145571270|gb|ABP80376.1| periplasmic beta-glucosidase [Pseudomonas stutzeri A1501] Length = 763 Score = 40.5 bits (94), Expect = 0.076, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+++ F+P++D+ P + F P + A R Y Sbjct: 138 AIEASADGLDLTFAPMVDITRDPR--WGRTSEGFGEDPYLVSQIAGTLVRAYQ 188 >gi|298480662|ref|ZP_06998858.1| xylosidase/arabinosidase [Bacteroides sp. D22] gi|298273096|gb|EFI14661.1| xylosidase/arabinosidase [Bacteroides sp. D22] Length = 777 Score = 40.5 bits (94), Expect = 0.077, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 17/57 (29%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A I +SPV+DL P + + + + Y NP Sbjct: 163 AYESRACCIPWTYSPVVDLGRDPRWP--RMWENYGEDAYVNAQMGVAMVQGYQGDNP 217 >gi|89099940|ref|ZP_01172811.1| glycosyl hydrolase, family 3 [Bacillus sp. NRRL B-14911] gi|89085332|gb|EAR64462.1| glycosyl hydrolase, family 3 [Bacillus sp. NRRL B-14911] Length = 720 Score = 40.5 bits (94), Expect = 0.077, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A SGI+V F+P++DL+ P + P E A+ R + Sbjct: 120 ALEASVSGIHVTFAPMVDLVRDPR--WGRVMESTGEDPYLNSEFARAQVRGFQ 170 >gi|317480934|ref|ZP_07940014.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bacteroides sp. 4_1_36] gi|316902827|gb|EFV24701.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bacteroides sp. 4_1_36] Length = 316 Score = 40.5 bits (94), Expect = 0.077, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L + G+ SP LD++ + F P + + YI Sbjct: 162 IATELRSQGVIQTLSPGLDVVRDLR--WGRVEESFGEDPWLVGQMGIAQVKGYID 214 >gi|284048809|ref|YP_003399148.1| glycoside hydrolase family 3 domain protein [Acidaminococcus fermentans DSM 20731] gi|283953030|gb|ADB47833.1| glycoside hydrolase family 3 domain protein [Acidaminococcus fermentans DSM 20731] Length = 369 Score = 40.5 bits (94), Expect = 0.077, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 19/54 (35%), Gaps = 7/54 (12%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G N+N +PV D+ +S PA A + + Y K Sbjct: 155 GTRLKALGFNLNLAPVADVGS-------GMERSYSSHPATAAKFVEGALAGYQK 201 >gi|270294308|ref|ZP_06200510.1| periplasmic beta-glucosidase [Bacteroides sp. D20] gi|270275775|gb|EFA21635.1| periplasmic beta-glucosidase [Bacteroides sp. D20] Length = 862 Score = 40.5 bits (94), Expect = 0.077, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L + G+ SP LD++ + F P + + YI Sbjct: 155 IATELRSQGVIQTLSPGLDVVRDLR--WGRVEESFGEDPWLVGQMGIAQVKGYID 207 >gi|160890986|ref|ZP_02071989.1| hypothetical protein BACUNI_03433 [Bacteroides uniformis ATCC 8492] gi|156859207|gb|EDO52638.1| hypothetical protein BACUNI_03433 [Bacteroides uniformis ATCC 8492] Length = 869 Score = 40.5 bits (94), Expect = 0.077, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L + G+ SP LD++ + F P + + YI Sbjct: 162 IATELRSQGVIQTLSPGLDVVRDLR--WGRVEESFGEDPWLVGQMGIAQVKGYID 214 >gi|148259961|ref|YP_001234088.1| Beta-N-acetylhexosaminidase [Acidiphilium cryptum JF-5] gi|146401642|gb|ABQ30169.1| Beta-N-acetylhexosaminidase [Acidiphilium cryptum JF-5] Length = 308 Score = 40.5 bits (94), Expect = 0.077, Method: Composition-based stats. Identities = 8/47 (17%), Positives = 15/47 (31%), Gaps = 1/47 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQ 47 + +G +V +PVLD+ + + PA Sbjct: 107 IGAMARDAGFDVVAAPVLDVPVPGAHDVIG-DRAIAADPAVVGALGA 152 >gi|212691100|ref|ZP_03299228.1| hypothetical protein BACDOR_00590 [Bacteroides dorei DSM 17855] gi|212666332|gb|EEB26904.1| hypothetical protein BACDOR_00590 [Bacteroides dorei DSM 17855] Length = 776 Score = 40.5 bits (94), Expect = 0.078, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A I ++PV+DL P + + + A + + +NP Sbjct: 163 AYETKACCIPWTYAPVMDLGRDPRWP--RMWESYGEDSYVNAQMAVEAVKGFQGENP 217 >gi|170728687|ref|YP_001762713.1| glycoside hydrolase family 3 protein [Shewanella woodyi ATCC 51908] gi|169814034|gb|ACA88618.1| glycoside hydrolase family 3 domain protein [Shewanella woodyi ATCC 51908] Length = 608 Score = 40.5 bits (94), Expect = 0.078, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++ +G++ F+P L + P + FS P A + A+ + K Sbjct: 134 EVLATGVDWVFAPNLAVAQDP--HWGRTYESFSESPQIAVKYAERIINGFHK 183 >gi|312197243|ref|YP_004017304.1| glycoside hydrolase family 3 domain protein [Frankia sp. EuI1c] gi|311228579|gb|ADP81434.1| glycoside hydrolase family 3 domain protein [Frankia sp. EuI1c] Length = 820 Score = 40.5 bits (94), Expect = 0.079, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G FSPV+D+ + + P + F+R Sbjct: 134 GRQVRAVGHGQVFSPVMDVARDAR--WGRVHETYGEEPYLVSALSVAFTRGLQ 184 >gi|306822295|ref|ZP_07455676.1| B-glucosidase [Bifidobacterium dentium ATCC 27679] gi|309802830|ref|ZP_07696932.1| glycosyl hydrolase family 3 N-terminal domain protein [Bifidobacterium dentium JCVIHMP022] gi|304554457|gb|EFM42363.1| B-glucosidase [Bifidobacterium dentium ATCC 27679] gi|308220583|gb|EFO76893.1| glycosyl hydrolase family 3 N-terminal domain protein [Bifidobacterium dentium JCVIHMP022] Length = 784 Score = 40.5 bits (94), Expect = 0.080, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + T+G++ FSPVL + + F P E A + Y Sbjct: 133 AEEVSTTGVHWTFSPVLCIGRDTR--WGRVGETFGEDPYLIGEMASSIVKGYQ 183 >gi|283456523|ref|YP_003361087.1| beta-glucosidase [Bifidobacterium dentium Bd1] gi|283103157|gb|ADB10263.1| bgl2 Beta-glucosidase [Bifidobacterium dentium Bd1] Length = 777 Score = 40.5 bits (94), Expect = 0.080, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + T+G++ FSPVL + + F P E A + Y Sbjct: 126 AEEVSTTGVHWTFSPVLCIGRDTR--WGRVGETFGEDPYLIGEMASSIVKGYQ 176 >gi|224537549|ref|ZP_03678088.1| hypothetical protein BACCELL_02428 [Bacteroides cellulosilyticus DSM 14838] gi|224520862|gb|EEF89967.1| hypothetical protein BACCELL_02428 [Bacteroides cellulosilyticus DSM 14838] Length = 791 Score = 40.5 bits (94), Expect = 0.080, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A NFSPVLDL ++ + A + + Y NP Sbjct: 174 AYETKAGNAPWNFSPVLDLGRDAR--WSRIYETYGEDVYLASQMGMACIKGYQGDNP 228 >gi|171742385|ref|ZP_02918192.1| hypothetical protein BIFDEN_01496 [Bifidobacterium dentium ATCC 27678] gi|171277999|gb|EDT45660.1| hypothetical protein BIFDEN_01496 [Bifidobacterium dentium ATCC 27678] Length = 784 Score = 40.5 bits (94), Expect = 0.080, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + T+G++ FSPVL + + F P E A + Y Sbjct: 133 AEEVSTTGVHWTFSPVLCIGRDTR--WGRVGETFGEDPYLIGEMASSIVKGYQ 183 >gi|154419098|ref|XP_001582566.1| glycosyl hydrolase [Trichomonas vaginalis G3] gi|121916802|gb|EAY21580.1| Glycosyl hydrolase family 3 N terminal domain containing protein [Trichomonas vaginalis G3] Length = 718 Score = 40.5 bits (94), Expect = 0.080, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G++ +FSPV+ + + F P A + Sbjct: 119 AYEMRYTGMSWSFSPVVCIARDTR--WGRVGETFGEDPYLIGRFASAMVKGLQ 169 >gi|265767403|ref|ZP_06095069.1| periplasmic beta-glucosidase [Bacteroides sp. 2_1_16] gi|263252708|gb|EEZ24220.1| periplasmic beta-glucosidase [Bacteroides sp. 2_1_16] Length = 764 Score = 40.5 bits (94), Expect = 0.081, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P A+ R Y Sbjct: 144 AVEASADGISWTFSPMVDVSRDPR--WGRVSEGNGEDPFLGAAIARAMIRGYQ 194 >gi|253566536|ref|ZP_04843989.1| periplasmic beta-glucosidase [Bacteroides sp. 3_2_5] gi|251944708|gb|EES85183.1| periplasmic beta-glucosidase [Bacteroides sp. 3_2_5] Length = 764 Score = 40.5 bits (94), Expect = 0.081, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P A+ R Y Sbjct: 144 AVEASADGISWTFSPMVDVSRDPR--WGRVSEGNGEDPFLGAAIARAMIRGYQ 194 >gi|255692036|ref|ZP_05415711.1| periplasmic beta-glucosidase [Bacteroides finegoldii DSM 17565] gi|260622284|gb|EEX45155.1| periplasmic beta-glucosidase [Bacteroides finegoldii DSM 17565] Length = 859 Score = 40.5 bits (94), Expect = 0.081, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A L T G+ +P +D+ + FS P A + Y+ + Sbjct: 157 IAGELNTIGVKQVLAPCIDVARELR--WGRVEESFSEDPFLCARMAVAEVKGYMDH 210 >gi|2253101|gb|AAB62870.1| beta-glucosidase [Bacteroides fragilis 638R] gi|301165106|emb|CBW24674.1| periplasmic beta-glucosidase precursor [Bacteroides fragilis 638R] Length = 764 Score = 40.5 bits (94), Expect = 0.081, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P A+ R Y Sbjct: 144 AVEASADGISWTFSPMVDVSRDPR--WGRVSEGNGEDPFLGAAIARAMIRGYQ 194 >gi|60683591|ref|YP_213735.1| periplasmic beta-glucosidase [Bacteroides fragilis NCTC 9343] gi|60495025|emb|CAH09843.1| periplasmic beta-glucosidase precursor [Bacteroides fragilis NCTC 9343] Length = 764 Score = 40.5 bits (94), Expect = 0.081, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P A+ R Y Sbjct: 144 AVEASADGISWTFSPMVDVSRDPR--WGRVSEGNGEDPFLGAAIARAMIRGYQ 194 >gi|53715652|ref|YP_101644.1| beta-glucosidase [Bacteroides fragilis YCH46] gi|52218517|dbj|BAD51110.1| beta-glucosidase [Bacteroides fragilis YCH46] Length = 764 Score = 40.5 bits (94), Expect = 0.081, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P A+ R Y Sbjct: 144 AVEASADGISWTFSPMVDVSRDPR--WGRVSEGNGEDPFLGAAIARAMIRGYQ 194 >gi|255011522|ref|ZP_05283648.1| periplasmic beta-glucosidase precursor [Bacteroides fragilis 3_1_12] gi|313149347|ref|ZP_07811540.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12] gi|313138114|gb|EFR55474.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12] Length = 763 Score = 40.5 bits (94), Expect = 0.082, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P A+ R Y Sbjct: 144 AIEASADGISWTFSPMVDVSRDPR--WGRVSEGNGEDPFLGAAIARAMIRGYQ 194 >gi|255532174|ref|YP_003092546.1| glycoside hydrolase family 3 domain-containing protein [Pedobacter heparinus DSM 2366] gi|255345158|gb|ACU04484.1| glycoside hydrolase family 3 domain protein [Pedobacter heparinus DSM 2366] Length = 799 Score = 40.5 bits (94), Expect = 0.082, Method: Composition-based stats. Identities = 6/55 (10%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + G ++P+LD+ + ++ P + +N Sbjct: 193 GQEARALGYTNVYAPILDVARDQR--WGRLEEVYGEDPYLVARLGVEMTLGMQEN 245 >gi|152996774|ref|YP_001341609.1| glycoside hydrolase family 3 protein [Marinomonas sp. MWYL1] gi|150837698|gb|ABR71674.1| glycoside hydrolase family 3 domain protein [Marinomonas sp. MWYL1] Length = 788 Score = 40.5 bits (94), Expect = 0.082, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G + +PVLD+ + P A + + Sbjct: 146 IGEQTRLVGAHHGLAPVLDVSRDVR--WGRTEETLGEDPYHVGVLATEYVKGLQ 197 >gi|301093710|ref|XP_002997700.1| glycoside hydrolase, putative [Phytophthora infestans T30-4] gi|262109949|gb|EEY68001.1| glycoside hydrolase, putative [Phytophthora infestans T30-4] Length = 792 Score = 40.5 bits (94), Expect = 0.083, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A++ +GI FSP+L++ P A+ F P A R N Sbjct: 184 ARDTGAAGIPWLFSPILEVSQNPL--WARTFETFGEDPHLVSVMADAIIRGIQSN 236 >gi|313675899|ref|YP_004053895.1| glycoside hydrolase family 3 domain protein [Marivirga tractuosa DSM 4126] gi|312942597|gb|ADR21787.1| glycoside hydrolase family 3 domain protein [Marivirga tractuosa DSM 4126] Length = 759 Score = 40.5 bits (94), Expect = 0.084, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ GI FSP+ D+ P + P + A+ + Y Sbjct: 143 AQEASADGIAWTFSPMTDISRDPR--WGRVSEGSGEDPYLGAQIAKAMVKGYQ 193 >gi|330801663|ref|XP_003288844.1| beta glucosidase [Dictyostelium purpureum] gi|325081090|gb|EGC34619.1| beta glucosidase [Dictyostelium purpureum] Length = 829 Score = 40.1 bits (93), Expect = 0.088, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 19/62 (30%), Gaps = 8/62 (12%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI------K 55 AK+ GI F+PVL + P F P A R + Sbjct: 223 AKDTSAVGIPWVFAPVLGIGVQPLWPRI--YETFGEDPYVASMMGAAAVRGFQGGNNSFD 280 Query: 56 NP 57 NP Sbjct: 281 NP 282 >gi|329960728|ref|ZP_08299052.1| glycosyl hydrolase family 3 protein [Bacteroides fluxus YIT 12057] gi|328532443|gb|EGF59241.1| glycosyl hydrolase family 3 protein [Bacteroides fluxus YIT 12057] Length = 750 Score = 40.1 bits (93), Expect = 0.088, Method: Composition-based stats. Identities = 10/60 (16%), Positives = 18/60 (30%), Gaps = 6/60 (10%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI----KNP 57 A + GI F+P++D+ P + + R + NP Sbjct: 138 AIEASSVGIRWTFAPMIDVSRDPR--WGRIAESCGEDTYLSSVMGAAMVRGFQGDSLNNP 195 >gi|269793720|ref|YP_003313175.1| beta-glucosidase-like glycosyl hydrolase [Sanguibacter keddieii DSM 10542] gi|269095905|gb|ACZ20341.1| beta-glucosidase-like glycosyl hydrolase [Sanguibacter keddieii DSM 10542] Length = 765 Score = 40.1 bits (93), Expect = 0.089, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI+ FSPVL + + F P E R Y Sbjct: 121 AVEVSATGIHWTFSPVLCITRDLR--WGRVSETFGEDPFLIGELGSAMVRGYQ 171 >gi|125624264|ref|YP_001032747.1| beta-glucosidase [Lactococcus lactis subsp. cremoris MG1363] gi|124493072|emb|CAL98036.1| beta-glucosidase [Lactococcus lactis subsp. cremoris MG1363] gi|300071045|gb|ADJ60445.1| beta-glucosidase [Lactococcus lactis subsp. cremoris NZ9000] Length = 714 Score = 40.1 bits (93), Expect = 0.089, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + LV +GI VNFSP++DL+ + F + + Y Sbjct: 125 GQELVATGIKVNFSPMVDLVRDAR--WGRVMESFGEDSILSGRLGRAMIEGYQ 175 >gi|326777531|ref|ZP_08236796.1| Beta-glucosidase [Streptomyces cf. griseus XylebKG-1] gi|326657864|gb|EGE42710.1| Beta-glucosidase [Streptomyces cf. griseus XylebKG-1] Length = 763 Score = 40.1 bits (93), Expect = 0.091, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G++ FSPVL + + F P E A R Y Sbjct: 121 AVEVAATGVHWTFSPVLCITRDLR--WGRVSETFGEDPFLIGELASAMVRGYQ 171 >gi|291446766|ref|ZP_06586156.1| beta-D-glucosideglucohydrolase [Streptomyces roseosporus NRRL 15998] gi|291349713|gb|EFE76617.1| beta-D-glucosideglucohydrolase [Streptomyces roseosporus NRRL 15998] Length = 781 Score = 40.1 bits (93), Expect = 0.091, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G++ FSPVL + + F P E A R Y Sbjct: 141 AVEVAATGVHWTFSPVLCITRDLR--WGRVSETFGEDPFLIGELASAMVRGYQ 191 >gi|320008403|gb|ADW03253.1| glycoside hydrolase family 3 domain protein [Streptomyces flavogriseus ATCC 33331] Length = 775 Score = 40.1 bits (93), Expect = 0.091, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G++ FSPVL + + F P E A R Y Sbjct: 133 AVEVAATGVHWTFSPVLCITRDLR--WGRVSETFGEDPFLIGELASAMVRGYQ 183 >gi|239943293|ref|ZP_04695230.1| putative beta-glucosidase [Streptomyces roseosporus NRRL 15998] gi|239989751|ref|ZP_04710415.1| putative beta-glucosidase [Streptomyces roseosporus NRRL 11379] Length = 761 Score = 40.1 bits (93), Expect = 0.091, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G++ FSPVL + + F P E A R Y Sbjct: 121 AVEVAATGVHWTFSPVLCITRDLR--WGRVSETFGEDPFLIGELASAMVRGYQ 171 >gi|182436919|ref|YP_001824638.1| putative beta-glucosidase [Streptomyces griseus subsp. griseus NBRC 13350] gi|178465435|dbj|BAG19955.1| putative beta-glucosidase [Streptomyces griseus subsp. griseus NBRC 13350] Length = 768 Score = 40.1 bits (93), Expect = 0.091, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G++ FSPVL + + F P E A R Y Sbjct: 126 AVEVAATGVHWTFSPVLCITRDLR--WGRVSETFGEDPFLIGELASAMVRGYQ 176 >gi|225163598|ref|ZP_03725906.1| glycoside hydrolase family 3 domain protein [Opitutaceae bacterium TAV2] gi|224801800|gb|EEG20088.1| glycoside hydrolase family 3 domain protein [Opitutaceae bacterium TAV2] Length = 748 Score = 40.1 bits (93), Expect = 0.091, Method: Composition-based stats. Identities = 13/46 (28%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 G++ FSPV+D+ P + F P A E A R + Sbjct: 163 GLHWTFSPVVDVGRDPR--WGRVAEGFGEDPVLAGELAAAAVRGFQ 206 >gi|270260872|ref|ZP_06189145.1| periplasmic beta-glucosidase [Serratia odorifera 4Rx13] gi|270044356|gb|EFA17447.1| periplasmic beta-glucosidase [Serratia odorifera 4Rx13] Length = 765 Score = 40.1 bits (93), Expect = 0.093, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G+N+ FSP++D+ P + F + A++ Y Sbjct: 143 AQEASDDGLNMTFSPMVDITRDPR--WGRVSEGFGEDTWLVSKIAKVMVDAYQN 194 >gi|301094656|ref|XP_002896432.1| glycoside hydrolase, putative [Phytophthora infestans T30-4] gi|262109407|gb|EEY67459.1| glycoside hydrolase, putative [Phytophthora infestans T30-4] Length = 683 Score = 40.1 bits (93), Expect = 0.093, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A++ +GI+ F P+LD+ T ++ F P R Sbjct: 106 ARDTEAAGISWVFGPILDISQN--TLWSRTYETFGEDPYLVSVMGAALVRGLQ 156 >gi|157369614|ref|YP_001477603.1| glycoside hydrolase family 3 protein [Serratia proteamaculans 568] gi|157321378|gb|ABV40475.1| glycoside hydrolase family 3 domain protein [Serratia proteamaculans 568] Length = 765 Score = 40.1 bits (93), Expect = 0.093, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G+N+ FSP++D+ P + F + A++ Y Sbjct: 143 AQEASDDGLNMTFSPMVDITRDPR--WGRVSEGFGEDTWLVSKIAKVMVDAYQN 194 >gi|332883802|gb|EGK04082.1| hypothetical protein HMPREF9456_01110 [Dysgonomonas mossii DSM 22836] Length = 727 Score = 40.1 bits (93), Expect = 0.094, Method: Composition-based stats. Identities = 11/45 (24%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Query: 15 SPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 +P DL P + F P E A F + +NP+ Sbjct: 148 APNADLARDPR--WGRTEESFGEDPFLVSEMAVAFIKGLQGENPR 190 >gi|302349176|ref|YP_003816814.1| Beta-xylosidase [Acidilobus saccharovorans 345-15] gi|302329588|gb|ADL19783.1| Beta-xylosidase [Acidilobus saccharovorans 345-15] Length = 743 Score = 40.1 bits (93), Expect = 0.098, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+ FSPVLDL P + + P A + R Sbjct: 133 IGRQASRLGVRQLFSPVLDLCLDPR--WGRCEETYGEDPKLAAAMGVSYVRGVQ 184 >gi|15894360|ref|NP_347709.1| Beta-glucosidase family protein [Clostridium acetobutylicum ATCC 824] gi|15023988|gb|AAK79049.1|AE007622_11 Beta-glucosidase family protein [Clostridium acetobutylicum ATCC 824] gi|325508488|gb|ADZ20124.1| Beta-glucosidase family protein [Clostridium acetobutylicum EA 2018] Length = 665 Score = 40.1 bits (93), Expect = 0.098, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 18/56 (32%), Gaps = 4/56 (7%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETF-IAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK + + I F+P L P+ + F A E + + N Sbjct: 178 AKEMRVTDIPWTFAPCLA---NPQNPTWGRTYEGFGEDINLASELGSSYIKGLQGN 230 >gi|265765465|ref|ZP_06093740.1| periplasmic beta-glucosidase [Bacteroides sp. 2_1_16] gi|263254849|gb|EEZ26283.1| periplasmic beta-glucosidase [Bacteroides sp. 2_1_16] Length = 814 Score = 40.1 bits (93), Expect = 0.098, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A G ++ + PVLDL P ++ + P R + Sbjct: 194 IAIEASAQGAHIGYGPVLDLARDPR--WSRVEETYGEDPYLNGAMGTALVRGFQ 245 >gi|329923020|ref|ZP_08278536.1| glycosyl hydrolase family 3 N-terminal domain protein [Paenibacillus sp. HGF5] gi|328941793|gb|EGG38078.1| glycosyl hydrolase family 3 N-terminal domain protein [Paenibacillus sp. HGF5] Length = 763 Score = 40.1 bits (93), Expect = 0.099, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +SPVLD++ P + F P E A + Sbjct: 150 AAETRAQGGAATYSPVLDVVRDPR--WGRTEETFGEDPHLVAEFAVAAVQGLQ 200 >gi|265752789|ref|ZP_06088358.1| periplasmic beta-glucosidase [Bacteroides sp. 3_1_33FAA] gi|263235975|gb|EEZ21470.1| periplasmic beta-glucosidase [Bacteroides sp. 3_1_33FAA] Length = 779 Score = 40.1 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P E A+ R Y Sbjct: 145 AIEASADGISWTFSPMVDVSRDPR--WGRVSEGSGEDPFLGAEIAKAMVRGYQ 195 >gi|237711386|ref|ZP_04541867.1| periplasmic beta-glucosidase [Bacteroides sp. 9_1_42FAA] gi|229454081|gb|EEO59802.1| periplasmic beta-glucosidase [Bacteroides sp. 9_1_42FAA] Length = 771 Score = 40.1 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P E A+ R Y Sbjct: 137 AIEASADGISWTFSPMVDVSRDPR--WGRVSEGSGEDPFLGAEIAKAMVRGYQ 187 >gi|237726151|ref|ZP_04556632.1| periplasmic beta-glucosidase [Bacteroides sp. D4] gi|229435959|gb|EEO46036.1| periplasmic beta-glucosidase [Bacteroides dorei 5_1_36/D4] Length = 771 Score = 40.1 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P E A+ R Y Sbjct: 137 AIEASADGISWTFSPMVDVSRDPR--WGRVSEGSGEDPFLGAEIAKAMVRGYQ 187 >gi|212692419|ref|ZP_03300547.1| hypothetical protein BACDOR_01915 [Bacteroides dorei DSM 17855] gi|212664998|gb|EEB25570.1| hypothetical protein BACDOR_01915 [Bacteroides dorei DSM 17855] Length = 779 Score = 40.1 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P E A+ R Y Sbjct: 145 AIEASADGISWTFSPMVDVSRDPR--WGRVSEGSGEDPFLGAEIAKAMVRGYQ 195 >gi|313505754|gb|ADR64671.1| glycol-hydro-3-superfamily/glycol-hydro-3C-superfamily protein [uncultured microorganism] Length = 803 Score = 40.1 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + + G +V +P L+++ P + +S P A ++A + + KN Sbjct: 153 IGEEVKEYGADVLLAPALNIMRNPLC--GRNFEYYSEDPVVAGKTASAYIKGVQKN 206 >gi|326202244|ref|ZP_08192113.1| glycoside hydrolase family 3 domain protein [Clostridium papyrosolvens DSM 2782] gi|325987362|gb|EGD48189.1| glycoside hydrolase family 3 domain protein [Clostridium papyrosolvens DSM 2782] Length = 661 Score = 40.1 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A L + G++ F+P + + + FS P + F + Sbjct: 198 ADELNSIGVDWTFAPCVAVSNDIR--WGRAYECFSETPDLVTMMSTPFIAALQE 249 >gi|257067376|ref|YP_003153631.1| beta-glucosidase-like glycosyl hydrolase [Brachybacterium faecium DSM 4810] gi|256558194|gb|ACU84041.1| beta-glucosidase-like glycosyl hydrolase [Brachybacterium faecium DSM 4810] Length = 798 Score = 40.1 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ G ++ SPVLD++ + P A + R Sbjct: 148 IGGDMHAMGAHMGLSPVLDIVRDYR--WGRIEETMGEDPYLTGVLATAYVRGLQ 199 >gi|237716102|ref|ZP_04546583.1| conserved hypothetical protein [Bacteroides sp. D1] gi|262407714|ref|ZP_06084262.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] gi|294647263|ref|ZP_06724860.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides ovatus SD CC 2a] gi|294807834|ref|ZP_06766619.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides xylanisolvens SD CC 1b] gi|229443749|gb|EEO49540.1| conserved hypothetical protein [Bacteroides sp. D1] gi|262354522|gb|EEZ03614.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] gi|292637400|gb|EFF55821.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides ovatus SD CC 2a] gi|294444953|gb|EFG13635.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides xylanisolvens SD CC 1b] Length = 859 Score = 40.1 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A L T G+ +P +D++ + FS P A + Y+ + Sbjct: 157 IAGELNTIGVKQVLAPCIDVVRELR--WGRVEESFSEDPFLCARMAVAEVKGYMDH 210 >gi|229817921|ref|ZP_04448203.1| hypothetical protein BIFANG_03208 [Bifidobacterium angulatum DSM 20098] gi|229784525|gb|EEP20639.1| hypothetical protein BIFANG_03208 [Bifidobacterium angulatum DSM 20098] Length = 428 Score = 40.1 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 17/57 (29%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVL---DLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L +GINV+ +PV+ + I F A A F Sbjct: 204 GNQLAQAGINVDLAPVVGTVTVPRASNAPIGALNRDFGLDAAGNAAHASAFVLGMRD 260 >gi|261408260|ref|YP_003244501.1| glycoside hydrolase family 3 domain-containing protein [Paenibacillus sp. Y412MC10] gi|261284723|gb|ACX66694.1| glycoside hydrolase family 3 domain protein [Paenibacillus sp. Y412MC10] Length = 763 Score = 40.1 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G + +SPVLD++ P + F P E A + Sbjct: 150 AAETRAQGGSATYSPVLDVVRDPR--WGRTEETFGEDPHLVTEFAVAAVQGLQ 200 >gi|126462354|ref|YP_001043468.1| Beta-N-acetylhexosaminidase [Rhodobacter sphaeroides ATCC 17029] gi|126104018|gb|ABN76696.1| Beta-N-acetylhexosaminidase [Rhodobacter sphaeroides ATCC 17029] Length = 337 Score = 40.1 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 8/38 (21%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRI 38 +A++L GI+ N +PV D+ + Sbjct: 109 IAEDLRAVGIDGNCAPVADIRTAATHP-FLANRCLADE 145 >gi|320332857|ref|YP_004169568.1| glycoside hydrolase family 3 domain-containing protein [Deinococcus maricopensis DSM 21211] gi|319754146|gb|ADV65903.1| glycoside hydrolase family 3 domain protein [Deinococcus maricopensis DSM 21211] Length = 622 Score = 40.1 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G+ +F+P + + + +S+ E A F Sbjct: 142 AREVSATGVRWDFAPAVSIPQDVR--WGRTYEGYSQDTGVVSELATAFIEGLR 192 >gi|312876685|ref|ZP_07736665.1| glycoside hydrolase family 3 domain protein [Caldicellulosiruptor lactoaceticus 6A] gi|311796525|gb|EFR12874.1| glycoside hydrolase family 3 domain protein [Caldicellulosiruptor lactoaceticus 6A] Length = 770 Score = 40.1 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 6/54 (11%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + +G + +P++D+ + F P A + + Sbjct: 128 IRIQMKATGSHQALAPLIDVARDAR--WGRVEETFGEDPYLVANMAVSYVKGIQ 179 >gi|307825911|ref|ZP_07656126.1| glycoside hydrolase family 3 domain protein [Methylobacter tundripaludum SV96] gi|307733030|gb|EFO03892.1| glycoside hydrolase family 3 domain protein [Methylobacter tundripaludum SV96] Length = 733 Score = 40.1 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + SG NFS V+D+ P + F A + + + Sbjct: 151 AREVRASGQQWNFSTVMDIGRQPLWP--RLWETFGEDVHLATVMGTAYIKGHQ 201 >gi|293397140|ref|ZP_06641414.1| periplasmic beta-glucosidase [Serratia odorifera DSM 4582] gi|291420611|gb|EFE93866.1| periplasmic beta-glucosidase [Serratia odorifera DSM 4582] Length = 766 Score = 40.1 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G+N+ FSP++D+ P + + + A++ Y Sbjct: 144 AQEASDDGLNMTFSPMVDITRDPR--WGRVSEGYGEDTWLVSKIARVMVDAYQN 195 >gi|301087754|ref|XP_002894720.1| beta-glucosidase, putative [Phytophthora infestans T30-4] gi|262096521|gb|EEY54573.1| beta-glucosidase, putative [Phytophthora infestans T30-4] Length = 558 Score = 39.8 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A++ +GI+ F P+LD+ T ++ F P R Sbjct: 106 ARDTEAAGISWVFGPILDISQN--TLWSRTYETFGEDPYLVSVMGAALVRGLQ 156 >gi|313145353|ref|ZP_07807546.1| periplasmic beta-glucosidase [Bacteroides fragilis 3_1_12] gi|313134120|gb|EFR51480.1| periplasmic beta-glucosidase [Bacteroides fragilis 3_1_12] Length = 802 Score = 39.8 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A G ++ + PVLDL P ++ + P R + Sbjct: 182 IATEASAQGAHIGYGPVLDLARDPR--WSRVEETYGEDPYLNGVMGAALVRGFQ 233 >gi|255007659|ref|ZP_05279785.1| putative beta-glucosidase [Bacteroides fragilis 3_1_12] Length = 814 Score = 39.8 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A G ++ + PVLDL P ++ + P R + Sbjct: 194 IATEASAQGAHIGYGPVLDLARDPR--WSRVEETYGEDPYLNGVMGAALVRGFQ 245 >gi|239944527|ref|ZP_04696464.1| glycosyl hydrolase [Streptomyces roseosporus NRRL 15998] gi|239990987|ref|ZP_04711651.1| glycosyl hydrolase [Streptomyces roseosporus NRRL 11379] gi|291447990|ref|ZP_06587380.1| glycosyl hydrolase [Streptomyces roseosporus NRRL 15998] gi|291350937|gb|EFE77841.1| glycosyl hydrolase [Streptomyces roseosporus NRRL 15998] Length = 1033 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 AK + ++G+ +F+P + + + F PA + + + +P Sbjct: 481 AKEVRSTGVPWDFAPCVCVTRDER--WGRSYEAFGEDPALVKAM-ETVIQGMQGSP 533 >gi|332667329|ref|YP_004450117.1| beta-N-acetylhexosaminidase [Haliscomenobacter hydrossis DSM 1100] gi|332336143|gb|AEE53244.1| Beta-N-acetylhexosaminidase [Haliscomenobacter hydrossis DSM 1100] Length = 1070 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G++VN++PV+D+ P F A + R Sbjct: 146 IGRQCKRMGVHVNYAPVVDINNNPNNP-VINFRSFGEDKYNVTSKALAYMRGMQ 198 >gi|328958016|ref|YP_004375402.1| periplasmic beta-glucosidase [Carnobacterium sp. 17-4] gi|328674340|gb|AEB30386.1| periplasmic beta-glucosidase [Carnobacterium sp. 17-4] Length = 706 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK SG++V F+P++DL+ + P + A+ F R Y Sbjct: 108 AKEAAVSGLHVTFAPMVDLVRDAR--WGRVLESTGEDPYLNQLYARAFVRGYQ 158 >gi|257051950|ref|YP_003129783.1| glycoside hydrolase family 3 domain protein [Halorhabdus utahensis DSM 12940] gi|256690713|gb|ACV11050.1| glycoside hydrolase family 3 domain protein [Halorhabdus utahensis DSM 12940] Length = 783 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 14/55 (25%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + K L G SPVLD+ + + P + Sbjct: 148 IRKRLAAVGAVQALSPVLDVSRDMR--WGRVEETYGEDPQLVGALGAAYVSGLQN 200 >gi|238762472|ref|ZP_04623443.1| Glycosyl hydrolase family protein [Yersinia kristensenii ATCC 33638] gi|238699457|gb|EEP92203.1| Glycosyl hydrolase family protein [Yersinia kristensenii ATCC 33638] Length = 627 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L + G N NF PV+D+ + +S P E A+ + K Sbjct: 166 GYELSSLGFNFNFGPVVDVNNNQNNPVIGV-RSYSNNPVLVGELARSYISGIHK 218 >gi|160882475|ref|ZP_02063478.1| hypothetical protein BACOVA_00426 [Bacteroides ovatus ATCC 8483] gi|156112056|gb|EDO13801.1| hypothetical protein BACOVA_00426 [Bacteroides ovatus ATCC 8483] Length = 859 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A L T G+ +P +D++ + F P + A + Y+++ Sbjct: 156 IAGELNTMGVKQVLAPCIDVVRDLR--WGRVEESFGEDPFLCSKMAVAEVKGYMEH 209 >gi|153809437|ref|ZP_01962105.1| hypothetical protein BACCAC_03751 [Bacteroides caccae ATCC 43185] gi|149127897|gb|EDM19119.1| hypothetical protein BACCAC_03751 [Bacteroides caccae ATCC 43185] Length = 859 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A L T G+ +P +D++ + F P + A + Y+++ Sbjct: 156 IAGELNTMGVKQVLAPCIDVVRDLR--WGRVEESFGEDPFLCSKMAVAEVKGYMEH 209 >gi|299136878|ref|ZP_07030061.1| glycoside hydrolase family 3 domain protein [Acidobacterium sp. MP5ACTX8] gi|298601393|gb|EFI57548.1| glycoside hydrolase family 3 domain protein [Acidobacterium sp. MP5ACTX8] Length = 765 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK +G+ F+P++D+ P + P A+ R + Sbjct: 150 AKEASATGVQWTFAPMVDIARDPR--WGRIMEGAGEDPFLGSRMAEAQVRGFQ 200 >gi|224535250|ref|ZP_03675789.1| hypothetical protein BACCELL_00111 [Bacteroides cellulosilyticus DSM 14838] gi|224523135|gb|EEF92240.1| hypothetical protein BACCELL_00111 [Bacteroides cellulosilyticus DSM 14838] Length = 786 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G +SP+LD+ P + + P E + + + Sbjct: 183 AEEAKALGYTNIYSPILDIAQDPR--WGRVVECYGEDPFLVGELGKRMIKGLQQ 234 >gi|189468349|ref|ZP_03017134.1| hypothetical protein BACINT_04746 [Bacteroides intestinalis DSM 17393] gi|189436613|gb|EDV05598.1| hypothetical protein BACINT_04746 [Bacteroides intestinalis DSM 17393] Length = 786 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ G +SP+LD+ P + + P E + + + Sbjct: 183 AEEAKALGYTNIYSPILDIAQDPR--WGRVVECYGEDPFLVGELGKRMIKGLQQ 234 >gi|328956335|ref|YP_004373668.1| glycoside hydrolase family 3 domain protein [Coriobacterium glomerans PW2] gi|328456659|gb|AEB07853.1| glycoside hydrolase family 3 domain protein [Coriobacterium glomerans PW2] Length = 773 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M + L G+++ LDL P + F P + + ++ + Sbjct: 154 MGRELSCMGVDLALVSTLDLARDPR--WGRTEECFGEEPYLSAKYSEAIVEGFQ 205 >gi|294647557|ref|ZP_06725134.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides ovatus SD CC 2a] gi|294807095|ref|ZP_06765914.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides xylanisolvens SD CC 1b] gi|292637099|gb|EFF55540.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides ovatus SD CC 2a] gi|294445794|gb|EFG14442.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides xylanisolvens SD CC 1b] Length = 783 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + K + G ++++ PVLDL P ++ F P E + Sbjct: 176 IGKEIRLQGGHISYGPVLDLARDPR--WSRVEETFGEDPVLTGEIGKAMVEGL 226 >gi|290962042|ref|YP_003493224.1| beta-xylosidase [Streptomyces scabiei 87.22] gi|260651568|emb|CBG74692.1| putative beta-xylosidase [Streptomyces scabiei 87.22] Length = 816 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 8/52 (15%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G++ SP+LD+ + + P F R Sbjct: 142 RQMRSVGLHHALSPLLDIARDAR--WGRVHETYGEDPYLVSALGVSFVRNLQ 191 >gi|260172112|ref|ZP_05758524.1| periplasmic beta-glucosidase precursor, xylosidase/arabinosidase [Bacteroides sp. D2] gi|315920423|ref|ZP_07916663.1| periplasmic beta-glucosidase [Bacteroides sp. D2] gi|313694298|gb|EFS31133.1| periplasmic beta-glucosidase [Bacteroides sp. D2] Length = 769 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + K + G ++++ PVLDL P ++ F P E + Sbjct: 162 IGKEIRLQGGHISYGPVLDLARDPR--WSRVEETFGEDPVLTGEIGKAMVEGL 212 >gi|237715270|ref|ZP_04545751.1| periplasmic beta-glucosidase [Bacteroides sp. D1] gi|262405113|ref|ZP_06081663.1| periplasmic beta-glucosidase [Bacteroides sp. 2_1_22] gi|229444579|gb|EEO50370.1| periplasmic beta-glucosidase [Bacteroides sp. D1] gi|262355988|gb|EEZ05078.1| periplasmic beta-glucosidase [Bacteroides sp. 2_1_22] Length = 769 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + K + G ++++ PVLDL P ++ F P E + Sbjct: 162 IGKEIRLQGGHISYGPVLDLARDPR--WSRVEETFGEDPVLTGEIGKAMVEGL 212 >gi|60280038|gb|AAX16378.1| beta-glucosidase [uncultured murine large bowel bacterium BAC 31B] Length = 750 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 14/53 (26%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI F+P++D+ P + + + Sbjct: 138 AVEASAVGIRWTFAPMIDVARDPR--WGRMAEGCGEDTYLTSVMGAAMVKGFQ 188 >gi|310794790|gb|EFQ30251.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Glomerella graminicola M1.001] Length = 777 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A G+N F+P +DL + + P E +++ + Sbjct: 163 IAIESKALGVNQLFAPNVDLARELR--FGRVEECYGEDPFLVGEYGYSYTKGLQE 215 >gi|301096962|ref|XP_002897577.1| glycoside hydrolase, putative [Phytophthora infestans T30-4] gi|262107037|gb|EEY65089.1| glycoside hydrolase, putative [Phytophthora infestans T30-4] Length = 732 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 ++ SG+ F P+L + P A+ FS P R N Sbjct: 93 GRDTEASGVPWVFGPILGISRNPL--WARTFETFSEDPHINSVMGDAIIRGLQSN 145 >gi|224536087|ref|ZP_03676626.1| hypothetical protein BACCELL_00952 [Bacteroides cellulosilyticus DSM 14838] gi|224522306|gb|EEF91411.1| hypothetical protein BACCELL_00952 [Bacteroides cellulosilyticus DSM 14838] Length = 791 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK + G +SP+LD+ P + + P + + ++ K+ Sbjct: 188 AKEAIALGYTNIYSPILDICQDPR--WGRSVECYGEDPYLVGQLGKQMIQSLQKH 240 >gi|317474222|ref|ZP_07933498.1| glycosyl hydrolase family 3 C terminal domain-containing protein [Bacteroides eggerthii 1_2_48FAA] gi|316909532|gb|EFV31210.1| glycosyl hydrolase family 3 C terminal domain-containing protein [Bacteroides eggerthii 1_2_48FAA] Length = 954 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + +G +SPVLD+ + + F P + + + Y Sbjct: 254 IGEETLAAGTMQAWSPVLDV--AQDARWGRCEETFGEDPVLVSQIGGAWIKGYQ 305 >gi|317479341|ref|ZP_07938475.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bacteroides sp. 4_1_36] gi|316904415|gb|EFV26235.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bacteroides sp. 4_1_36] Length = 742 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 13/53 (24%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI F+P++D+ P + + Sbjct: 138 AVEASAVGIRWTFAPMIDVARDPR--WGRMAEGCGEDTYLTSVMGVAMVEGFQ 188 >gi|290770098|gb|ADD61859.1| putative carbohydrate-active enzyme [uncultured organism] Length = 750 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 13/53 (24%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI F+P++D+ P + + Sbjct: 138 AVEASAVGIRWTFAPMIDVARDPR--WGRMAEGCGEDTYLTSVMGVAMVEGFQ 188 >gi|270293824|ref|ZP_06200026.1| beta-glucosidase [Bacteroides sp. D20] gi|270275291|gb|EFA21151.1| beta-glucosidase [Bacteroides sp. D20] Length = 750 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 13/53 (24%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI F+P++D+ P + + Sbjct: 138 AVEASAVGIRWTFAPMIDVARDPR--WGRMAEGCGEDTYLTSVMGVAMVEGFQ 188 >gi|218130693|ref|ZP_03459497.1| hypothetical protein BACEGG_02282 [Bacteroides eggerthii DSM 20697] gi|217987037|gb|EEC53368.1| hypothetical protein BACEGG_02282 [Bacteroides eggerthii DSM 20697] Length = 954 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + +G +SPVLD+ + + F P + + + Y Sbjct: 254 IGEETLAAGTMQAWSPVLDV--AQDARWGRCEETFGEDPVLVSQIGGAWIKGYQ 305 >gi|160889064|ref|ZP_02070067.1| hypothetical protein BACUNI_01484 [Bacteroides uniformis ATCC 8492] gi|156861531|gb|EDO54962.1| hypothetical protein BACUNI_01484 [Bacteroides uniformis ATCC 8492] Length = 750 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 13/53 (24%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI F+P++D+ P + + Sbjct: 138 AVEASAVGIRWTFAPMIDVARDPR--WGRMAEGCGEDTYLTSVMGVAMVEGFQ 188 >gi|297162266|gb|ADI11978.1| glycosyl hydrolase [Streptomyces bingchenggensis BCW-1] Length = 986 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G+ +F+P + + + F PA + + Sbjct: 433 ASEVRATGVPWDFAPCVCVSRDER--WGRAYESFGEDPALVTAM-ETVIKGMQ 482 >gi|199596938|ref|ZP_03210371.1| Beta-glucosidase-related glycosidase [Lactobacillus rhamnosus HN001] gi|199592071|gb|EDZ00145.1| Beta-glucosidase-related glycosidase [Lactobacillus rhamnosus HN001] Length = 795 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + G++V P +++ P + FS P A + + + K Sbjct: 93 IGLEAQSLGVDVVLGPGVNMKRNPLC--GRNFEYFSEDPYLAGKLGAAWIQGMQK 145 >gi|86141404|ref|ZP_01059950.1| beta-glucosidase [Leeuwenhoekiella blandensis MED217] gi|85831963|gb|EAQ50418.1| beta-glucosidase [Leeuwenhoekiella blandensis MED217] Length = 675 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK +G++ F+P++D+ + P + + Sbjct: 64 AKETAAAGVHWTFAPMIDVSRDAR--WGRIMEGAGEDPYLNAVIGVARIKGFQ 114 >gi|224535195|ref|ZP_03675734.1| hypothetical protein BACCELL_00056 [Bacteroides cellulosilyticus DSM 14838] gi|224523186|gb|EEF92291.1| hypothetical protein BACCELL_00056 [Bacteroides cellulosilyticus DSM 14838] Length = 733 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK V SGI+ FSP++D+ P + + P + Y Sbjct: 144 AKESVLSGIDWTFSPMIDVARDPR--WGRISECYGEDPYLNTVFGVASVKGYQ 194 >gi|293371041|ref|ZP_06617583.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides ovatus SD CMC 3f] gi|292633971|gb|EFF52518.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides ovatus SD CMC 3f] Length = 791 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +AK + + G ++++ PVLDL P ++ F P + I Sbjct: 183 IAKEIRSQGGHISYGPVLDLTRDPR--WSRVEETFGEDPVLSGTLGAAMVDGLIN 235 >gi|293371677|ref|ZP_06618088.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides ovatus SD CMC 3f] gi|292633374|gb|EFF51944.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides ovatus SD CMC 3f] Length = 783 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + K + G ++++ PVLDL P ++ F P E + Sbjct: 176 IGKEIRLQGGHISYGPVLDLARDPR--WSRVEETFGEDPVLTGEIGKAIVEGL 226 >gi|114562496|ref|YP_750009.1| Beta-glucosidase [Shewanella frigidimarina NCIMB 400] gi|114333789|gb|ABI71171.1| exo-1,4-beta-glucosidase [Shewanella frigidimarina NCIMB 400] Length = 880 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +GI+ F+P + ++ + +S P + + Sbjct: 202 AKEVMVTGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPQIVKAYSYAIVEGLQ 252 >gi|328887395|emb|CCA60634.1| putative glycosyl hydrolase [Streptomyces venezuelae ATCC 10712] Length = 1025 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK + +G+ +F+P L + + F PA + Sbjct: 473 AKEVRATGVPWDFAPCLCVTRDER--WGRSYEAFGEDPALVTAM-ETVINGMQ 522 >gi|258507680|ref|YP_003170431.1| beta-glucosidase (GH3) [Lactobacillus rhamnosus GG] gi|257147607|emb|CAR86580.1| Beta-glucosidase (GH3) [Lactobacillus rhamnosus GG] gi|259649028|dbj|BAI41190.1| glycosyl hydrolase [Lactobacillus rhamnosus GG] Length = 795 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + G++V P +++ P + FS P A + + + K Sbjct: 93 IGLEAQSLGVDVVLGPGVNMKRNPLC--GRNFEYFSEDPYLAGKLGAAWIQGMQK 145 >gi|72383317|ref|YP_292672.1| beta-N-acetylhexosaminidase [Prochlorococcus marinus str. NATL2A] gi|72003167|gb|AAZ58969.1| beta-N-acetylhexosaminidase [Prochlorococcus marinus str. NATL2A] Length = 544 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 K G+N +PV D+ P + + P + F R Sbjct: 124 GKEAKKIGLNWLLAPVCDINNNPNNPVINL-RAWGEEPETVKSLTSAFQRG 173 >gi|317474379|ref|ZP_07933653.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bacteroides eggerthii 1_2_48FAA] gi|316909060|gb|EFV30740.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Bacteroides eggerthii 1_2_48FAA] Length = 733 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK V SGI+ FSP++D+ P + + P + Y Sbjct: 144 AKESVLSGIDWTFSPMIDVARDPR--WGRISECYGEDPYLNTVFGIASVKGYQ 194 >gi|253999735|ref|YP_003051798.1| glycoside hydrolase family 3 domain-containing protein [Methylovorus sp. SIP3-4] gi|253986414|gb|ACT51271.1| glycoside hydrolase family 3 domain protein [Methylovorus sp. SIP3-4] Length = 326 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A NL I N +PV D + + +S P A + AQ F+ + Sbjct: 109 ALNLNEKCITANLAPVADTNFNKS----KYNRAYSDEPDIANKYAQAFATSMRN 158 >gi|229553710|ref|ZP_04442435.1| beta-glucosidase [Lactobacillus rhamnosus LMS2-1] gi|258538848|ref|YP_003173347.1| beta-glucosidase [Lactobacillus rhamnosus Lc 705] gi|229312932|gb|EEN78905.1| beta-glucosidase [Lactobacillus rhamnosus LMS2-1] gi|257150524|emb|CAR89496.1| Beta-glucosidase (GH3) [Lactobacillus rhamnosus Lc 705] Length = 795 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + G++V P +++ P + FS P A + + + K Sbjct: 93 IGLEAQSLGVDVVLGPGVNMKRNPLC--GRNFEYFSEDPYLAGKLGAAWIQGMQK 145 >gi|77463498|ref|YP_353002.1| putative glycoside hydrolase [Rhodobacter sphaeroides 2.4.1] gi|77387916|gb|ABA79101.1| Putative Glycoside hydrolase [Rhodobacter sphaeroides 2.4.1] Length = 337 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 8/38 (21%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRI 38 +A++L GI+ N +PV D+ + Sbjct: 109 IAEDLRAVGIDGNCAPVADIRTAATHP-FLANRCLADE 145 >gi|116194216|ref|XP_001222920.1| hypothetical protein CHGG_03706 [Chaetomium globosum CBS 148.51] gi|88179619|gb|EAQ87087.1| hypothetical protein CHGG_03706 [Chaetomium globosum CBS 148.51] Length = 777 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ GIN F+PV DL + ++ A E A + + Sbjct: 160 IAEEARVFGINQLFAPVADLARELRH--GRVEEMYGEDGFLAGELAHAYVKGAQ 211 >gi|257067998|ref|YP_003154253.1| beta-glucosidase-like glycosyl hydrolase [Brachybacterium faecium DSM 4810] gi|256558816|gb|ACU84663.1| beta-glucosidase-like glycosyl hydrolase [Brachybacterium faecium DSM 4810] Length = 421 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 18/57 (31%), Gaps = 4/57 (7%) Query: 1 MAKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + ++L GI V SPV D++ + F P E + Sbjct: 194 IGEDLAARGIQVALSPVADVVDPDLGDANEPVGAVDRGFGTEPGPVGECVVAATEAL 250 >gi|224538725|ref|ZP_03679264.1| hypothetical protein BACCELL_03619 [Bacteroides cellulosilyticus DSM 14838] gi|224519667|gb|EEF88772.1| hypothetical protein BACCELL_03619 [Bacteroides cellulosilyticus DSM 14838] Length = 942 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + G ++P+LD+ + ++ P E R N Sbjct: 199 GREARMLGYTNVYAPILDVGRDQR--WGRYEEVYGESPYLVAELGIEMVRGMQHN 251 >gi|153809292|ref|ZP_01961960.1| hypothetical protein BACCAC_03604 [Bacteroides caccae ATCC 43185] gi|149128062|gb|EDM19283.1| hypothetical protein BACCAC_03604 [Bacteroides caccae ATCC 43185] Length = 946 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + G ++P+LD+ + ++ P E R N Sbjct: 199 GREARMLGYTNVYAPILDVGRDQR--WGRYEEVYGESPYLVAELGIEMVRGMQHN 251 >gi|254482316|ref|ZP_05095556.1| Glycosyl hydrolase family 3 N terminal domain protein [marine gamma proteobacterium HTCC2148] gi|214037321|gb|EEB77988.1| Glycosyl hydrolase family 3 N terminal domain protein [marine gamma proteobacterium HTCC2148] Length = 736 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 9/50 (18%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Query: 7 TSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 ++G+N F+P++D+ P + P R + N Sbjct: 127 STGVNWTFAPMIDITRDPR--WGRIAESLGEDPYLCGVLGAAMVRGFQGN 174 >gi|322512592|gb|ADX05702.1| putative carbohydrate-active enzyme [uncultured organism] Length = 787 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + + G++V +P L+++ P + +S P A ++A + KN Sbjct: 136 IGEEVKEYGVDVLLAPALNIMRNPLC--GRNFEYYSEDPLVAGKTAAAYITGVQKN 189 >gi|282861280|ref|ZP_06270345.1| glycoside hydrolase family 3 domain protein [Streptomyces sp. ACTE] gi|282563938|gb|EFB69475.1| glycoside hydrolase family 3 domain protein [Streptomyces sp. ACTE] Length = 765 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + ++G++ FSPVL + + F P E A R Y Sbjct: 123 AVEVASTGVHWTFSPVLCITRDLR--WGRVSETFGEDPFLIGELASAMVRGYQ 173 >gi|315185696|gb|EFU19463.1| glycoside hydrolase family 3 domain protein [Spirochaeta thermophila DSM 6578] Length = 756 Score = 39.8 bits (92), Expect = 0.15, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI+V P +++ P + +S P A E A + R + Sbjct: 90 LGEEARAEGIDVLLGPAINIKRSPLC--GRNFEYYSEDPYLAGELAAAYIRGVQE 142 >gi|307719141|ref|YP_003874673.1| glycoside hydrolase, family 3 domain-containing protein [Spirochaeta thermophila DSM 6192] gi|306532866|gb|ADN02400.1| glycoside hydrolase, family 3 domain protein [Spirochaeta thermophila DSM 6192] Length = 762 Score = 39.8 bits (92), Expect = 0.15, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GI+V P +++ P + +S P A E A + R + Sbjct: 96 LGEEARAEGIDVLLGPAINIKRSPLC--GRNFEYYSEDPYLAGELAAAYIRGVQE 148 >gi|115378343|ref|ZP_01465508.1| periplasmic beta-glucosidase [Stigmatella aurantiaca DW4/3-1] gi|310825391|ref|YP_003957749.1| periplasmic beta-glucosidase [Stigmatella aurantiaca DW4/3-1] gi|115364656|gb|EAU63726.1| periplasmic beta-glucosidase [Stigmatella aurantiaca DW4/3-1] gi|309398463|gb|ADO75922.1| Periplasmic beta-glucosidase [Stigmatella aurantiaca DW4/3-1] Length = 790 Score = 39.8 bits (92), Expect = 0.15, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ G+ FSP++D+ + P A+ + R Y Sbjct: 178 AEEAAADGVRWVFSPMVDIARDAR--WGRIVEGSGEDPYLGAAMARAYVRGYQ 228 >gi|225618986|ref|YP_002720212.1| beta-hexosaminidase [Brachyspira hyodysenteriae WA1] gi|225213805|gb|ACN82539.1| beta-hexosaminidase [Brachyspira hyodysenteriae WA1] Length = 349 Score = 39.4 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +K L+ GIN+ P+ D+ ++I FS E + Sbjct: 151 SKFLLDLGINMILGPLCDIPNDSNSYI--YNRSFSTNINIVSEMVSNTVKAQRD 202 >gi|189467715|ref|ZP_03016500.1| hypothetical protein BACINT_04107 [Bacteroides intestinalis DSM 17393] gi|189435979|gb|EDV04964.1| hypothetical protein BACINT_04107 [Bacteroides intestinalis DSM 17393] Length = 943 Score = 39.4 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + G ++P+LD+ + ++ P E R N Sbjct: 199 GREARILGYTNVYAPILDVGRDQR--WGRYEEVYGESPYLVAELGIEMVRGMQHN 251 >gi|320538301|ref|ZP_08038183.1| glycosyl hydrolase family 3 protein [Treponema phagedenis F0421] gi|320144848|gb|EFW36582.1| glycosyl hydrolase family 3 protein [Treponema phagedenis F0421] Length = 398 Score = 39.4 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A GI++N +PV + FS P K A F K Sbjct: 151 AAQTAIIGIHLNLAPVAECSAAETLQTLGA-RTFSESPEKTAAYAASFVAGMQK 203 >gi|226492108|ref|NP_001145784.1| hypothetical protein LOC100279291 [Zea mays] gi|219884415|gb|ACL52582.1| unknown [Zea mays] Length = 619 Score = 39.4 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 8/48 (16%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLF 49 A + +GI+ F+P + + P + +S P + Sbjct: 140 ALEVRATGIHWTFAPCVAVCRDPR--WGRCYESYSEDPEIVRSLTTIV 185 >gi|288919738|ref|ZP_06414064.1| glycoside hydrolase family 3 domain protein [Frankia sp. EUN1f] gi|288348838|gb|EFC83089.1| glycoside hydrolase family 3 domain protein [Frankia sp. EUN1f] Length = 1613 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G SPV+D+ + + P + F+R Sbjct: 134 LRRQVRAIGHPFVLSPVMDVARDAR--WGRVHETYGEDPYLVSAMSVAFTRGLQ 185 >gi|54307674|ref|YP_128694.1| putative xylosidase [Photobacterium profundum SS9] gi|46912097|emb|CAG18892.1| putative xylosidase [Photobacterium profundum SS9] Length = 786 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K + + G +PVLD+ + P A + + Sbjct: 146 IGKQVKSVGAQQGLAPVLDVSRDVR--WGRTEETLGEDPYHVGVLATRYVQGLQ 197 >gi|224537504|ref|ZP_03678043.1| hypothetical protein BACCELL_02383 [Bacteroides cellulosilyticus DSM 14838] gi|224520883|gb|EEF89988.1| hypothetical protein BACCELL_02383 [Bacteroides cellulosilyticus DSM 14838] Length = 766 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK + ++ F+P +++ + + P + Y Sbjct: 169 AKEMRAMNMHWTFNPNVEVARDAR--WGRVGETYGEDPYLVTLLGVQSVKGYQ 219 >gi|148271260|ref|YP_001220821.1| putative beta-glucosidase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] gi|147829190|emb|CAN00101.1| putative beta-glucosidase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] Length = 795 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +V+ G SP+ D+ P + + P + A F R Sbjct: 141 IGAQMVSVGARQALSPLADVAQDPR--WGRVSETYGEDPYLVGQIASAFVRGIQ 192 >gi|85711656|ref|ZP_01042713.1| glucan 1,4-beta-glucosidase [Idiomarina baltica OS145] gi|85694516|gb|EAQ32457.1| glucan 1,4-beta-glucosidase [Idiomarina baltica OS145] Length = 839 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A ++ +GI+ F+P + + + +S PA + A R + Sbjct: 171 ATEVMVTGIDWVFAPTVAVARDVR--WGRTYESYSEDPAVVRDYAASIVRGLQGH 223 >gi|310819124|ref|YP_003951482.1| 1,4-beta-d-glucan glucohydrolase [Stigmatella aurantiaca DW4/3-1] gi|309392196|gb|ADO69655.1| 1,4-beta-D-glucan glucohydrolase [Stigmatella aurantiaca DW4/3-1] Length = 1080 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ F+P + ++ + +S PA E A + + Sbjct: 191 AREVARTGVDWAFAPTIAVVRDDR--WGRTYEGYSEDPAVVEAYAGKAVQGFQ 241 >gi|281354948|ref|ZP_06241442.1| glycoside hydrolase family 3 domain protein [Victivallis vadensis ATCC BAA-548] gi|281317828|gb|EFB01848.1| glycoside hydrolase family 3 domain protein [Victivallis vadensis ATCC BAA-548] Length = 698 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G+ FSPVL + + F P + A R Sbjct: 120 AREMRNTGVAWTFSPVLCIARDLR--WGRVGETFGEDPLLIGDFAIALIRGLQ 170 >gi|257051243|ref|YP_003129076.1| glycoside hydrolase family 3 domain protein [Halorhabdus utahensis DSM 12940] gi|256690006|gb|ACV10343.1| glycoside hydrolase family 3 domain protein [Halorhabdus utahensis DSM 12940] Length = 755 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 15/51 (29%), Gaps = 2/51 (3%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L +G SPVLD+ + F P A+ + Sbjct: 118 QLQATGAVHGLSPVLDVARDLR--WGRVEETFGEDPQLVAAMARAYVSGLQ 166 >gi|163789481|ref|ZP_02183920.1| glycosyl hydrolase, family 3 [Carnobacterium sp. AT7] gi|159875335|gb|EDP69400.1| glycosyl hydrolase, family 3 [Carnobacterium sp. AT7] Length = 720 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK SG++V FSP++DL+ + P + A+ F R Y Sbjct: 120 AKEAAVSGLHVTFSPMVDLVRDAR--WGRVMESTGEDPYLNQLYARAFVRGYQ 170 >gi|317474221|ref|ZP_07933497.1| glycosyl hydrolase family 3 C terminal domain-containing protein [Bacteroides eggerthii 1_2_48FAA] gi|316909531|gb|EFV31209.1| glycosyl hydrolase family 3 C terminal domain-containing protein [Bacteroides eggerthii 1_2_48FAA] Length = 786 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ G +SP+LD+ P + + P E + + Sbjct: 183 AEEAKALGYTNIYSPILDIAQDPR--WGRVVECYGEDPFLVGELGKRMIKGLQ 233 >gi|218130692|ref|ZP_03459496.1| hypothetical protein BACEGG_02281 [Bacteroides eggerthii DSM 20697] gi|217987036|gb|EEC53367.1| hypothetical protein BACEGG_02281 [Bacteroides eggerthii DSM 20697] Length = 786 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ G +SP+LD+ P + + P E + + Sbjct: 183 AEEAKALGYTNIYSPILDIAQDPR--WGRVVECYGEDPFLVGELGKRMIKGLQ 233 >gi|300314060|ref|YP_003778152.1| periplasmic beta-D-glucoside glucohydrolase [Herbaspirillum seropedicae SmR1] gi|300076845|gb|ADJ66244.1| periplasmic beta-D-glucoside glucohydrolase, protein [Herbaspirillum seropedicae SmR1] Length = 784 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ I++ F+P++D+ P + F P A++ R Sbjct: 158 AEEAAADSIDMTFAPMVDISRDPR--WGRTSEGFGEDPYLVSRIAEVSVRALQ 208 >gi|294673871|ref|YP_003574487.1| family 3 glycosyl hydrolase [Prevotella ruminicola 23] gi|294474367|gb|ADE83756.1| glycosyl hydrolase, family 3 [Prevotella ruminicola 23] Length = 782 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + + G ++++ PVLDL P ++ P A E + Sbjct: 175 IGQEIRLQGGHISYGPVLDLAREPR--WSRVEETMGEDPVLAGELGAAMVKGL 225 >gi|330814072|ref|YP_004358311.1| beta N-acetyl-glucosaminidase [Candidatus Pelagibacter sp. IMCC9063] gi|327487167|gb|AEA81572.1| beta N-acetyl-glucosaminidase [Candidatus Pelagibacter sp. IMCC9063] Length = 317 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 12/48 (25%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Query: 8 SGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 GIN+ +P LDL Y ++ + +S + +L Y K Sbjct: 119 LGINLVAAPTLDLFYKNKSDVIG-DRSYSSKVEVVQAIGKLVIDMYKK 165 >gi|300023794|ref|YP_003756405.1| glycoside hydrolase [Hyphomicrobium denitrificans ATCC 51888] gi|299525615|gb|ADJ24084.1| glycoside hydrolase family 3 domain protein [Hyphomicrobium denitrificans ATCC 51888] Length = 456 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 21/58 (36%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKR----SIFSRIPAKAEESAQLFSRTYIK 55 A+ L G+ +NF PV+DL G + P + A + T K Sbjct: 210 AQGLERLGVTMNFGPVVDLRLGTSRRNDGETQLFWRAIDSNPYLVAKVAGWYCDTLTK 267 >gi|332533625|ref|ZP_08409485.1| periplasmic beta-glucosidase [Pseudoalteromonas haloplanktis ANT/505] gi|332036906|gb|EGI73366.1| periplasmic beta-glucosidase [Pseudoalteromonas haloplanktis ANT/505] Length = 850 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A ++ +GI+ F+P + ++ + +S P + + Sbjct: 184 AVEVMATGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPKIVHDYSAAIVNGLQ 234 >gi|315125760|ref|YP_004067763.1| Glycoside hydrolase, family 3 [Pseudoalteromonas sp. SM9913] gi|315014274|gb|ADT67612.1| Glycoside hydrolase, family 3 [Pseudoalteromonas sp. SM9913] Length = 838 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ ++ +GI+ F+P + ++ + +S P + + + Sbjct: 177 AREVMVTGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPEIVKAYSASIVKGLQ 227 >gi|301116998|ref|XP_002906227.1| glycoside hydrolase, putative [Phytophthora infestans T30-4] gi|262107576|gb|EEY65628.1| glycoside hydrolase, putative [Phytophthora infestans T30-4] Length = 753 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A++ +GI F P+L++ P ++ FS P + R Sbjct: 114 ARDTQAAGIPWIFGPILEISQNPL--WSRTYETFSEDPHLVTVLGEALVRGLQ 164 >gi|219848593|ref|YP_002463026.1| glycoside hydrolase family 3 domain-containing protein [Chloroflexus aggregans DSM 9485] gi|219542852|gb|ACL24590.1| glycoside hydrolase family 3 domain protein [Chloroflexus aggregans DSM 9485] Length = 619 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G+ N++P + ++ + ++ P A F R Sbjct: 163 AREMAATGVFWNYAPGVMVVQDVR--WGRTYESYAERPEHVASLAVAFLRGLQ 213 >gi|294791424|ref|ZP_06756581.1| periplasmic beta-glucosidase [Scardovia inopinata F0304] gi|294457895|gb|EFG26249.1| periplasmic beta-glucosidase [Scardovia inopinata F0304] Length = 837 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ VT+G+ FSPVL + + F P E A + Y Sbjct: 134 AREAVTTGVQWTFSPVLCIARDTR--WGRVGETFGEDPYLIGEMAAAMVKGYQ 184 >gi|315606892|ref|ZP_07881900.1| beta-glucosidase [Prevotella buccae ATCC 33574] gi|315251429|gb|EFU31410.1| beta-glucosidase [Prevotella buccae ATCC 33574] Length = 767 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 5/53 (9%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + G+ ++P +++ + F P + + Sbjct: 169 ALEMRACGMQWAYAPNVEVARDTR--WGRIGETFGEDPYLVGQMGIATVKGLQ 219 >gi|238632078|gb|ACR50763.1| periplasmic beta-glucosidase [Streptomyces longisporoflavus] Length = 738 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A ++G++ F+P++D+ P + P A R Y Sbjct: 134 AAEARSNGVHWTFAPMMDVTSEPR--WGRIAESGGEDPYLNGVLAAAKVRGYQ 184 >gi|288927108|ref|ZP_06420995.1| periplasmic beta-glucosidase [Prevotella buccae D17] gi|288336114|gb|EFC74508.1| periplasmic beta-glucosidase [Prevotella buccae D17] Length = 767 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 5/53 (9%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + G+ ++P +++ + F P + + Sbjct: 169 ALEMRACGMQWAYAPNVEVARDTR--WGRIGETFGEDPYLVGQMGIATVKGLQ 219 >gi|115380580|ref|ZP_01467535.1| 1,4-beta-D-glucan glucohydrolase [Stigmatella aurantiaca DW4/3-1] gi|115362414|gb|EAU61694.1| 1,4-beta-D-glucan glucohydrolase [Stigmatella aurantiaca DW4/3-1] Length = 900 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ F+P + ++ + +S PA E A + + Sbjct: 191 AREVARTGVDWAFAPTIAVVRDDR--WGRTYEGYSEDPAVVEAYAGKAVQGFQ 241 >gi|154503006|ref|ZP_02040066.1| hypothetical protein RUMGNA_00828 [Ruminococcus gnavus ATCC 29149] gi|153796360|gb|EDN78780.1| hypothetical protein RUMGNA_00828 [Ruminococcus gnavus ATCC 29149] Length = 718 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 23/61 (37%), Gaps = 6/61 (9%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI----KNP 57 AK +G V FSP++D++ P + F + R Y K+P Sbjct: 125 AKEGSAAGYQVTFSPMVDVVRDPR--WGRVMESFGEDKRLNADFGSAMVRGYQGEDLKHP 182 Query: 58 K 58 + Sbjct: 183 E 183 >gi|299137019|ref|ZP_07030202.1| glycoside hydrolase family 3 domain protein [Acidobacterium sp. MP5ACTX8] gi|298601534|gb|EFI57689.1| glycoside hydrolase family 3 domain protein [Acidobacterium sp. MP5ACTX8] Length = 766 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A++ +GI+ F+P++D+ + P AQ R + Sbjct: 144 AQDARAAGIDWTFTPMVDIARDAR--WGRIVEGAGEDPVLGSAMAQAQVRGFQ 194 >gi|255595109|ref|XP_002536229.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis] gi|223520375|gb|EEF26154.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis] Length = 578 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A+ + G N+ +PV+D+ P + + P E + + Sbjct: 127 AREMRARGANLALAPVVDVAREPR--WGRIEETYGEDPYLCGEIGKAAIIGF 176 >gi|119469348|ref|ZP_01612287.1| Beta-glucosidase [Alteromonadales bacterium TW-7] gi|119447212|gb|EAW28481.1| Beta-glucosidase [Alteromonadales bacterium TW-7] Length = 849 Score = 39.4 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A ++ +GI+ F+P + ++ + +S PA E + Sbjct: 184 AVEVMATGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPAIVREYSAAIVNGLQ 234 >gi|255280001|ref|ZP_05344556.1| xylosidase [Bryantella formatexigens DSM 14469] gi|255269774|gb|EET62979.1| xylosidase [Bryantella formatexigens DSM 14469] Length = 796 Score = 39.4 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K +V++G+ SPV+D+ P + + P + + F++ Sbjct: 122 IRKQMVSTGMRQALSPVMDVARDPR--WGRVGETYGEDPTLSAAMSVAFTKGLQ 173 >gi|319934735|ref|ZP_08009180.1| glycoside hydrolase family 3 domain-containing protein [Coprobacillus sp. 29_1] gi|319810112|gb|EFW06474.1| glycoside hydrolase family 3 domain-containing protein [Coprobacillus sp. 29_1] Length = 734 Score = 39.4 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK SGI++ FSP++D++ + + E A+ Y N Sbjct: 120 AKEAAVSGIHITFSPMVDMVRDAR--WGRVMESYGEDNFLNCEYAKAMVEGYQGN 172 >gi|145530169|ref|XP_001450862.1| hypothetical protein [Paramecium tetraurelia strain d4-2] gi|124418495|emb|CAK83465.1| unnamed protein product [Paramecium tetraurelia] Length = 736 Score = 39.4 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 7/49 (14%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Query: 7 TSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 G N F+P + + + P + P +E + + + Sbjct: 172 DCGFNFAFAPTVAVSHNP--KWGRFYETQGADPKFIKEIGRAYIKELQD 218 >gi|228472134|ref|ZP_04056900.1| periplasmic beta-glucosidase/beta-xylosidase [Capnocytophaga gingivalis ATCC 33624] gi|228276337|gb|EEK15061.1| periplasmic beta-glucosidase/beta-xylosidase [Capnocytophaga gingivalis ATCC 33624] Length = 772 Score = 39.0 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 18/56 (32%), Gaps = 8/56 (14%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRS---IFSRIPAKAEESAQLFSRTYI 54 AK GI SP +DL P + F P + A+ + + Sbjct: 225 AKEYRAMGITTALSPQIDLGTEP-----RWNRMVFTFGESPELTTDMARAYVDGFQ 275 >gi|253571651|ref|ZP_04849057.1| periplasmic beta-glucosidase [Bacteroides sp. 1_1_6] gi|251838859|gb|EES66944.1| periplasmic beta-glucosidase [Bacteroides sp. 1_1_6] Length = 769 Score = 39.0 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 11/50 (22%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 +AK + + G ++++ PVLDL P ++ F P + Sbjct: 159 IAKEIRSQGAHISYGPVLDLSRDPR--WSRVEETFGEDPVLSGRLGAAMV 206 >gi|237715894|ref|ZP_04546375.1| conserved hypothetical protein [Bacteroides sp. D1] gi|262407508|ref|ZP_06084056.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] gi|294808869|ref|ZP_06767598.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides xylanisolvens SD CC 1b] gi|229443541|gb|EEO49332.1| conserved hypothetical protein [Bacteroides sp. D1] gi|262354316|gb|EEZ03408.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] gi|294443911|gb|EFG12649.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides xylanisolvens SD CC 1b] Length = 771 Score = 39.0 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 7/56 (12%), Positives = 17/56 (30%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A + +G + F+P +++ + + F P + N Sbjct: 173 ALEMRVTGSHWAFTPNIEI--ACDARWGRVGETFGEDPYLVSRMGVASIKGLQTDN 226 >gi|326334652|ref|ZP_08200859.1| beta-glucosidase [Capnocytophaga sp. oral taxon 338 str. F0234] gi|325693102|gb|EGD35034.1| beta-glucosidase [Capnocytophaga sp. oral taxon 338 str. F0234] Length = 770 Score = 39.0 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 18/56 (32%), Gaps = 8/56 (14%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRS---IFSRIPAKAEESAQLFSRTYI 54 AK GI SP +DL P + F P + A+ + + Sbjct: 226 AKEYRAMGITTALSPQIDLGTEP-----RWNRMVFTFGESPELTTDMARAYVDGFQ 276 >gi|149279578|ref|ZP_01885707.1| b-glucosidase, glycoside hydrolase family 3 protein [Pedobacter sp. BAL39] gi|149229614|gb|EDM35004.1| b-glucosidase, glycoside hydrolase family 3 protein [Pedobacter sp. BAL39] Length = 766 Score = 39.0 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A S I NF+P+LDL P ++ F P E + Y Sbjct: 162 AYETRASSIPWNFAPLLDLGADPRFP--RQWESFGEDPYVISELGLAAVKGY 211 >gi|312213435|emb|CBX93517.1| hypothetical protein [Leptosphaeria maculans] Length = 882 Score = 39.0 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +AK GIN F+PV+DL + + P A E + + Sbjct: 262 IAKESQALGINQLFAPVVDLARELR--FGRVEETYGEDPFLAGELGYQYVKAVQ 313 >gi|153809346|ref|ZP_01962014.1| hypothetical protein BACCAC_03660 [Bacteroides caccae ATCC 43185] gi|149127932|gb|EDM19154.1| hypothetical protein BACCAC_03660 [Bacteroides caccae ATCC 43185] Length = 416 Score = 39.0 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 17/57 (29%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A + F+PV+DL P + F + A R NP Sbjct: 160 AYETRACCVPWTFAPVMDLGRDPRWP--RMWESFGEDTYVNAQMAVQAVRGLQGDNP 214 >gi|162455179|ref|YP_001617546.1| hypothetical protein sce6897 [Sorangium cellulosum 'So ce 56'] gi|161165761|emb|CAN97066.1| unnamed protein product [Sorangium cellulosum 'So ce 56'] Length = 832 Score = 39.0 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A G++V P ++L P + FS P + R + Sbjct: 105 LASEARRKGVDVVLGPTVNLHRSPLG--GRHFECFSEDPLLTGRLGAAYVRGLQAH 158 >gi|280977787|gb|ACZ98611.1| glucosidase [Cellulosilyticum ruminicola] Length = 702 Score = 39.0 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK + G++ FSPVL L + F E Y Sbjct: 112 AKEVAADGLHWTFSPVLCLARDTR--WGRIDETFGEDAYLTGELGAAIIEGYQ 162 >gi|325298569|ref|YP_004258486.1| Beta-glucosidase [Bacteroides salanitronis DSM 18170] gi|324318122|gb|ADY36013.1| Beta-glucosidase [Bacteroides salanitronis DSM 18170] Length = 763 Score = 39.0 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK +GI FSP++D+ + P A+ + R Y Sbjct: 146 AKEATANGIAWTFSPMVDICRDAR--WGRIAEGNGEDPFIGAMMARAYVRGYQ 196 >gi|313158675|gb|EFR58064.1| glycosyl hydrolase family 3 N-terminal domain protein [Alistipes sp. HGB5] Length = 771 Score = 39.0 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 8/52 (15%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 +A + G ++ + PVLD++ P ++ + + + R Sbjct: 165 IAAEIRLQGGHICYGPVLDIVRDPR--WSRTEESYGEDCYLTARIGEAYVRG 214 >gi|167645268|ref|YP_001682931.1| glycoside hydrolase family 3 protein [Caulobacter sp. K31] gi|167347698|gb|ABZ70433.1| glycoside hydrolase family 3 domain protein [Caulobacter sp. K31] Length = 826 Score = 39.0 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 14/53 (26%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG + F P L + + +S P A Sbjct: 181 AQETAASGFDWAFGPTLTVPRDDR--WGRTYEGYSEDPEIVRSYAGQMILGLQ 231 >gi|313156839|gb|EFR56279.1| glycosyl hydrolase family 3 C-terminal domain protein [Alistipes sp. HGB5] Length = 772 Score = 39.0 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A I NF+PV+DL P ++ + A R Sbjct: 161 AYETRACAIPWNFAPVMDLGRDPR--WSRMWESYGEDVCVNSRLAAASVRGLQ 211 >gi|145613742|ref|XP_363470.2| hypothetical protein MGG_01396 [Magnaporthe oryzae 70-15] gi|145020773|gb|EDK04902.1| hypothetical protein MGG_01396 [Magnaporthe oryzae 70-15] Length = 787 Score = 39.0 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A G+N F+PV+DL + +S A E + + Sbjct: 165 IALESRALGVNQIFAPVVDLARELR--FGRVEECYSEDAFLAGEYGYAYVKAMQ 216 >gi|320585779|gb|EFW98458.1| glycoside hydrolase family 3 domain containing protein [Grosmannia clavigera kw1407] Length = 942 Score = 39.0 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Query: 1 MAKN-LVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + GI + P +DL P ++ F + E A + R + Sbjct: 146 IAREEYLALGIRLALHPQVDLATEPR--WSRINRTFGEDADLSCELASAYVRGFQ 198 >gi|291514622|emb|CBK63832.1| Beta-glucosidase-related glycosidases [Alistipes shahii WAL 8301] Length = 762 Score = 39.0 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A I NF+PV+DL P ++ + A R Sbjct: 151 AYETRACAIPWNFAPVMDLGRDPR--WSRMWESYGEDVCVNSRLAAASVRGLQ 201 >gi|254523206|ref|ZP_05135261.1| 1,4-beta-D-glucan glucohydrolase D [Stenotrophomonas sp. SKA14] gi|219720797|gb|EED39322.1| 1,4-beta-D-glucan glucohydrolase D [Stenotrophomonas sp. SKA14] Length = 843 Score = 39.0 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+++ +GI F+P L + + P + +S P A + + Sbjct: 171 ARSVRATGIGWVFAPTLAVAHDPR--WGRTYESYSSDPMVIRSFAHAYVKGAQ 221 >gi|238064360|ref|ZP_04609069.1| beta-glucosidase [Micromonospora sp. ATCC 39149] gi|237886171|gb|EEP74999.1| beta-glucosidase [Micromonospora sp. ATCC 39149] Length = 514 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G++ FSPVL + + F P E A R Y Sbjct: 141 AVEVAPTGVHWTFSPVLCIARDLR--WGRIGETFGEDPFLIGELAAAMVRGYQ 191 >gi|332663029|ref|YP_004445817.1| Xylan 1,4-beta-xylosidase [Haliscomenobacter hydrossis DSM 1100] gi|332331843|gb|AEE48944.1| Xylan 1,4-beta-xylosidase [Haliscomenobacter hydrossis DSM 1100] Length = 775 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 18/56 (32%), Gaps = 8/56 (14%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRS---IFSRIPAKAEESAQLFSRTYI 54 A GI SP +D+ P + F P A E A+ + + Sbjct: 231 AAEYRALGIATALSPQVDIATEP-----RWNRFSGTFGEDPYLAAEMARAYCDGFQ 281 >gi|124024899|ref|YP_001014015.1| beta-N-acetylglucosaminidase [Prochlorococcus marinus str. NATL1A] gi|123959967|gb|ABM74750.1| Possible beta-N-acetylglucosaminidase [Prochlorococcus marinus str. NATL1A] Length = 544 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 K G+N +PV D+ P + + P + F R Sbjct: 124 GKEAKKIGLNWLLAPVCDINNNPNNPVINL-RAWGEEPETVKSLTCAFQRG 173 >gi|90415624|ref|ZP_01223558.1| glucan 1,4-beta-glucosidase [marine gamma proteobacterium HTCC2207] gi|90332947|gb|EAS48117.1| glucan 1,4-beta-glucosidase [marine gamma proteobacterium HTCC2207] Length = 833 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +G++ F+P + ++ + FS PA E A Sbjct: 171 AKEILVTGLDWTFAPTIAVVRDDR--WGRTYESFSEDPAIVREYAGHLVEGLQ 221 >gi|260906052|ref|ZP_05914374.1| beta-glucosidase-like glycosyl hydrolase [Brevibacterium linens BL2] Length = 535 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +NL G ++F+P D+ G + + E + Y Sbjct: 181 GQNLTDLGFTIDFAPDADVTTGAKDVAINV-RSAGDDHKEVAEVVADAATGYH 232 >gi|319785689|ref|YP_004145164.1| glycoside hydrolase [Pseudoxanthomonas suwonensis 11-1] gi|317464201|gb|ADV25933.1| glycoside hydrolase family 3 domain protein [Pseudoxanthomonas suwonensis 11-1] Length = 862 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ T+G+ F+P + + + +S P + A+ Sbjct: 195 AQETRTTGMEWTFAPTVAVPQDVR--WGRAYEGYSENPQLVADFARAMVEGLQ 245 >gi|332535023|ref|ZP_08410838.1| periplasmic beta-glucosidase [Pseudoalteromonas haloplanktis ANT/505] gi|332035542|gb|EGI72036.1| periplasmic beta-glucosidase [Pseudoalteromonas haloplanktis ANT/505] Length = 839 Score = 39.0 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A ++ +GI+ F+P + ++ + +S PA E + Sbjct: 173 AIEVMATGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPAIVREYSAAIVNGLQ 223 >gi|300785890|ref|YP_003766181.1| beta-glucosidase [Amycolatopsis mediterranei U32] gi|299795404|gb|ADJ45779.1| beta-glucosidase [Amycolatopsis mediterranei U32] Length = 1218 Score = 39.0 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 8/41 (19%), Positives = 14/41 (34%), Gaps = 2/41 (4%) Query: 14 FSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 ++P ++L P + F P + A F Y Sbjct: 174 WAPTVNLDRDPR--WGRTDEGFGEDPYLVAKMAGAFVNGYQ 212 >gi|119469377|ref|ZP_01612316.1| Beta-glucosidase [Alteromonadales bacterium TW-7] gi|119447241|gb|EAW28510.1| Beta-glucosidase [Alteromonadales bacterium TW-7] Length = 855 Score = 39.0 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A ++ +GI+ F+P + ++ + +S PA + + Sbjct: 189 AVEVMATGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPAIVRKYSAAIVNGLQ 239 >gi|329962030|ref|ZP_08300041.1| glycosyl hydrolase family 3 protein [Bacteroides fluxus YIT 12057] gi|328530678|gb|EGF57536.1| glycosyl hydrolase family 3 protein [Bacteroides fluxus YIT 12057] Length = 941 Score = 39.0 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 7/55 (12%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + G ++P+LD+ + ++ P E R ++ Sbjct: 199 GREARMLGYTNVYAPILDVGRDQR--WGRYEEVYGESPYLVAELGIEMVRGLQQH 251 >gi|310815160|ref|YP_003963124.1| Beta-glucosidase [Ketogulonicigenium vulgare Y25] gi|308753895|gb|ADO41824.1| Beta-glucosidase [Ketogulonicigenium vulgare Y25] Length = 490 Score = 39.0 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + ++ +P +++ P + FS P A A F + Sbjct: 86 LAAEVRAKKAHIILAPAVNMHRNPLN--GRNFENFSEDPHLAARMAVAFIKGVQ 137 >gi|326492610|dbj|BAJ90161.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326502242|dbj|BAJ95184.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 614 Score = 39.0 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 8/48 (16%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLF 49 A + +GI+ F+P + + P + +S P + Sbjct: 138 ALEVRATGIHWAFAPCVAVCRDPR--WGRCYESYSEDPEIVRSLTTIV 183 >gi|329956938|ref|ZP_08297506.1| glycosyl hydrolase family 3 protein [Bacteroides clarus YIT 12056] gi|328523695|gb|EGF50787.1| glycosyl hydrolase family 3 protein [Bacteroides clarus YIT 12056] Length = 944 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + G ++P+LD+ + ++ P E R N Sbjct: 199 GREARMLGYTNVYAPILDVGRDQR--WGRYEEVYGESPYLVAELGIEMVRGLQHN 251 >gi|317480750|ref|ZP_07939836.1| glycosyl hydrolase family 3 C terminal domain-containing protein [Bacteroides sp. 4_1_36] gi|316903091|gb|EFV24959.1| glycosyl hydrolase family 3 C terminal domain-containing protein [Bacteroides sp. 4_1_36] Length = 942 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + G ++P+LD+ + ++ P E R N Sbjct: 199 GREARMLGYTNVYAPILDVGRDQR--WGRYEEVYGESPYLVAELGIEMVRGLQHN 251 >gi|270296173|ref|ZP_06202373.1| conserved hypothetical protein [Bacteroides sp. D20] gi|270273577|gb|EFA19439.1| conserved hypothetical protein [Bacteroides sp. D20] Length = 942 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + G ++P+LD+ + ++ P E R N Sbjct: 199 GREARMLGYTNVYAPILDVGRDQR--WGRYEEVYGESPYLVAELGIEMVRGLQHN 251 >gi|255692030|ref|ZP_05415705.1| xylosidase [Bacteroides finegoldii DSM 17565] gi|260622277|gb|EEX45148.1| xylosidase [Bacteroides finegoldii DSM 17565] Length = 865 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 ++ L T G+ SP +D+ + F P A R Y+ + Sbjct: 161 ISGELNTMGVKQVLSPCIDVARELR--WGRVEESFGEDPFLCSAMAVAEVRGYLDH 214 >gi|160892207|ref|ZP_02073210.1| hypothetical protein BACUNI_04671 [Bacteroides uniformis ATCC 8492] gi|156858685|gb|EDO52116.1| hypothetical protein BACUNI_04671 [Bacteroides uniformis ATCC 8492] Length = 990 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + G ++P+LD+ + ++ P E R N Sbjct: 247 GREARMLGYTNVYAPILDVGRDQR--WGRYEEVYGESPYLVAELGIEMVRGLQHN 299 >gi|255949250|ref|XP_002565392.1| Pc22g14710 [Penicillium chrysogenum Wisconsin 54-1255] gi|211592409|emb|CAP98759.1| Pc22g14710 [Penicillium chrysogenum Wisconsin 54-1255] Length = 781 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 +A+ G+N F+PV+DL + FS P + E + + KN Sbjct: 161 IAQEAKALGVNQLFAPVVDLARELR--FGRVEEGFSEDPFLSGEYGYSYVKGVQGKN 215 >gi|319935812|ref|ZP_08010241.1| hypothetical protein HMPREF9488_01072 [Coprobacillus sp. 29_1] gi|319809247|gb|EFW05696.1| hypothetical protein HMPREF9488_01072 [Coprobacillus sp. 29_1] Length = 1118 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + G F+P L L + FS A + + Sbjct: 147 AQEIRAIGATWAFTPTLGLPQNER--WGRTYECFSETSDVASQLGSAYIEGLQ 197 >gi|254419249|ref|ZP_05032973.1| Glycosyl hydrolase family 3 N terminal domain protein [Brevundimonas sp. BAL3] gi|196185426|gb|EDX80402.1| Glycosyl hydrolase family 3 N terminal domain protein [Brevundimonas sp. BAL3] Length = 731 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 9/46 (19%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 GI+ F+P+LD+ P + P A+ + + Sbjct: 123 GIHWTFAPMLDITRDPR--WGRIVEGPGEDPYLGAALARAAVKGFQ 166 >gi|167765093|ref|ZP_02437206.1| hypothetical protein BACSTE_03479 [Bacteroides stercoris ATCC 43183] gi|167696721|gb|EDS13300.1| hypothetical protein BACSTE_03479 [Bacteroides stercoris ATCC 43183] Length = 944 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + G ++P+LD+ + ++ P E R N Sbjct: 199 GREARMLGYTNVYAPILDVGRDQR--WGRYEEVYGESPYLVAELGIEMVRGLQHN 251 >gi|110639943|ref|YP_680153.1| b-glucosidase [Cytophaga hutchinsonii ATCC 33406] gi|110282624|gb|ABG60810.1| b-glucosidase, glycoside hydrolase family 3 protein [Cytophaga hutchinsonii ATCC 33406] Length = 750 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 A +GI NF+PVLD+ ++ F A E R + Sbjct: 159 AVQTRAAGIRYNFAPVLDVGRN--QLWSRFGETFGEDTYIATEMGLASIRGF 208 >gi|312898690|ref|ZP_07758080.1| glycosyl hydrolase family 3 protein [Megasphaera micronuciformis F0359] gi|310620609|gb|EFQ04179.1| glycosyl hydrolase family 3 protein [Megasphaera micronuciformis F0359] Length = 389 Score = 39.0 bits (90), Expect = 0.25, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 18/52 (34%), Gaps = 7/52 (13%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 L GIN+NF+PV D+ + ++ + + Y Sbjct: 168 GMQLKGMGINMNFAPVADVSATDS-------RSYGGNASQVSKFVDAAAYGY 212 >gi|294646832|ref|ZP_06724453.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides ovatus SD CC 2a] gi|292637777|gb|EFF56174.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides ovatus SD CC 2a] Length = 578 Score = 39.0 bits (90), Expect = 0.25, Method: Composition-based stats. Identities = 7/56 (12%), Positives = 17/56 (30%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A + +G + F+P +++ + + F P + N Sbjct: 127 ALEMRVTGSHWAFTPNIEI--ACDARWGRVGETFGEDPYLVSRMGVASIKGLQTDN 180 >gi|254432507|ref|ZP_05046210.1| beta-glucosidase [Cyanobium sp. PCC 7001] gi|197626960|gb|EDY39519.1| beta-glucosidase [Cyanobium sp. PCC 7001] Length = 742 Score = 38.6 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 7/56 (12%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + + G N + ++LL P + + + P +R ++ Sbjct: 108 IGREARSFGANWVAAVCVNLLRHPG--WGRAQETYGEDPHHVGALGAAMTRGLERH 161 >gi|224538590|ref|ZP_03679129.1| hypothetical protein BACCELL_03484 [Bacteroides cellulosilyticus DSM 14838] gi|224519799|gb|EEF88904.1| hypothetical protein BACCELL_03484 [Bacteroides cellulosilyticus DSM 14838] Length = 748 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 14/53 (26%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + GI F+P++D+ P + + Sbjct: 136 AIEASSVGIRWTFAPMIDIARDPR--WGRIAEGCGEDTYLTSVMGAAMVEGFQ 186 >gi|189467777|ref|ZP_03016562.1| hypothetical protein BACINT_04169 [Bacteroides intestinalis DSM 17393] gi|189436041|gb|EDV05026.1| hypothetical protein BACINT_04169 [Bacteroides intestinalis DSM 17393] Length = 750 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 14/53 (26%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + GI F+P++D+ P + + Sbjct: 138 AIEASSVGIRWTFAPMIDIARDPR--WGRIAEGCGEDTYLTSVMGAAMVEGFQ 188 >gi|281425268|ref|ZP_06256181.1| hypothetical protein HMPREF0971_02240 [Prevotella oris F0302] gi|281400561|gb|EFB31392.1| beta-glucosidase [Prevotella oris F0302] Length = 784 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A+ + G +++F PVLDL P ++ P + Sbjct: 178 IARQIRLQGAHISFGPVLDLTRDPR--WSRVEESMGEDPVLTACMEAAMVKGL 228 >gi|301161853|emb|CBW21397.1| putative beta-glucosidase [Bacteroides fragilis 638R] Length = 814 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A G ++ + PVLDL P ++ + P R + Sbjct: 194 IAIEASAQGAHIGYGPVLDLARDPR--WSRVEETYGEDPYLNGVMGTALVRGFQ 245 >gi|253563828|ref|ZP_04841285.1| periplasmic beta-glucosidase [Bacteroides sp. 3_2_5] gi|251947604|gb|EES87886.1| periplasmic beta-glucosidase [Bacteroides sp. 3_2_5] Length = 814 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A G ++ + PVLDL P ++ + P R + Sbjct: 194 IAIEASAQGAHIGYGPVLDLARDPR--WSRVEETYGEDPYLNGVMGTALVRGFQ 245 >gi|238620766|ref|YP_002915592.1| glycoside hydrolase family 3 domain protein [Sulfolobus islandicus M.16.4] gi|238381836|gb|ACR42924.1| glycoside hydrolase family 3 domain protein [Sulfolobus islandicus M.16.4] Length = 755 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 14/54 (25%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G N SPVLD+ P + + + + Sbjct: 126 IRYQAKLIGTNQCLSPVLDVCRDPR--WGRCEETYGEDQYLVASIGLAYVKGLQ 177 >gi|224543194|ref|ZP_03683733.1| hypothetical protein CATMIT_02394 [Catenibacterium mitsuokai DSM 15897] gi|224523981|gb|EEF93086.1| hypothetical protein CATMIT_02394 [Catenibacterium mitsuokai DSM 15897] Length = 790 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L + GIN N +PV+D+ + +S A Sbjct: 161 IGSELSSIGINTNLAPVVDVNNNANNPVIGL-RSYSDNADVVGNMASATIAGLKD 214 >gi|170735456|ref|YP_001774570.1| glycoside hydrolase family 3 protein [Burkholderia cenocepacia MC0-3] gi|169821494|gb|ACA96075.1| glycoside hydrolase family 3 domain protein [Burkholderia cenocepacia MC0-3] Length = 337 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 MAK + +GIN+ SP D++ G + + P A + + R Sbjct: 119 MAKGVAQAGINLVLSPTADVVTGRN--LWLNGRTLADDPVLAAAMVRAYVRG 168 >gi|60680320|ref|YP_210464.1| putative beta-glucosidase [Bacteroides fragilis NCTC 9343] gi|60491754|emb|CAH06512.1| putative beta-glucosidase [Bacteroides fragilis NCTC 9343] Length = 814 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A G ++ + PVLDL P ++ + P R + Sbjct: 194 IAIEASAQGAHIGYGPVLDLARDPR--WSRVEETYGEDPYLNGVMGTALVRGFQ 245 >gi|53712134|ref|YP_098126.1| periplasmic beta-glucosidase [Bacteroides fragilis YCH46] gi|52214999|dbj|BAD47592.1| periplasmic beta-glucosidase precursor [Bacteroides fragilis YCH46] Length = 812 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A G ++ + PVLDL P ++ + P R + Sbjct: 194 IAIEASAQGAHIGYGPVLDLARDPR--WSRVEETYGEDPYLNGVMGTALVRGFQ 245 >gi|116686694|ref|YP_839941.1| glycoside hydrolase family 3 protein [Burkholderia cenocepacia HI2424] gi|116652409|gb|ABK13048.1| glycoside hydrolase, family 3 domain protein [Burkholderia cenocepacia HI2424] Length = 337 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 MAK + +GIN+ SP D++ G + + P A + + R Sbjct: 119 MAKGVAQAGINLVLSPTADVVTGRN--LWLNGRTLADDPVLAAAMVRAYVRG 168 >gi|227497627|ref|ZP_03927845.1| possible xylan 1,4-beta-xylosidase [Actinomyces urogenitalis DSM 15434] gi|226832898|gb|EEH65281.1| possible xylan 1,4-beta-xylosidase [Actinomyces urogenitalis DSM 15434] Length = 766 Score = 38.6 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 +++ GI P +DL P + + + A + A+ P Sbjct: 180 ISQEYRALGITTALGPQIDLGTEPR--WMRLQDTWGPSSALVTDYARAVCDAMQTTP 234 >gi|94497564|ref|ZP_01304133.1| xylosidase/arabinosidase [Sphingomonas sp. SKA58] gi|94422981|gb|EAT08013.1| xylosidase/arabinosidase [Sphingomonas sp. SKA58] Length = 791 Score = 38.6 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G+++ SPV+D+ P + F P E Sbjct: 184 IAREVRARGVHLALSPVVDIARDPR--WGRIEETFGEDPYLCGEMGVAAVLGLQ 235 >gi|227828570|ref|YP_002830350.1| glycoside hydrolase [Sulfolobus islandicus M.14.25] gi|229585800|ref|YP_002844302.1| glycoside hydrolase family 3 domain protein [Sulfolobus islandicus M.16.27] gi|227460366|gb|ACP39052.1| glycoside hydrolase family 3 domain protein [Sulfolobus islandicus M.14.25] gi|228020850|gb|ACP56257.1| glycoside hydrolase family 3 domain protein [Sulfolobus islandicus M.16.27] Length = 755 Score = 38.6 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 14/54 (25%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G N SPVLD+ P + + + + Sbjct: 126 IRYQAKLIGTNQCLSPVLDVCRDPR--WGRCEETYGEDQYLVASIGLAYVKGLQ 177 >gi|301098089|ref|XP_002898138.1| beta glucosidase, putative [Phytophthora infestans T30-4] gi|262105499|gb|EEY63551.1| beta glucosidase, putative [Phytophthora infestans T30-4] Length = 743 Score = 38.6 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 ++ + +G F P+L++ P + F P ++ + N Sbjct: 161 GRDTLAAGTPWIFGPMLEISQNPLWP--RVYETFGEDPVLVSAISEALIKGIQSN 213 >gi|330911964|gb|EGH40474.1| periplasmic beta-glucosidase [Escherichia coli AA86] Length = 765 Score = 38.6 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + KNP Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSIMGKTMVEAMQGKNP 197 >gi|319901412|ref|YP_004161140.1| glycoside hydrolase family 3 domain protein [Bacteroides helcogenes P 36-108] gi|319416443|gb|ADV43554.1| glycoside hydrolase family 3 domain protein [Bacteroides helcogenes P 36-108] Length = 944 Score = 38.6 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + G ++P+LD+ + ++ P E R N Sbjct: 199 GREARMLGYTNVYAPILDVGRDQR--WGRYEEVYGESPYLVAELGIEMVRGMQYN 251 >gi|331647783|ref|ZP_08348875.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Escherichia coli M605] gi|331043507|gb|EGI15645.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Escherichia coli M605] Length = 765 Score = 38.6 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + KNP Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSIMGKTMVEAMQGKNP 197 >gi|313621926|gb|EFR92585.1| periplasmic beta-glucosidase [Listeria innocua FSL J1-023] Length = 756 Score = 38.6 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G+++ + LD+L P + + P A E + + Sbjct: 151 IAEEISEKGVHLALASALDILRDPR--WGRAEECYGEDPYLAAELTAAITEGFQ 202 >gi|288551611|gb|ADC53302.1| glucosidase [Martelella mediterranea] Length = 831 Score = 38.6 bits (89), Expect = 0.29, Method: Composition-based stats. Identities = 8/56 (14%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A + G V +P +++ + +S P A + + N Sbjct: 94 LAAEARSKGARVLLAPTVNMHRSGLN--GRNFECYSEDPLLTSMLAVAYVKGLQDN 147 >gi|329851774|ref|ZP_08266455.1| beta-xylosidase B [Asticcacaulis biprosthecum C19] gi|328839623|gb|EGF89196.1| beta-xylosidase B [Asticcacaulis biprosthecum C19] Length = 802 Score = 38.6 bits (89), Expect = 0.29, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + G N+ +PV+D+ P + + P + + Sbjct: 194 AREMRARGANLALAPVVDVARDPR--WGRIEETYGEDPYVCGVMGKAAVIGFQ 244 >gi|329936816|ref|ZP_08286495.1| putative beta-glucosidase [Streptomyces griseoaurantiacus M045] gi|329303741|gb|EGG47625.1| putative beta-glucosidase [Streptomyces griseoaurantiacus M045] Length = 1009 Score = 38.6 bits (89), Expect = 0.29, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G+ +F+P L + + F PA + R Sbjct: 460 AAEVRATGVPWDFAPCLCVSRDER--WGRAYESFGEDPALVTSM-ETVIRGLQ 509 >gi|328475465|gb|EGF46230.1| beta-glucosidase [Lactobacillus rhamnosus MTCC 5462] Length = 161 Score = 38.6 bits (89), Expect = 0.29, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + G++V P +++ P + FS P A + + + K Sbjct: 53 IGLEAQSLGVDVVLGPGVNMKRNPLC--GRNFEYFSEDPYLAGKLGAAWIQGMQK 105 >gi|163846652|ref|YP_001634696.1| glycoside hydrolase family 3 protein [Chloroflexus aurantiacus J-10-fl] gi|222524453|ref|YP_002568924.1| glycoside hydrolase family 3 domain-containing protein [Chloroflexus sp. Y-400-fl] gi|163667941|gb|ABY34307.1| glycoside hydrolase family 3 domain protein [Chloroflexus aurantiacus J-10-fl] gi|222448332|gb|ACM52598.1| glycoside hydrolase family 3 domain protein [Chloroflexus sp. Y-400-fl] Length = 619 Score = 38.6 bits (89), Expect = 0.30, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G+ N++P + + + ++ P A F R Sbjct: 163 ALEMAATGVFWNYAPAVMVPLDVR--WGRTYEGYAERPDHVAALASAFLRGLQ 213 >gi|322371968|ref|ZP_08046510.1| glycoside hydrolase family 3 domain protein [Haladaptatus paucihalophilus DX253] gi|320548390|gb|EFW90062.1| glycoside hydrolase family 3 domain protein [Haladaptatus paucihalophilus DX253] Length = 776 Score = 38.6 bits (89), Expect = 0.30, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L G SPVLD+ + F P A+ + Sbjct: 140 IRGQLEAIGTTHALSPVLDIARDLR--WGRVEETFGEDPYLVAAMARGYVNGLQ 191 >gi|295136515|ref|YP_003587191.1| beta-N-acetylglucosaminidase [Zunongwangia profunda SM-A87] gi|294984530|gb|ADF54995.1| beta-N-acetylglucosaminidase [Zunongwangia profunda SM-A87] Length = 982 Score = 38.6 bits (89), Expect = 0.30, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A+ + +G+++NF+ + + F K E + R Sbjct: 153 ARQVKRTGLHMNFA-PVVDVNNNPNNPVINYRSFGENKEKVAEKGIAYMRGMQD 205 >gi|227536644|ref|ZP_03966693.1| possible beta-glucosidase [Sphingobacterium spiritivorum ATCC 33300] gi|227243445|gb|EEI93460.1| possible beta-glucosidase [Sphingobacterium spiritivorum ATCC 33300] Length = 777 Score = 38.6 bits (89), Expect = 0.30, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 AK + G ++++ PVLDL P ++ + P A Sbjct: 172 AKEVRQQGAHISYGPVLDLSRDPR--WSRVEESYGEDPVLTGTLAAAIVTGL 221 >gi|242798296|ref|XP_002483140.1| glycosyl hydrolase, putative [Talaromyces stipitatus ATCC 10500] gi|218716485|gb|EED15906.1| glycosyl hydrolase, putative [Talaromyces stipitatus ATCC 10500] Length = 390 Score = 38.6 bits (89), Expect = 0.30, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 19/53 (35%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A L IN N +PVLD+ P F + +S A F+ Sbjct: 134 ASALAAYNINTNLAPVLDVFRTPGDFDDRFGRSYSNNATLAGICGGAFTTAQQ 186 >gi|255010014|ref|ZP_05282140.1| putative exported beta-glucosidase [Bacteroides fragilis 3_1_12] gi|313147808|ref|ZP_07810001.1| periplasmic beta-glucosidase [Bacteroides fragilis 3_1_12] gi|313136575|gb|EFR53935.1| periplasmic beta-glucosidase [Bacteroides fragilis 3_1_12] Length = 766 Score = 38.6 bits (89), Expect = 0.31, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P + AQ R Y Sbjct: 141 AIEASADGISWTFSPMVDISRDPR--WGRVSEGSGEDPFLGAQIAQAMVRGYQ 191 >gi|297627150|ref|YP_003688913.1| secreted glycosyl hydrolase [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1] gi|296922915|emb|CBL57497.1| secreted glycosyl hydrolase [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1] Length = 413 Score = 38.6 bits (89), Expect = 0.31, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 15/57 (26%), Gaps = 4/57 (7%) Query: 2 AKNLVTSGINVNFSPVLDL----LYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L G++ N +P DL G I Q + A + Sbjct: 188 GAQLRRGGVHYNLAPSADLVPRANRGANAPIGQLDRGYGATRADVATNVTAVLAGVH 244 >gi|289718454|gb|ADD17009.1| beta-glucosidase [uncultured rumen bacterium] Length = 765 Score = 38.6 bits (89), Expect = 0.31, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 M + + G +V +P L++ P + +S P A ++A + R N Sbjct: 133 MGEEVHEYGADVYLAPALNIHRNPLN--GRNFEYYSEDPVVAGKTAAAYVRGVQSN 186 >gi|515668|gb|AAA91967.1| beta-glucosidase [uncultured bacterium] Length = 352 Score = 38.6 bits (89), Expect = 0.32, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK + G++ FSP+L L + F P A E A + Y Sbjct: 142 AKEVAADGLHWTFSPILCLGRDLR--WGRINETFGEDPYLAGELAASIIQGYQ 192 >gi|308176152|ref|YP_003915558.1| glycosyl hydrolase family 3 protein [Arthrobacter arilaitensis Re117] gi|307743615|emb|CBT74587.1| glycosyl hydrolase, family 3 [Arthrobacter arilaitensis Re117] Length = 439 Score = 38.6 bits (89), Expect = 0.32, Method: Composition-based stats. Identities = 12/47 (25%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Query: 2 AKNLVTSGINVNFSPVLDLLYG----PETFIAQKRSIFSRIPAKAEE 44 K LV +GINVN +PV D++ I ++ + Sbjct: 200 GKQLVEAGINVNLAPVADVVPAELGTGNAPIGYFGREYAHGATAVAK 246 >gi|225012305|ref|ZP_03702742.1| glycoside hydrolase family 3 domain protein [Flavobacteria bacterium MS024-2A] gi|225003860|gb|EEG41833.1| glycoside hydrolase family 3 domain protein [Flavobacteria bacterium MS024-2A] Length = 753 Score = 38.6 bits (89), Expect = 0.32, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK +GIN F+P++D+ + P A R + Sbjct: 139 AKEAAAAGINWTFAPMIDITRDAR--WGRVMEGAGEDPYLGSLIAAARVRGFQ 189 >gi|188025464|ref|ZP_02958767.2| hypothetical protein PROSTU_00519 [Providencia stuartii ATCC 25827] gi|188023590|gb|EDU61630.1| hypothetical protein PROSTU_00519 [Providencia stuartii ATCC 25827] Length = 612 Score = 38.6 bits (89), Expect = 0.32, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L + G N+NF PV+D+ + +S E + + + K Sbjct: 149 GYELSSLGFNINFGPVVDVNNNQNNPVIGV-RSYSDNKELVEALSTNYIKGIHK 201 >gi|291541211|emb|CBL14322.1| Beta-glucosidase-related glycosidases [Roseburia intestinalis XB6B4] Length = 731 Score = 38.2 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G++ LD+L P + + P + E A+ K Sbjct: 146 GRQLKQMGVDFALVSTLDILRDPR--WGRSEECYGEDPYLSAELARAIVTGIQK 197 >gi|94967561|ref|YP_589609.1| glycoside hydrolase family protein [Candidatus Koribacter versatilis Ellin345] gi|94549611|gb|ABF39535.1| glycoside hydrolase, family 3-like protein [Candidatus Koribacter versatilis Ellin345] Length = 751 Score = 38.2 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK T G+ FSP++D+ + P E A+ + R Y Sbjct: 146 AKEASTDGVRWTFSPMVDIARDAR--WGRITEGAGEDPYLGSEIAKAYVRGYQ 196 >gi|313159041|gb|EFR58416.1| glycosyl hydrolase family 3 N-terminal domain protein [Alistipes sp. HGB5] Length = 760 Score = 38.2 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 17/56 (30%), Gaps = 8/56 (14%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRS---IFSRIPAKAEESAQLFSRTYI 54 + GI SP +DL P + F P + A+ + + Sbjct: 236 SAEYRALGIATALSPQIDLATEP-----RWNRFYGTFGEDPDLDTDMARAYIDGFQ 286 >gi|293370496|ref|ZP_06617049.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides ovatus SD CMC 3f] gi|292634488|gb|EFF53024.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides ovatus SD CMC 3f] Length = 759 Score = 38.2 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A GI FSP++D+ + P A+ + R Y N Sbjct: 143 AVEASADGICWTFSPMVDICRDSR--WGRIAEGSGEDPYLGSLLAKAYVRGYQGN 195 >gi|291514618|emb|CBK63828.1| Beta-glucosidase-related glycosidases [Alistipes shahii WAL 8301] Length = 744 Score = 38.2 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 17/56 (30%), Gaps = 8/56 (14%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRS---IFSRIPAKAEESAQLFSRTYI 54 + GI SP +DL P + F P + A+ + + Sbjct: 220 SAEYRALGIATALSPQIDLATEP-----RWNRFYGTFGEDPDLDTDMARAYIDGFQ 270 >gi|237716627|ref|ZP_04547108.1| periplasmic beta-glucosidase [Bacteroides sp. D1] gi|262405402|ref|ZP_06081952.1| periplasmic beta-glucosidase [Bacteroides sp. 2_1_22] gi|294647634|ref|ZP_06725202.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides ovatus SD CC 2a] gi|294809150|ref|ZP_06767868.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides xylanisolvens SD CC 1b] gi|229442610|gb|EEO48401.1| periplasmic beta-glucosidase [Bacteroides sp. D1] gi|262356277|gb|EEZ05367.1| periplasmic beta-glucosidase [Bacteroides sp. 2_1_22] gi|292637022|gb|EFF55472.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides ovatus SD CC 2a] gi|294443704|gb|EFG12453.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides xylanisolvens SD CC 1b] Length = 759 Score = 38.2 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A GI FSP++D+ + P A+ + R Y N Sbjct: 143 AVEASADGICWTFSPMVDICRDSR--WGRIAEGSGEDPYLGSLLAKAYVRGYQGN 195 >gi|83649438|ref|YP_437873.1| beta-glucosidase-like protein [Hahella chejuensis KCTC 2396] gi|83637481|gb|ABC33448.1| Beta-glucosidase-related Glycosidase [Hahella chejuensis KCTC 2396] Length = 1056 Score = 38.2 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK + +GI+ F+P L ++ + +S N Sbjct: 193 AKEVAVTGIDWTFAPTLAVVRDDR--WGRTYEGYSEDGEIIFNYGAAMVEGLQGN 245 >gi|325104789|ref|YP_004274443.1| glycoside hydrolase family 3 domain protein [Pedobacter saltans DSM 12145] gi|324973637|gb|ADY52621.1| glycoside hydrolase family 3 domain protein [Pedobacter saltans DSM 12145] Length = 802 Score = 38.2 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + G ++P+LDL P + + P E + N Sbjct: 192 GREGKALGYTNVYAPILDLARDPR--WGRVVECYGEDPFLVGELGKNMVSGLQSN 244 >gi|160891566|ref|ZP_02072569.1| hypothetical protein BACUNI_04018 [Bacteroides uniformis ATCC 8492] gi|156858973|gb|EDO52404.1| hypothetical protein BACUNI_04018 [Bacteroides uniformis ATCC 8492] Length = 773 Score = 38.2 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 13/51 (25%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 SGIN +SP+LD+ + F P E + R Y Sbjct: 147 EATASGINWVYSPMLDICRDAR--WGRIAETFGEDPFLCGELGKAMVRGYQ 195 >gi|329848297|ref|ZP_08263325.1| 1,4-B-D-glucan glucohydrolase [Asticcacaulis biprosthecum C19] gi|328843360|gb|EGF92929.1| 1,4-B-D-glucan glucohydrolase [Asticcacaulis biprosthecum C19] Length = 826 Score = 38.2 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + ++G++ F+P + + + +S P A A Sbjct: 181 AAEVRSTGMDWTFAPTIAVARDDR--WGRTYESYSEDPRIASTYAAAMVAGIQ 231 >gi|329922637|ref|ZP_08278189.1| glycosyl hydrolase family 3 N-terminal domain protein [Paenibacillus sp. HGF5] gi|328941979|gb|EGG38262.1| glycosyl hydrolase family 3 N-terminal domain protein [Paenibacillus sp. HGF5] Length = 765 Score = 38.2 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + G V +SPVLD++ P + F P E A Sbjct: 149 ALETRSQGGAVTYSPVLDVVRDPR--WGRTEECFGEDPYLISEYAVASVEGLQ 199 >gi|255692619|ref|ZP_05416294.1| beta-glucosidase [Bacteroides finegoldii DSM 17565] gi|260621679|gb|EEX44550.1| beta-glucosidase [Bacteroides finegoldii DSM 17565] Length = 769 Score = 38.2 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A GI+ FSP++D+ P + P A+ R Y KN Sbjct: 142 AVEASADGISWTFSPMVDVSRDPR--WGRVSEGSGEDPFLGAMIAEAMVRGYQGKN 195 >gi|261405721|ref|YP_003241962.1| glycoside hydrolase family 3 domain-containing protein [Paenibacillus sp. Y412MC10] gi|261282184|gb|ACX64155.1| glycoside hydrolase family 3 domain protein [Paenibacillus sp. Y412MC10] Length = 765 Score = 38.2 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + G V +SPVLD++ P + F P E A Sbjct: 149 ALETRSQGGAVTYSPVLDVVRDPR--WGRTEECFGEDPYLISEYAVASVEGLQ 199 >gi|256394357|ref|YP_003115921.1| glycoside hydrolase family 3 domain-containing protein [Catenulispora acidiphila DSM 44928] gi|256360583|gb|ACU74080.1| glycoside hydrolase family 3 domain protein [Catenulispora acidiphila DSM 44928] Length = 1357 Score = 38.2 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 8/43 (18%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Query: 14 FSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 ++P ++L P + F P + A F + N Sbjct: 179 WAPTVNLDRDPR--WGRTDEAFGEDPYLVGQMAGAFVNGFQGN 219 >gi|182412639|ref|YP_001817705.1| glycoside hydrolase family 3 protein [Opitutus terrae PB90-1] gi|177839853|gb|ACB74105.1| glycoside hydrolase family 3 domain protein [Opitutus terrae PB90-1] Length = 738 Score = 38.2 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +GI+ F+P++D+ P + P A+ + Sbjct: 139 ATETAAAGIHWTFAPMVDITRDPR--WGRVMEGSGEDPWLGSAIARARVHGFQ 189 >gi|6650326|gb|AAF21799.1|AF090429_2 beta-glucosidase precursor [Azospirillum irakense] Length = 649 Score = 38.2 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 15/52 (28%), Gaps = 2/52 (3%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 GI + SP DL P F PA+ + + + Sbjct: 197 AEYRAVGIQMALSPQADLATEPRWSRING--TFGEDPARVSAQVKAYVQGMQ 246 >gi|319790719|ref|YP_004152359.1| glycoside hydrolase family 3 domain protein [Variovorax paradoxus EPS] gi|315593182|gb|ADU34248.1| glycoside hydrolase family 3 domain protein [Variovorax paradoxus EPS] Length = 430 Score = 38.2 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 24/59 (40%), Gaps = 9/59 (15%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKR-------SIFSRIPAKAEESAQLFSRTY 53 ++L GI +NFSPV+DL G E + S PA + A + + Sbjct: 210 GRSLAALGITLNFSPVVDLRTGRE--PGRWDLHTRIDERAISADPALTTQVALAYEQGL 266 >gi|114571273|ref|YP_757953.1| Beta-glucosidase [Maricaulis maris MCS10] gi|114341735|gb|ABI67015.1| Beta-glucosidase [Maricaulis maris MCS10] Length = 759 Score = 38.2 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++ F+P++D+ P + P A+ Y Sbjct: 144 AEEASASGLHWTFAPMIDIARDPR--WGRIVEGGGADPYLGARMAEAQIAGYQ 194 >gi|126173373|ref|YP_001049522.1| glycoside hydrolase family 3 domain protein [Shewanella baltica OS155] gi|125996578|gb|ABN60653.1| exo-1,4-beta-glucosidase [Shewanella baltica OS155] Length = 886 Score = 38.2 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +GI+ F+P + ++ + +S P + + Sbjct: 208 AKEVMVTGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPVIVKSYSHAIVEGLQ 258 >gi|46128463|ref|XP_388785.1| hypothetical protein FG08609.1 [Gibberella zeae PH-1] Length = 773 Score = 38.2 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A GIN FSP +DL + FS P A E + + Sbjct: 156 IATESRAVGINQLFSPQVDLARELR--FGRVEECFSEDPYLAGEMGYSYVKGLQ 207 >gi|159041782|ref|YP_001541034.1| glycoside hydrolase family 3 protein [Caldivirga maquilingensis IC-167] gi|157920617|gb|ABW02044.1| glycoside hydrolase family 3 domain protein [Caldivirga maquilingensis IC-167] Length = 966 Score = 38.2 bits (88), Expect = 0.38, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ GI SPV++L + + + P A + A + + + Sbjct: 147 IARETRARGIRQCLSPVVNLTFDARA--GRTEETYGEDPYLASQLAYAYVKALRE 199 >gi|317056731|ref|YP_004105198.1| glycoside hydrolase family 3 domain-containing protein [Ruminococcus albus 7] gi|315449000|gb|ADU22564.1| glycoside hydrolase family 3 domain protein [Ruminococcus albus 7] Length = 444 Score = 38.2 bits (88), Expect = 0.39, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + LV+ G+N++F+PV D+ I K IFS P + + + Sbjct: 208 IGRYLVSYGVNLDFAPVADV-SEDSKKIGSK--IFSDDPLTVDSLVEAEIDGLHE 259 >gi|326334653|ref|ZP_08200860.1| beta-glucosidase [Capnocytophaga sp. oral taxon 338 str. F0234] gi|325693103|gb|EGD35035.1| beta-glucosidase [Capnocytophaga sp. oral taxon 338 str. F0234] Length = 786 Score = 38.2 bits (88), Expect = 0.39, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K G++V SP ++L P + +S P E A + Sbjct: 139 IGKEAKEYGVDVMLSPGVNLHRDPLN--GRNFEYYSEDPVLIGEIATAYINGIQ 190 >gi|260172818|ref|ZP_05759230.1| glycoside hydrolase family 3 domain protein [Bacteroides sp. D2] gi|315921104|ref|ZP_07917344.1| conserved hypothetical protein [Bacteroides sp. D2] gi|313694979|gb|EFS31814.1| conserved hypothetical protein [Bacteroides sp. D2] Length = 946 Score = 38.2 bits (88), Expect = 0.39, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + G ++P+LD+ + ++ P E R + Sbjct: 199 GREARMLGYTNVYAPILDVGRDQR--WGRYEEVYGESPYLVAELGIEMVRGMQQ 250 >gi|301309249|ref|ZP_07215193.1| periplasmic beta-glucosidase/beta-xylosidase [Bacteroides sp. 20_3] gi|300832931|gb|EFK63557.1| periplasmic beta-glucosidase/beta-xylosidase [Bacteroides sp. 20_3] Length = 776 Score = 38.2 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + GI SP +D+ P ++ F P + ++ + + Sbjct: 238 SAEYRALGIATALSPQVDMATEPR--WSRVSGTFGEDPDLVTDMSRAYVDGFQ 288 >gi|262382233|ref|ZP_06075371.1| beta-glucosidase [Bacteroides sp. 2_1_33B] gi|262297410|gb|EEY85340.1| beta-glucosidase [Bacteroides sp. 2_1_33B] Length = 601 Score = 38.2 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + GI SP +D+ P ++ F P + ++ + + Sbjct: 221 SAEYRALGIATALSPQVDMATEPR--WSRVSGTFGEDPDLVTDMSRAYVDGFQ 271 >gi|217974329|ref|YP_002359080.1| glycoside hydrolase family 3 domain-containing protein [Shewanella baltica OS223] gi|217499464|gb|ACK47657.1| glycoside hydrolase family 3 domain protein [Shewanella baltica OS223] Length = 886 Score = 38.2 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +GI+ F+P + ++ + +S P + + Sbjct: 208 AKEVMVTGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPVIVKSYSHAIVEGLQ 258 >gi|253754605|ref|YP_003027746.1| beta-glucosidase [Streptococcus suis P1/7] gi|251820851|emb|CAR47617.1| putative beta-glucosidase [Streptococcus suis P1/7] Length = 799 Score = 38.2 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+NV P L++ P + +S P +A + A R Sbjct: 90 LGAEANSLGVNVILGPGLNIKRSPLC--GRNFEYYSEDPYQAGKLAAAMIRGMQ 141 >gi|253752780|ref|YP_003025921.1| beta-glucosidase [Streptococcus suis SC84] gi|253756538|ref|YP_003029678.1| beta-glucosidase [Streptococcus suis BM407] gi|251817069|emb|CAZ52721.1| putative beta-glucosidase [Streptococcus suis SC84] gi|251819002|emb|CAZ56849.1| putative beta-glucosidase [Streptococcus suis BM407] gi|319759198|gb|ADV71140.1| glucocerebrosidase [Streptococcus suis JS14] Length = 799 Score = 38.2 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+NV P L++ P + +S P +A + A R Sbjct: 90 LGAEANSLGVNVILGPGLNIKRSPLC--GRNFEYYSEDPYQAGKLAAAMIRGMQ 141 >gi|146319799|ref|YP_001199511.1| glucocerebrosidase [Streptococcus suis 05ZYH33] gi|146321994|ref|YP_001201705.1| glucocerebrosidase [Streptococcus suis 98HAH33] gi|145690605|gb|ABP91111.1| glucocerebrosidase [Streptococcus suis 05ZYH33] gi|145692800|gb|ABP93305.1| glucocerebrosidase [Streptococcus suis 98HAH33] gi|292559403|gb|ADE32404.1| Thermostable beta-glucosidase B [Streptococcus suis GZ1] Length = 800 Score = 38.2 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+NV P L++ P + +S P +A + A R Sbjct: 91 LGAEANSLGVNVILGPGLNIKRSPLC--GRNFEYYSEDPYQAGKLAAAMIRGMQ 142 >gi|107023065|ref|YP_621392.1| glycoside hydrolase family protein [Burkholderia cenocepacia AU 1054] gi|105893254|gb|ABF76419.1| glycoside hydrolase, family 3-like protein [Burkholderia cenocepacia AU 1054] Length = 288 Score = 38.2 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 MAK + +GIN+ SP D++ G + + P A + + R Sbjct: 70 MAKGVAQAGINLVLSPTADVVTGRN--LWLNGRTLADDPVLAAAMVRAYVRG 119 >gi|330808014|ref|YP_004352476.1| beta-glucosidase; glycoside Hydrolase, GH3 family [Pseudomonas brassicacearum subsp. brassicacearum NFM421] gi|327376122|gb|AEA67472.1| Beta-glucosidase; Glycoside Hydrolase, GH3 family [Pseudomonas brassicacearum subsp. brassicacearum NFM421] Length = 763 Score = 38.2 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK +++ F+P++D+ P + F A + + + N Sbjct: 138 AKEAAADSLDITFAPMVDISRDPR--WGRTSEGFGEDTYLVSRIAGVMVKAFQGN 190 >gi|327402793|ref|YP_004343631.1| beta-glucosidase [Fluviicola taffensis DSM 16823] gi|327318301|gb|AEA42793.1| Beta-glucosidase [Fluviicola taffensis DSM 16823] Length = 878 Score = 38.2 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A GI SPV++L + + P E F R++ + Sbjct: 156 IALECKMRGIRQILSPVVNLATDVR--WGRTEETYGEDPFLTSEIGLAFIRSFEQ 208 >gi|160874337|ref|YP_001553653.1| glycoside hydrolase family 3 protein [Shewanella baltica OS195] gi|160859859|gb|ABX48393.1| glycoside hydrolase family 3 domain protein [Shewanella baltica OS195] gi|315266572|gb|ADT93425.1| glycoside hydrolase family 3 domain protein [Shewanella baltica OS678] Length = 886 Score = 38.2 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +GI+ F+P + ++ + +S P + + Sbjct: 208 AKEVMVTGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPVIVKSYSHAIVEGLQ 258 >gi|159899980|ref|YP_001546227.1| glycoside hydrolase family 3 protein [Herpetosiphon aurantiacus ATCC 23779] gi|159893019|gb|ABX06099.1| glycoside hydrolase family 3 domain protein [Herpetosiphon aurantiacus ATCC 23779] Length = 721 Score = 38.2 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 7/46 (15%), Positives = 14/46 (30%), Gaps = 2/46 (4%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 GIN F+P++D+ P + + + Sbjct: 114 GINWTFAPMIDISRDPR--WGRIAESCGEDAYLSSLMGVAMVEGFQ 157 >gi|240144945|ref|ZP_04743546.1| beta-glucosidase [Roseburia intestinalis L1-82] gi|257203006|gb|EEV01291.1| beta-glucosidase [Roseburia intestinalis L1-82] Length = 731 Score = 38.2 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + L G++ LD+L P + + P + E A+ K Sbjct: 146 GRQLKQMGVDFALVSALDILRDPR--WGRSEECYGEDPYLSAELARAIVTGIQK 197 >gi|282850713|ref|ZP_06260088.1| conserved domain protein [Lactobacillus gasseri 224-1] gi|282558121|gb|EFB63708.1| conserved domain protein [Lactobacillus gasseri 224-1] Length = 258 Score = 38.2 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEES 45 A L + GIN N++P D P TF+ F + + + Sbjct: 162 ATLLRSLGINWNYAPDADYSTKPGTFM--WDRTFGQGYQQTADY 203 >gi|268611122|ref|ZP_06144849.1| beta-N-acetylhexosaminidase [Ruminococcus flavefaciens FD-1] Length = 825 Score = 38.2 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A + NFSP + P + + + + +++ I Sbjct: 176 ADEAKLCHMMWNFSPCVAQSVDPR--WGRTYESYGSDLETITKLSTAYTKGLID 227 >gi|148657583|ref|YP_001277788.1| glycoside hydrolase family 3 protein [Roseiflexus sp. RS-1] gi|148569693|gb|ABQ91838.1| glycoside hydrolase, family 3 domain protein [Roseiflexus sp. RS-1] Length = 915 Score = 38.2 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G ++ +P +++ P + +S P + A + Sbjct: 98 LAEEAQSKGAHLLLAPTVNIHRSPLN--GRNFECYSEDPYLSARMAVAYITGLQ 149 >gi|170781094|ref|YP_001709426.1| putative beta-glucosidase [Clavibacter michiganensis subsp. sepedonicus] gi|169155662|emb|CAQ00781.1| putative beta-glucosidase [Clavibacter michiganensis subsp. sepedonicus] Length = 852 Score = 38.2 bits (88), Expect = 0.42, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A G++V P ++L P + FS P + A + +N Sbjct: 126 AVEARRKGVDVVLGPTINLHRSPYG--GRHFEAFSEDPLLTADLAAAYVAGVQEN 178 >gi|152999718|ref|YP_001365399.1| glycoside hydrolase family 3 protein [Shewanella baltica OS185] gi|151364336|gb|ABS07336.1| glycoside hydrolase family 3 domain protein [Shewanella baltica OS185] Length = 886 Score = 38.2 bits (88), Expect = 0.42, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +GI+ F+P + ++ + +S P + + Sbjct: 208 AKEVMVTGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPVIVKSYSHAIVEGLQ 258 >gi|304409303|ref|ZP_07390923.1| glycoside hydrolase family 3 domain protein [Shewanella baltica OS183] gi|307303661|ref|ZP_07583414.1| glycoside hydrolase family 3 domain protein [Shewanella baltica BA175] gi|304351821|gb|EFM16219.1| glycoside hydrolase family 3 domain protein [Shewanella baltica OS183] gi|306912559|gb|EFN42982.1| glycoside hydrolase family 3 domain protein [Shewanella baltica BA175] Length = 886 Score = 38.2 bits (88), Expect = 0.42, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +GI+ F+P + ++ + +S P + + Sbjct: 208 AKEVMVTGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPVIVKSYSHAIVEGLQ 258 >gi|320008388|gb|ADW03238.1| glycoside hydrolase family 3 domain protein [Streptomyces flavogriseus ATCC 33331] Length = 1028 Score = 38.2 bits (88), Expect = 0.42, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A + +GI +F+P + + + + PA E + +P Sbjct: 479 ANEVRATGIPWDFAPCVCVTRDER--WGRSYEAYGEDPALVEAM-ETVITGMQGSP 531 >gi|118640521|gb|ABL09836.1| beta-glucosidase [Shewanella sp. G5] Length = 685 Score = 38.2 bits (88), Expect = 0.42, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +GI+ F+P + ++ + +S P + + Sbjct: 96 AKEVMVTGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPVIVKSYSHAIVEGLQ 146 >gi|158312298|ref|YP_001504806.1| glycoside hydrolase family 3 protein [Frankia sp. EAN1pec] gi|158107703|gb|ABW09900.1| glycoside hydrolase family 3 domain protein [Frankia sp. EAN1pec] Length = 789 Score = 38.2 bits (88), Expect = 0.42, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + +G+ SPVLD+ P + F P + R Sbjct: 134 IRRQMRRTGLMHALSPVLDVALDPR--WGRVHETFGEDPYLCAALGVAYVRGLQ 185 >gi|182413194|ref|YP_001818260.1| glycoside hydrolase family 3 protein [Opitutus terrae PB90-1] gi|177840408|gb|ACB74660.1| glycoside hydrolase family 3 domain protein [Opitutus terrae PB90-1] Length = 859 Score = 37.8 bits (87), Expect = 0.43, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 14/53 (26%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G +SPVLDL P + + P R Sbjct: 207 GREARALGYTNIYSPVLDLARDPR--WGRTIETYGEDPFLVGTLGVEQVRGLQ 257 >gi|15232707|ref|NP_190284.1| glycosyl hydrolase family 3 protein [Arabidopsis thaliana] gi|6522581|emb|CAB61946.1| beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana] gi|17065280|gb|AAL32794.1| beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana] gi|20259996|gb|AAM13345.1| beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana] gi|20260350|gb|AAM13073.1| beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana] gi|30725406|gb|AAP37725.1| At3g47000 [Arabidopsis thaliana] gi|332644709|gb|AEE78230.1| beta-glucosidase [Arabidopsis thaliana] Length = 608 Score = 37.8 bits (87), Expect = 0.43, Method: Composition-based stats. Identities = 10/44 (22%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEES 45 A + SG++ FSP + +L P + + P E Sbjct: 137 ALEVRASGVHWAFSPCVAVLRDPR--WGRCYESYGEDPELVCEM 178 >gi|149280000|ref|ZP_01886125.1| putative beta-glucosidase [Pedobacter sp. BAL39] gi|149229197|gb|EDM34591.1| putative beta-glucosidase [Pedobacter sp. BAL39] Length = 793 Score = 37.8 bits (87), Expect = 0.43, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A G ++ + PVLDL P ++ + P + + Sbjct: 178 IAMETRLQGGHIGYGPVLDLAREPR--WSRVEETYGEDPVLNSRMGEAMVSGFQ 229 >gi|323139443|ref|ZP_08074492.1| glycoside hydrolase family 3 domain protein [Methylocystis sp. ATCC 49242] gi|322395314|gb|EFX97866.1| glycoside hydrolase family 3 domain protein [Methylocystis sp. ATCC 49242] Length = 709 Score = 37.8 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+++ F+P+LD+ P + P A + A+ R + Sbjct: 113 AIEAAHEGVSLTFAPMLDVARDPR--WGRIAEGPGEDPLVAVKMAEAKIRGFQ 163 >gi|71282603|ref|YP_270406.1| periplasmic beta-glucosidase [Colwellia psychrerythraea 34H] gi|71148343|gb|AAZ28816.1| periplasmic beta-glucosidase [Colwellia psychrerythraea 34H] Length = 740 Score = 37.8 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A SGIN F+P++D+ P + P + A + + Sbjct: 126 AIESSNSGINWTFAPMIDIARDPR--WGRIAESLGEDPYLCKTLANSMVKGFQ 176 >gi|4062846|dbj|BAA36161.1| beta-glucosidase [Bacillus sp.] Length = 756 Score = 37.8 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 ++ G++ SP +DL P F F P A + A+ + + Sbjct: 210 SREYRALGLSTALSPQVDLATDPRWFRFGM--TFGEDPRLATDMARAYIDGFQ 260 >gi|326798217|ref|YP_004316036.1| beta-N-acetylhexosaminidase [Sphingobacterium sp. 21] gi|326548981|gb|ADZ77366.1| Beta-N-acetylhexosaminidase [Sphingobacterium sp. 21] Length = 569 Score = 37.8 bits (87), Expect = 0.45, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +AKN G+NVNF+P +D+ P + F + + + Sbjct: 151 IAKNFKRIGLNVNFAPDVDVNNNPNNPVIN-YRSFGENKMNVVRKGGAYMKGMMD 204 >gi|168017993|ref|XP_001761531.1| predicted protein [Physcomitrella patens subsp. patens] gi|162687215|gb|EDQ73599.1| predicted protein [Physcomitrella patens subsp. patens] Length = 613 Score = 37.8 bits (87), Expect = 0.45, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 16/53 (30%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI F+P + + P + +S P + Sbjct: 144 ALEVRATGIPYVFAPCIAVCRDPR--WGRCYESYSEDPDVVSSMTSI-IDGLQ 193 >gi|153832154|ref|ZP_01984821.1| 1,4-B-D-glucan glucohydrolase [Vibrio harveyi HY01] gi|148871769|gb|EDL70610.1| 1,4-B-D-glucan glucohydrolase [Vibrio harveyi HY01] Length = 1109 Score = 37.8 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ +V +G++ F+P + + +S P E A+ Sbjct: 179 AREVVATGLDWTFAPTVATPRDYR--WGRVYEGYSEDPEIVYEYAKRMVEGIQ 229 >gi|198275394|ref|ZP_03207925.1| hypothetical protein BACPLE_01556 [Bacteroides plebeius DSM 17135] gi|198271730|gb|EDY96000.1| hypothetical protein BACPLE_01556 [Bacteroides plebeius DSM 17135] Length = 761 Score = 37.8 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ + P A + R Y Sbjct: 145 ATEASADGISWTFSPMVDICRDAR--WGRIAEGSGEDPYLGALMAGAYVRGYQ 195 >gi|317492602|ref|ZP_07951029.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Enterobacteriaceae bacterium 9_2_54FAA] gi|316919352|gb|EFV40684.1| glycosyl hydrolase family 3 N terminal domain-containing protein [Enterobacteriaceae bacterium 9_2_54FAA] Length = 810 Score = 37.8 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F E +L NP Sbjct: 188 AYEASEDGLNMTWAPMVDVTRDPR--WGRTSEGFGEDTYLTSEMGRLMVEAMQGNNP 242 >gi|281412087|ref|YP_003346166.1| glycoside hydrolase family 3 domain protein [Thermotoga naphthophila RKU-10] gi|281373190|gb|ADA66752.1| glycoside hydrolase family 3 domain protein [Thermotoga naphthophila RKU-10] Length = 721 Score = 37.8 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M + + G++V +P +++ P + +S P + E A F + Sbjct: 103 MGEEVREYGVDVLLAPAMNIHRNPLC--GRNFEYYSEDPVLSGEMASAFVKGVQ 154 >gi|242209115|ref|XP_002470406.1| hypothetical protein POSPLDRAFT_46915 [Postia placenta Mad-698-R] gi|220730576|gb|EED84431.1| hypothetical protein POSPLDRAFT_46915 [Postia placenta Mad-698-R] Length = 835 Score = 37.8 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + G + F+PVLDL + + P E + + Sbjct: 209 IGTEAAALGFSQVFAPVLDLSRELR--WGRVEENYGEDPFLTGEMGLAYVSGIQE 261 >gi|242210505|ref|XP_002471095.1| predicted protein [Postia placenta Mad-698-R] gi|220729885|gb|EED83752.1| predicted protein [Postia placenta Mad-698-R] Length = 681 Score = 37.8 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + G + F+PVLDL + + P E + + Sbjct: 113 IGTEAAALGFSQVFAPVLDLSRELR--WGRVEENYGEDPFLTGEMGLAYVSGIQE 165 >gi|170288716|ref|YP_001738954.1| glycoside hydrolase family 3 protein [Thermotoga sp. RQ2] gi|170176219|gb|ACB09271.1| glycoside hydrolase family 3 domain protein [Thermotoga sp. RQ2] Length = 721 Score = 37.8 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M + + G++V +P +++ P + +S P + E A F + Sbjct: 103 MGEEVREYGVDVLLAPAMNIHRNPLC--GRNFEYYSEDPVLSGEMASAFVKGVQ 154 >gi|148270032|ref|YP_001244492.1| glycoside hydrolase family 3 protein [Thermotoga petrophila RKU-1] gi|147735576|gb|ABQ46916.1| beta-glucosidase. Glycosyl Hydrolase family 3 [Thermotoga petrophila RKU-1] Length = 722 Score = 37.8 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M + + G++V +P +++ P + +S P + E A F + Sbjct: 104 MGEEVREYGVDVLLAPAMNIHRNPLC--GRNFEYYSEDPVLSGEMASAFVKGVQ 155 >gi|15642800|ref|NP_227841.1| beta-glucosidase [Thermotoga maritima MSB8] gi|4980509|gb|AAD35119.1|AE001690_13 beta-glucosidase [Thermotoga maritima MSB8] Length = 721 Score = 37.8 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M + + G++V +P +++ P + +S P + E A F + Sbjct: 103 MGEEVREYGVDVLLAPAMNIHRNPLC--GRNFEYYSEDPVLSGEMASAFVKGVQ 154 >gi|300778223|ref|ZP_07088081.1| possible xylan 1,4-beta-xylosidase [Chryseobacterium gleum ATCC 35910] gi|300503733|gb|EFK34873.1| possible xylan 1,4-beta-xylosidase [Chryseobacterium gleum ATCC 35910] Length = 763 Score = 37.8 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ GI+ SP +DL P + +FS P + + + + Sbjct: 222 AQEYRALGISTALSPQIDLGTEPRWYRIAY--VFSESPELTADLGRGYIDGFQ 272 >gi|88803384|ref|ZP_01118910.1| glycosyl hydrolase, family 3 [Polaribacter irgensii 23-P] gi|88780950|gb|EAR12129.1| glycosyl hydrolase, family 3 [Polaribacter irgensii 23-P] Length = 602 Score = 37.8 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +G N FSP + + Y + +S A E A + Sbjct: 153 AIETQATGFNWTFSPCIAIPYNE--KWGRVYEAYSESTALTTEMATASIEGHQ 203 >gi|319900126|ref|YP_004159854.1| glycoside hydrolase family 3 domain protein [Bacteroides helcogenes P 36-108] gi|319415157|gb|ADV42268.1| glycoside hydrolase family 3 domain protein [Bacteroides helcogenes P 36-108] Length = 750 Score = 37.8 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + ++ F+P +++ + + P A R Y Sbjct: 151 AREMRAMNMHWTFNPNVEVARDAR--WGRVGETYGEDPYLAALMGAQSVRGYQ 201 >gi|290770223|gb|ADD61980.1| putative carbohydrate-active enzyme [uncultured organism] Length = 728 Score = 37.8 bits (87), Expect = 0.50, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + GI F+P++D+ P + + + Sbjct: 117 AIEASSVGIRWTFAPMIDIARDPR--WGRMAEGCGEDTYLTTVMGVAMVKGFQ 167 >gi|29829250|ref|NP_823884.1| glycosyl hydrolase [Streptomyces avermitilis MA-4680] gi|29606357|dbj|BAC70419.1| putative glycosyl hydrolase [Streptomyces avermitilis MA-4680] Length = 1011 Score = 37.8 bits (87), Expect = 0.50, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI +F+P L + + F PA + + + Sbjct: 459 AAEVRATGIPWDFAPCLCVTRDER--WGRSYESFGEDPALVKSM-ETVIQGLQ 508 >gi|319901526|ref|YP_004161254.1| glycoside hydrolase family 3 domain protein [Bacteroides helcogenes P 36-108] gi|319416557|gb|ADV43668.1| glycoside hydrolase family 3 domain protein [Bacteroides helcogenes P 36-108] Length = 750 Score = 37.8 bits (87), Expect = 0.51, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + G+ F+P++D+ P + + + + Sbjct: 138 AIEASSVGVRWTFAPMIDISRDPR--WGRIAESCGEDVYLSSVMGSAMVKGFQ 188 >gi|295840563|ref|ZP_06827496.1| thermostable beta-glucosidase B [Streptomyces sp. SPB74] gi|197699725|gb|EDY46658.1| thermostable beta-glucosidase B [Streptomyces sp. SPB74] Length = 705 Score = 37.8 bits (87), Expect = 0.51, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A G++V P +++ P + FS+ P + E R Sbjct: 112 IAAEARDHGVHVVLGPGVNIKRSPLC--GRNFEYFSKDPLVSAELGGAMVRGLQN 164 >gi|15238197|ref|NP_196618.1| glycosyl hydrolase family 3 protein [Arabidopsis thaliana] gi|75264319|sp|Q9LXA8|BXL6_ARATH RecName: Full=Probable beta-D-xylosidase 6; Short=AtBXL6; Flags: Precursor gi|7671447|emb|CAB89387.1| beta-xylosidase-like protein [Arabidopsis thaliana] gi|15982753|gb|AAL09717.1| AT5g10560/F12B17_90 [Arabidopsis thaliana] gi|332004180|gb|AED91563.1| putative beta-D-xylosidase 6 [Arabidopsis thaliana] Length = 792 Score = 37.8 bits (87), Expect = 0.51, Method: Composition-based stats. Identities = 6/42 (14%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Query: 14 FSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++P +++ P + + P E F R + + Sbjct: 153 WAPNINVFRDPR--WGRGQETPGEDPKVVSEYGVEFVRGFQE 192 >gi|26449574|dbj|BAC41913.1| putative beta-xylosidase [Arabidopsis thaliana] Length = 732 Score = 37.8 bits (87), Expect = 0.51, Method: Composition-based stats. Identities = 6/42 (14%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Query: 14 FSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++P +++ P + + P E F R + + Sbjct: 93 WAPNINVFRDPR--WGRGQETPGEDPKVVSEYGVEFVRGFQE 132 >gi|283785078|ref|YP_003364943.1| glycosyl hydrolase, family 3 [Citrobacter rodentium ICC168] gi|282948532|emb|CBG88121.1| putative glycosyl hydrolase, family 3 [Citrobacter rodentium ICC168] Length = 791 Score = 37.8 bits (87), Expect = 0.52, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++G +PVLD+L + F P + Sbjct: 150 IGIEARSAGCRQGLAPVLDVLRDVR--WGRTEETFGEDPWLVGVMGCAYVAGLQ 201 >gi|332308072|ref|YP_004435923.1| glycoside hydrolase family 3 domain protein [Glaciecola agarilytica 4H-3-7+YE-5] gi|332175401|gb|AEE24655.1| glycoside hydrolase family 3 domain protein [Glaciecola agarilytica 4H-3-7+YE-5] Length = 856 Score = 37.8 bits (87), Expect = 0.52, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ ++ +GI+ F+P + + + +S P + + Sbjct: 189 AEEVLATGIDWIFAPTVATVRDDR--WGRTYEGYSEDPEIVRLYSASIVKGLQ 239 >gi|257875166|ref|ZP_05654819.1| glycoside hydrolase [Enterococcus casseliflavus EC20] gi|257809332|gb|EEV38152.1| glycoside hydrolase [Enterococcus casseliflavus EC20] Length = 408 Score = 37.8 bits (87), Expect = 0.52, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 15/52 (28%), Gaps = 2/52 (3%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + L GIN PV D+ P++FI + Sbjct: 196 EILKAYGINAGLFPVADVSTDPQSFI--YDRTIGMDAQGTSAFVERVVHVLQ 245 >gi|302418606|ref|XP_003007134.1| periplasmic beta-glucosidase [Verticillium albo-atrum VaMs.102] gi|261354736|gb|EEY17164.1| periplasmic beta-glucosidase [Verticillium albo-atrum VaMs.102] Length = 781 Score = 37.8 bits (87), Expect = 0.53, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + + G+ SP +DL P + ++ E A + +T + Sbjct: 164 IREENLAIGVQWVLSPEVDLAKDPRN--GRNGEMYGEDGYLVGEFATKYIQTMQE 216 >gi|257438963|ref|ZP_05614718.1| periplasmic beta-glucosidase/beta-xylosidase [Faecalibacterium prausnitzii A2-165] gi|257198548|gb|EEU96832.1| periplasmic beta-glucosidase/beta-xylosidase [Faecalibacterium prausnitzii A2-165] Length = 784 Score = 37.8 bits (87), Expect = 0.53, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K + G+N+ + P +D+ P + + P + A+ + Y Sbjct: 242 KMMKAEGLNIMYGPQVDVTSDPRWP--RTSGTYGERPDVTSDIAEALVKGYQD 292 >gi|284032578|ref|YP_003382509.1| glycoside hydrolase family 3 domain-containing protein [Kribbella flavida DSM 17836] gi|283811871|gb|ADB33710.1| glycoside hydrolase family 3 domain protein [Kribbella flavida DSM 17836] Length = 693 Score = 37.8 bits (87), Expect = 0.54, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 16/53 (30%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK +G NF+P + + + FS P A + Sbjct: 206 AKETRATGPQWNFAPCVCVARDTR--WGRTYESFSEHPGLVTRFASS-IEGFQ 255 >gi|220914262|ref|YP_002489571.1| glycoside hydrolase [Arthrobacter chlorophenolicus A6] gi|219861140|gb|ACL41482.1| glycoside hydrolase family 3 domain protein [Arthrobacter chlorophenolicus A6] Length = 727 Score = 37.8 bits (87), Expect = 0.55, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + G+N FSP++D+ P + F R Y Sbjct: 112 AQEAASGGVNWTFSPMIDVSRDPR--WGRVVEGFGEDAYVNSVFGAAKVRGYQ 162 >gi|217964124|ref|YP_002349802.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Listeria monocytogenes HCC23] gi|217333394|gb|ACK39188.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Listeria monocytogenes HCC23] gi|307571309|emb|CAR84488.1| beta-glucosidase [Listeria monocytogenes L99] Length = 723 Score = 37.8 bits (87), Expect = 0.55, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESIGEDPFLNSELGKAMVDGYQ 173 >gi|116874143|ref|YP_850924.1| beta-glucosidase [Listeria welshimeri serovar 6b str. SLCC5334] gi|116743021|emb|CAK22145.1| beta-glucosidase [Listeria welshimeri serovar 6b str. SLCC5334] Length = 756 Score = 37.8 bits (87), Expect = 0.55, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G+++ + LD+L P + + P A E + + Sbjct: 151 IAEEISEKGVHLALASALDILRDPR--WGRAEECYGEDPYLASELTAAITDGFQ 202 >gi|103486996|ref|YP_616557.1| Beta-glucosidase [Sphingopyxis alaskensis RB2256] gi|98977073|gb|ABF53224.1| Beta-glucosidase [Sphingopyxis alaskensis RB2256] Length = 826 Score = 37.8 bits (87), Expect = 0.55, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + SGI F+P L + + ++ P + A+ + Sbjct: 175 AAEIAASGIEWTFAPTLAVPRDLR--WGRSYEGYAADPQLVAQYAKAMTLGLQ 225 >gi|330829188|ref|YP_004392140.1| beta-glucosidase [Aeromonas veronii B565] gi|328804324|gb|AEB49523.1| Beta-glucosidase [Aeromonas veronii B565] Length = 793 Score = 37.5 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 8/56 (14%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 M + GI++ +P +++ P + +S P + N Sbjct: 149 MGDEVRQYGIDILLAPGMNIQRNPLN--GRNFEYYSEDPLLTGKIGAAMVNGVESN 202 >gi|224537620|ref|ZP_03678159.1| hypothetical protein BACCELL_02502 [Bacteroides cellulosilyticus DSM 14838] gi|224520762|gb|EEF89867.1| hypothetical protein BACCELL_02502 [Bacteroides cellulosilyticus DSM 14838] Length = 766 Score = 37.5 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI FSP++D+ P + P E A+ R Y Sbjct: 147 AIEASADGICWTFSPMVDVSRDPR--WGRVSEGNGEDPFLGAEIARAMVRGYQ 197 >gi|189465287|ref|ZP_03014072.1| hypothetical protein BACINT_01635 [Bacteroides intestinalis DSM 17393] gi|189437561|gb|EDV06546.1| hypothetical protein BACINT_01635 [Bacteroides intestinalis DSM 17393] Length = 766 Score = 37.5 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI FSP++D+ P + P E A+ R Y Sbjct: 147 AIEASADGICWTFSPMVDVSRDPR--WGRVSEGNGEDPFLGAEIARAMVRGYQ 197 >gi|160890630|ref|ZP_02071633.1| hypothetical protein BACUNI_03075 [Bacteroides uniformis ATCC 8492] gi|317479833|ref|ZP_07938953.1| glycosyl hydrolase family 3 C terminal domain-containing protein [Bacteroides sp. 4_1_36] gi|156859629|gb|EDO53060.1| hypothetical protein BACUNI_03075 [Bacteroides uniformis ATCC 8492] gi|316904039|gb|EFV25873.1| glycosyl hydrolase family 3 C terminal domain-containing protein [Bacteroides sp. 4_1_36] Length = 860 Score = 37.5 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 ++K L GI +P +D++ + + P A ++ Y+ N Sbjct: 158 ISKELHYQGIRQILAPCIDVVRDLR--WGRVEESYGEDPFLNGIFAYEEAKGYLDN 211 >gi|119476079|ref|ZP_01616431.1| Beta-glucosidase-related Glycosidase [marine gamma proteobacterium HTCC2143] gi|119450706|gb|EAW31940.1| Beta-glucosidase-related Glycosidase [marine gamma proteobacterium HTCC2143] Length = 861 Score = 37.5 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI+ F+P + + + +S P + A + Sbjct: 194 AIEVAVTGIDWIFAPTVATVRN--DLWGRTYEGYSEDPDIVKAYAGMIVTGMQ 244 >gi|146299327|ref|YP_001193918.1| glycoside hydrolase family 3 protein [Flavobacterium johnsoniae UW101] gi|146153745|gb|ABQ04599.1| Candidate beta-glucosidase; Glycoside hydrolase family 3 [Flavobacterium johnsoniae UW101] Length = 743 Score = 37.5 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A SGI+ F+P++D+ P + + A + + N Sbjct: 136 ATEASASGIHWTFAPMVDISRDPR--WGRVMEGAGEDTYLGSKIAYARVKGFQGN 188 >gi|154250273|ref|YP_001411098.1| glycoside hydrolase family 3 protein [Fervidobacterium nodosum Rt17-B1] gi|154154209|gb|ABS61441.1| glycoside hydrolase family 3 domain protein [Fervidobacterium nodosum Rt17-B1] Length = 714 Score = 37.5 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M + + G++V +P +++ P + +S P E A F Sbjct: 105 MGEEVREYGVDVLLAPAINIHRNPLC--GRNFEYYSEDPLLTGELAASFVEGVQ 156 >gi|294508875|ref|YP_003572934.1| Periplasmic beta-glucosidase [Precursor] [Salinibacter ruber M8] gi|294345204|emb|CBH25982.1| Periplasmic beta-glucosidase [Precursor] [Salinibacter ruber M8] Length = 866 Score = 37.5 bits (86), Expect = 0.59, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+++ SGI NF+PVLD+ P + FS R Y Sbjct: 244 ARDVRASGIPWNFAPVLDMGREPRWP--RLYETFSEDAHLTNVMGLGMLRGYQ 294 >gi|301116996|ref|XP_002906226.1| glycoside hydrolase, putative [Phytophthora infestans T30-4] gi|262107575|gb|EEY65627.1| glycoside hydrolase, putative [Phytophthora infestans T30-4] Length = 790 Score = 37.5 bits (86), Expect = 0.59, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A++ +GI F P+L++ P ++ F P A R Sbjct: 173 ARDTQAAGIPWIFGPILEISQNPL--WSRTYETFGEDPYLASVMGDAIVRGLQ 223 >gi|258510013|ref|YP_003175676.1| beta-N-acetylhexosaminidase [Lactobacillus rhamnosus Lc 705] gi|257152854|emb|CAR91825.1| Beta-N-acetylhexosaminidase (GH3) [Lactobacillus rhamnosus Lc 705] Length = 641 Score = 37.5 bits (86), Expect = 0.59, Method: Composition-based stats. Identities = 11/49 (22%), Positives = 15/49 (30%), Gaps = 2/49 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 L GIN N++PV D +FI F + Sbjct: 169 GTILKNLGINWNYAPVADSTPDTSSFIYG--RTFGQDYLATANYITNVI 215 >gi|83814445|ref|YP_446935.1| xylosidase [Salinibacter ruber DSM 13855] gi|83755839|gb|ABC43952.1| xylosidase [Salinibacter ruber DSM 13855] Length = 866 Score = 37.5 bits (86), Expect = 0.59, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+++ SGI NF+PVLD+ P + FS R Y Sbjct: 244 ARDVRASGIPWNFAPVLDMGREPRWP--RLYETFSEDAHLTNVMGLGMLRGYQ 294 >gi|327405124|ref|YP_004345962.1| glycoside hydrolase family 3 domain-containing protein [Fluviicola taffensis DSM 16823] gi|327320632|gb|AEA45124.1| glycoside hydrolase family 3 domain protein [Fluviicola taffensis DSM 16823] Length = 386 Score = 37.5 bits (86), Expect = 0.59, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A L GIN NF+PV+DL F+++ A + F + Sbjct: 174 IAATLKAIGINYNFAPVVDLAKNGT----VGYRGFAKVEANNVPWSNAFIARMQE 224 >gi|297202580|ref|ZP_06919977.1| glycosyl hydrolase [Streptomyces sviceus ATCC 29083] gi|297148143|gb|EFH28854.1| glycosyl hydrolase [Streptomyces sviceus ATCC 29083] Length = 943 Score = 37.5 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI +F+P L + + F PA E + + Sbjct: 459 AAEVRATGIPWDFAPCLCVTRDER--WGRSYESFGEDPALVESM-ETVIQGLQ 508 >gi|260911906|ref|ZP_05918472.1| beta-glucosidase [Prevotella sp. oral taxon 472 str. F0295] gi|260634022|gb|EEX52146.1| beta-glucosidase [Prevotella sp. oral taxon 472 str. F0295] Length = 756 Score = 37.5 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK + GIN +SP++D+ P + P A R N Sbjct: 141 AKEATSQGINWAYSPMVDIALDPR--WGRIAEGNGEDPYLNGCIAAAMVRGLQGN 193 >gi|226323374|ref|ZP_03798892.1| hypothetical protein COPCOM_01148 [Coprococcus comes ATCC 27758] gi|225208058|gb|EEG90412.1| hypothetical protein COPCOM_01148 [Coprococcus comes ATCC 27758] Length = 800 Score = 37.5 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K + G SPV+D+ P + + A A F + Sbjct: 128 IRKQMYYVGFRQALSPVVDITRDPR--WGRITETYGEDAALTSAMASAFVKGIQ 179 >gi|217077987|ref|YP_002335705.1| beta-glucosidase [Thermosipho africanus TCF52B] gi|217037842|gb|ACJ76364.1| beta-glucosidase [Thermosipho africanus TCF52B] Length = 719 Score = 37.5 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M G++ +P +++ P + +S P E A F Sbjct: 102 MGNEAKEYGVDFLLAPAINIHRNPLC--GRNFEYYSEDPILTGELASAFVEGVQ 153 >gi|154248985|ref|YP_001409810.1| glycoside hydrolase family 3 protein [Fervidobacterium nodosum Rt17-B1] gi|154152921|gb|ABS60153.1| glycoside hydrolase family 3 domain protein [Fervidobacterium nodosum Rt17-B1] Length = 717 Score = 37.5 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M + + G+++ +P +++ P + +S P E A F Sbjct: 106 MGEEVREYGVDILLAPAINIHRNPLG--GRNFEYYSEDPLLTGEMAASFVEGVQ 157 >gi|239629267|ref|ZP_04672298.1| beta-N-acetylhexosaminidase [Lactobacillus paracasei subsp. paracasei 8700:2] gi|258507429|ref|YP_003170180.1| beta-N-acetylhexosaminidase (GH3) [Lactobacillus rhamnosus GG] gi|239528472|gb|EEQ67473.1| beta-N-acetylhexosaminidase [Lactobacillus paracasei subsp. paracasei 8700:2] gi|257147356|emb|CAR86329.1| Beta-N-acetylhexosaminidase (GH3) [Lactobacillus rhamnosus GG] gi|259648784|dbj|BAI40946.1| beta-N-acetylglucosaminidase [Lactobacillus rhamnosus GG] Length = 604 Score = 37.5 bits (86), Expect = 0.62, Method: Composition-based stats. Identities = 11/49 (22%), Positives = 15/49 (30%), Gaps = 2/49 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 L GIN N++PV D +FI F + Sbjct: 132 GTILKNLGINWNYAPVADSTPDTSSFIYG--RTFGQDYLATANYITNVI 178 >gi|53711621|ref|YP_097613.1| beta-glucosidase [Bacteroides fragilis YCH46] gi|52214486|dbj|BAD47079.1| beta-glucosidase [Bacteroides fragilis YCH46] Length = 832 Score = 37.5 bits (86), Expect = 0.62, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K+ G++V P +++ P + P A + + Sbjct: 116 LGKDCRARGVHVVLGPAVNIYRAPMC--GRNFEYMGEDPYLTSRMATGYIKGVQ 167 >gi|328466483|gb|EGF37626.1| beta-glucosidase [Listeria monocytogenes 1816] Length = 723 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVDGYQ 173 >gi|313623395|gb|EFR93614.1| periplasmic beta-glucosidase [Listeria innocua FSL J1-023] Length = 723 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVDGYQ 173 >gi|313608307|gb|EFR84294.1| beta-glucosidase [Listeria monocytogenes FSL F2-208] Length = 723 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVDGYQ 173 >gi|284802173|ref|YP_003414038.1| hypothetical protein LM5578_1929 [Listeria monocytogenes 08-5578] gi|284995315|ref|YP_003417083.1| hypothetical protein LM5923_1880 [Listeria monocytogenes 08-5923] gi|284057735|gb|ADB68676.1| hypothetical protein LM5578_1929 [Listeria monocytogenes 08-5578] gi|284060782|gb|ADB71721.1| hypothetical protein LM5923_1880 [Listeria monocytogenes 08-5923] Length = 723 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVDGYQ 173 >gi|255522080|ref|ZP_05389317.1| beta-glucosidase [Listeria monocytogenes FSL J1-175] Length = 613 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVDGYQ 173 >gi|255026158|ref|ZP_05298144.1| hypothetical protein LmonocytFSL_07040 [Listeria monocytogenes FSL J2-003] Length = 723 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVDGYQ 173 >gi|254993217|ref|ZP_05275407.1| beta-glucosidase [Listeria monocytogenes FSL J2-064] Length = 321 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVDGYQ 173 >gi|254932826|ref|ZP_05266185.1| beta-glucosidase [Listeria monocytogenes HPB2262] gi|293584379|gb|EFF96411.1| beta-glucosidase [Listeria monocytogenes HPB2262] gi|332312170|gb|EGJ25265.1| Periplasmic beta-glucosidase [Listeria monocytogenes str. Scott A] Length = 723 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVDGYQ 173 >gi|290893386|ref|ZP_06556371.1| beta-glucosidase [Listeria monocytogenes FSL J2-071] gi|290557037|gb|EFD90566.1| beta-glucosidase [Listeria monocytogenes FSL J2-071] Length = 677 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 77 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVDGYQ 127 >gi|226224332|ref|YP_002758439.1| beta-glucosidase [Listeria monocytogenes Clip81459] gi|254826027|ref|ZP_05231028.1| beta-glucosidase [Listeria monocytogenes FSL J1-194] gi|225876794|emb|CAS05503.1| Putative beta-glucosidase [Listeria monocytogenes serotype 4b str. CLIP 80459] gi|293595266|gb|EFG03027.1| beta-glucosidase [Listeria monocytogenes FSL J1-194] Length = 723 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVDGYQ 173 >gi|161502686|ref|YP_001569798.1| hypothetical protein SARI_00733 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980] gi|160864033|gb|ABX20656.1| hypothetical protein SARI_00733 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] Length = 771 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + + KNP Sbjct: 149 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSIMGETMVKAMQGKNP 203 >gi|254829251|ref|ZP_05233938.1| beta-glucosidase [Listeria monocytogenes FSL N3-165] gi|258601663|gb|EEW14988.1| beta-glucosidase [Listeria monocytogenes FSL N3-165] Length = 723 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVDGYQ 173 >gi|116873162|ref|YP_849943.1| glycoside hydrolase family protein [Listeria welshimeri serovar 6b str. SLCC5334] gi|116742040|emb|CAK21164.1| glycoside hydrolase, family 3 [Listeria welshimeri serovar 6b str. SLCC5334] Length = 723 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVDGYQ 173 >gi|46907959|ref|YP_014348.1| beta-glucosidase [Listeria monocytogenes serotype 4b str. F2365] gi|254853640|ref|ZP_05242988.1| beta-glucosidase [Listeria monocytogenes FSL R2-503] gi|300764657|ref|ZP_07074648.1| beta-glucosidase [Listeria monocytogenes FSL N1-017] gi|46881229|gb|AAT04525.1| beta-glucosidase [Listeria monocytogenes serotype 4b str. F2365] gi|258607018|gb|EEW19626.1| beta-glucosidase [Listeria monocytogenes FSL R2-503] gi|300514543|gb|EFK41599.1| beta-glucosidase [Listeria monocytogenes FSL N1-017] Length = 723 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVDGYQ 173 >gi|16803769|ref|NP_465254.1| hypothetical protein lmo1729 [Listeria monocytogenes EGD-e] gi|224503346|ref|ZP_03671653.1| hypothetical protein LmonFR_12670 [Listeria monocytogenes FSL R2-561] gi|16411183|emb|CAC99807.1| lmo1729 [Listeria monocytogenes EGD-e] Length = 723 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVDGYQ 173 >gi|16800907|ref|NP_471175.1| hypothetical protein lin1840 [Listeria innocua Clip11262] gi|16414342|emb|CAC97071.1| lin1840 [Listeria innocua Clip11262] Length = 723 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVDGYQ 173 >gi|47092883|ref|ZP_00230665.1| beta-glucosidase [Listeria monocytogenes str. 4b H7858] gi|47018709|gb|EAL09460.1| beta-glucosidase [Listeria monocytogenes str. 4b H7858] Length = 440 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVDGYQ 173 >gi|192361998|ref|YP_001980747.1| glucan 1,4-beta-glucosidase cel3C [Cellvibrio japonicus Ueda107] gi|190688163|gb|ACE85841.1| glucan 1,4-beta-glucosidase, putative, cel3C [Cellvibrio japonicus Ueda107] Length = 848 Score = 37.5 bits (86), Expect = 0.64, Method: Composition-based stats. Identities = 6/46 (13%), Positives = 14/46 (30%), Gaps = 2/46 (4%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 GI+ F+P L + + ++ P + + Sbjct: 191 GIDWTFAPTLAVARDDR--WGRTYESYAEDPEIVKAYGGMMVEGLQ 234 >gi|1483615|emb|CAB01407.1| beta-glucosidase [Thermotoga neapolitana] Length = 720 Score = 37.5 bits (86), Expect = 0.64, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M + + G++V P +++ P + +S P + E A F + Sbjct: 102 MGEEVREYGVDVLLGPAMNIHRNPLC--GRNFEYYSEDPVLSGEMASSFVKGVQ 153 >gi|294675324|ref|YP_003575940.1| glucan 1,4-beta-glucosidase [Prevotella ruminicola 23] gi|294473408|gb|ADE82797.1| glucan 1,4-beta-glucosidase [Prevotella ruminicola 23] Length = 787 Score = 37.5 bits (86), Expect = 0.64, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + + G +V +P L+++ P + +S P A ++A + KN Sbjct: 136 IGEEVKEYGADVLLAPALNIMRNPLC--GRNFEYYSEDPVVAGKTAAAYITGVQKN 189 >gi|90019894|ref|YP_525721.1| exo-1,4-beta-glucosidase [Saccharophagus degradans 2-40] gi|89949494|gb|ABD79509.1| exo-1,4-beta-glucosidase [Saccharophagus degradans 2-40] Length = 862 Score = 37.5 bits (86), Expect = 0.64, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK + +GI+ F+P + ++ + +S PA +E A+ Sbjct: 191 AKVVQVTGIDWVFAPTVAVVRDDR--WGRTYEGYSEDPAIVKEYARAMVIGMQ 241 >gi|237720288|ref|ZP_04550769.1| periplasmic beta-glucosidase [Bacteroides sp. 2_2_4] gi|229450039|gb|EEO55830.1| periplasmic beta-glucosidase [Bacteroides sp. 2_2_4] Length = 769 Score = 37.5 bits (86), Expect = 0.65, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A GI+ FSP++D+ P + P A+ R Y KN Sbjct: 142 AVEASADGISWTFSPMVDISRDPR--WGRVSEGSGEDPFLGAMIAEAMVRGYQGKN 195 >gi|293370563|ref|ZP_06617115.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides ovatus SD CMC 3f] gi|292634297|gb|EFF52834.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides ovatus SD CMC 3f] Length = 769 Score = 37.5 bits (86), Expect = 0.66, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A GI+ FSP++D+ P + P A+ R Y KN Sbjct: 142 AVEASADGISWTFSPMVDISRDPR--WGRVSEGSGEDPFLGAMIAEAMVRGYQGKN 195 >gi|237716559|ref|ZP_04547040.1| periplasmic beta-glucosidase [Bacteroides sp. D1] gi|294810357|ref|ZP_06769018.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides xylanisolvens SD CC 1b] gi|229442542|gb|EEO48333.1| periplasmic beta-glucosidase [Bacteroides sp. D1] gi|294442465|gb|EFG11271.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides xylanisolvens SD CC 1b] Length = 769 Score = 37.5 bits (86), Expect = 0.66, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A GI+ FSP++D+ P + P A+ R Y KN Sbjct: 142 AVEASADGISWTFSPMVDISRDPR--WGRVSEGSGEDPFLGAMIAEAMVRGYQGKN 195 >gi|224540191|ref|ZP_03680730.1| hypothetical protein BACCELL_05104 [Bacteroides cellulosilyticus DSM 14838] gi|224518194|gb|EEF87299.1| hypothetical protein BACCELL_05104 [Bacteroides cellulosilyticus DSM 14838] Length = 737 Score = 37.5 bits (86), Expect = 0.67, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ F+P++D+ + P + A+ + Sbjct: 141 AAETSAHGIHWTFAPMVDISRDAR--WGRSMEGAGEDPWYGSQVAKARVEGFQ 191 >gi|291539346|emb|CBL12457.1| Beta-glucosidase-related glycosidases [Roseburia intestinalis XB6B4] Length = 737 Score = 37.5 bits (86), Expect = 0.68, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK SG++V F+P+ DL+ + P R + N Sbjct: 119 AKEASVSGLHVTFAPMTDLVRDAR--WGRVMESTGEDPYLNSLFCAAMVRGFQGN 171 >gi|291534799|emb|CBL07911.1| Beta-glucosidase-related glycosidases [Roseburia intestinalis M50/1] Length = 737 Score = 37.5 bits (86), Expect = 0.68, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK SG++V F+P+ DL+ + P R + N Sbjct: 119 AKEASVSGLHVTFAPMTDLVRDAR--WGRVMESTGEDPYLNSLFCAAMVRGFQGN 171 >gi|240145435|ref|ZP_04744036.1| beta-glucosidase [Roseburia intestinalis L1-82] gi|257202564|gb|EEV00849.1| beta-glucosidase [Roseburia intestinalis L1-82] Length = 737 Score = 37.5 bits (86), Expect = 0.68, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK SG++V F+P+ DL+ + P R + N Sbjct: 119 AKEASVSGLHVTFAPMTDLVRDAR--WGRVMESTGEDPYLNSLFCAAMVRGFQGN 171 >gi|225377742|ref|ZP_03754963.1| hypothetical protein ROSEINA2194_03393 [Roseburia inulinivorans DSM 16841] gi|225210419|gb|EEG92773.1| hypothetical protein ROSEINA2194_03393 [Roseburia inulinivorans DSM 16841] Length = 737 Score = 37.5 bits (86), Expect = 0.68, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK SG++V F+P+ DL+ + P R + N Sbjct: 119 AKEASVSGLHVTFAPMTDLVRDAR--WGRVMESTGEDPYLNSLFCAAMVRGFQGN 171 >gi|322512686|gb|ADX05749.1| putative carbohydrate-active enzyme [uncultured organism] Length = 775 Score = 37.5 bits (86), Expect = 0.69, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + ++ G++V +P +++ P + FS P + + A + R N Sbjct: 128 LGNEVLEYGVDVLLAPGMNIHRNPLN--GRNFEYFSEDPLLSGKMAAAYVRGIQAN 181 >gi|298250389|ref|ZP_06974193.1| glycoside hydrolase family 3 domain protein [Ktedonobacter racemifer DSM 44963] gi|297548393|gb|EFH82260.1| glycoside hydrolase family 3 domain protein [Ktedonobacter racemifer DSM 44963] Length = 825 Score = 37.5 bits (86), Expect = 0.69, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 20/55 (36%), Gaps = 4/55 (7%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKR-SIFSRIPAKAEESAQLFSRTYI 54 +A+ + G V +P +++ T I + FS P A + R Sbjct: 85 LAQETKSKGARVLLAPTVNIHR---TPIGGRNFESFSEDPYLTARMAVAYIRGIQ 136 >gi|189466455|ref|ZP_03015240.1| hypothetical protein BACINT_02830 [Bacteroides intestinalis DSM 17393] gi|189434719|gb|EDV03704.1| hypothetical protein BACINT_02830 [Bacteroides intestinalis DSM 17393] Length = 737 Score = 37.5 bits (86), Expect = 0.69, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ F+P++D+ + P + A+ + Sbjct: 141 AAETSAHGIHWTFAPMVDISRDAR--WGRSMEGAGEDPWYGSQVAKARVEGFQ 191 >gi|298481608|ref|ZP_06999799.1| beta-glucosidase [Bacteroides sp. D22] gi|298272149|gb|EFI13719.1| beta-glucosidase [Bacteroides sp. D22] Length = 805 Score = 37.5 bits (86), Expect = 0.70, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A GI+ FSP++D+ P + P A+ R Y KN Sbjct: 178 AVEASADGISWTFSPMVDISRDPR--WGRVSEGSGEDPFLGAMIAEAMVRGYQGKN 231 >gi|325970618|ref|YP_004246809.1| beta-glucosidase [Spirochaeta sp. Buddy] gi|324025856|gb|ADY12615.1| Beta-glucosidase [Spirochaeta sp. Buddy] Length = 711 Score = 37.5 bits (86), Expect = 0.71, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 M G+ V P +++ P + F P A E A + + P Sbjct: 123 MGYECRALGVGVLLGPGVNIARVPVN--GRNFEYFGEDPYLASEMAVHYIAGVKQYP 177 >gi|310826625|ref|YP_003958982.1| glycoside hydrolase family 3 domain protein [Eubacterium limosum KIST612] gi|308738359|gb|ADO36019.1| glycoside hydrolase family 3 domain protein [Eubacterium limosum KIST612] Length = 873 Score = 37.5 bits (86), Expect = 0.71, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ T+G+++ P L++ P + +S P + A+ F K Sbjct: 94 IAREARTAGVDLILGPGLNIKRSPLC--GRNFEYYSEDPYLSGHLAKAFVEGARK 146 >gi|262405336|ref|ZP_06081886.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] gi|262356211|gb|EEZ05301.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] Length = 805 Score = 37.5 bits (86), Expect = 0.71, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A GI+ FSP++D+ P + P A+ R Y KN Sbjct: 178 AVEASADGISWTFSPMVDISRDPR--WGRVSEGSGEDPFLGAMIAEAMVRGYQGKN 231 >gi|253574420|ref|ZP_04851761.1| glycoside hydrolase [Paenibacillus sp. oral taxon 786 str. D14] gi|251846125|gb|EES74132.1| glycoside hydrolase [Paenibacillus sp. oral taxon 786 str. D14] Length = 782 Score = 37.5 bits (86), Expect = 0.71, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ G V +SPVLD++ P + F E A Sbjct: 166 ARETRAQGGAVTYSPVLDVVRDPR--WGRTEECFGEDAYLISEMAVASVEGLQ 216 >gi|295086360|emb|CBK67883.1| Beta-glucosidase-related glycosidases [Bacteroides xylanisolvens XB1A] Length = 741 Score = 37.5 bits (86), Expect = 0.71, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A GI+ FSP++D+ P + P A+ R Y KN Sbjct: 114 AVEASADGISWTFSPMVDISRDPR--WGRVSEGSGEDPFLGAMIAEAMVRGYQGKN 167 >gi|94495010|ref|ZP_01301591.1| family 3 glycoside hydrolase [Sphingomonas sp. SKA58] gi|94425276|gb|EAT10296.1| family 3 glycoside hydrolase [Sphingomonas sp. SKA58] Length = 872 Score = 37.5 bits (86), Expect = 0.72, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Query: 5 LVTSGINVN-FSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 L G ++ +SP +++ P + + + P F + NP Sbjct: 124 LGRIGTGLDTWSPNINIFRDPR--WGRGQETYGEDPYLTARMGVAFIQGMQGDNP 176 >gi|89072861|ref|ZP_01159418.1| 1,4-beta-D-glucan glucohydrolase D [Photobacterium sp. SKA34] gi|89051383|gb|EAR56838.1| 1,4-beta-D-glucan glucohydrolase D [Photobacterium sp. SKA34] Length = 920 Score = 37.5 bits (86), Expect = 0.72, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + +G++ F+P + + +S P + A + Sbjct: 181 AEEITATGLDWTFAPTVTTPRDYR--WGRVYEGYSEDPEIVWKYAGKMVKGLQ 231 >gi|254295420|ref|YP_003061443.1| glycoside hydrolase [Hirschia baltica ATCC 49814] gi|254043951|gb|ACT60746.1| glycoside hydrolase family 3 domain protein [Hirschia baltica ATCC 49814] Length = 788 Score = 37.1 bits (85), Expect = 0.74, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ SG++ F+P++D+ P + P A + + N Sbjct: 168 AEESTASGLHWTFAPMVDIARDPR--WGRIVEGAGADPYLGSVMAVAQVKGFQGN 220 >gi|271964149|ref|YP_003338345.1| hypothetical protein Sros_2633 [Streptosporangium roseum DSM 43021] gi|270507324|gb|ACZ85602.1| conserved hypothetical protein [Streptosporangium roseum DSM 43021] Length = 805 Score = 37.1 bits (85), Expect = 0.74, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ G++V +P L+L P + FS P E + + Sbjct: 83 LAQEARRKGVHVLLAPTLNLHRSPLG--GRHFECFSEDPYLTGELGAAYVEGVQE 135 >gi|257052446|ref|YP_003130279.1| Beta-glucosidase [Halorhabdus utahensis DSM 12940] gi|256691209|gb|ACV11546.1| Beta-glucosidase [Halorhabdus utahensis DSM 12940] Length = 737 Score = 37.1 bits (85), Expect = 0.74, Method: Composition-based stats. Identities = 10/47 (21%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 A+ + +G + N+SP D+ P + + P A + A Sbjct: 143 AREVRATGAHQNYSPTCDVAREPR--WGRVQETHGESPRLAADFAAA 187 >gi|299146513|ref|ZP_07039581.1| beta-glucosidase [Bacteroides sp. 3_1_23] gi|298517004|gb|EFI40885.1| beta-glucosidase [Bacteroides sp. 3_1_23] Length = 736 Score = 37.1 bits (85), Expect = 0.74, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +AK + + G ++++ PVLDL P ++ F P + Sbjct: 128 IAKEIRSQGGHISYGPVLDLTRDPR--WSRVEETFGEDPVLSGILGASMVDGL 178 >gi|160887545|ref|ZP_02068548.1| hypothetical protein BACOVA_05565 [Bacteroides ovatus ATCC 8483] gi|156107956|gb|EDO09701.1| hypothetical protein BACOVA_05565 [Bacteroides ovatus ATCC 8483] Length = 736 Score = 37.1 bits (85), Expect = 0.74, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +AK + + G ++++ PVLDL P ++ F P + Sbjct: 128 IAKEIRSQGGHISYGPVLDLTRDPR--WSRVEETFGEDPVLSGILGASMVDGL 178 >gi|160885381|ref|ZP_02066384.1| hypothetical protein BACOVA_03380 [Bacteroides ovatus ATCC 8483] gi|156109003|gb|EDO10748.1| hypothetical protein BACOVA_03380 [Bacteroides ovatus ATCC 8483] Length = 779 Score = 37.1 bits (85), Expect = 0.75, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A GI+ FSP++D+ P + P A+ R Y KN Sbjct: 152 AVEASADGISWTFSPMVDISRDPR--WGRVSEGSGEDPFLGAMIAEAMVRGYQGKN 205 >gi|294644615|ref|ZP_06722368.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides ovatus SD CC 2a] gi|292640052|gb|EFF58317.1| glycosyl hydrolase family 3 N-terminal domain protein [Bacteroides ovatus SD CC 2a] Length = 779 Score = 37.1 bits (85), Expect = 0.76, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A GI+ FSP++D+ P + P A+ R Y KN Sbjct: 152 AVEASADGISWTFSPMVDISRDPR--WGRVSEGSGEDPFLGAMIAEAMVRGYQGKN 205 >gi|260172896|ref|ZP_05759308.1| glycoside hydrolase family beta-glycosidase [Bacteroides sp. D2] gi|315921179|ref|ZP_07917419.1| conserved hypothetical protein [Bacteroides sp. D2] gi|313695054|gb|EFS31889.1| conserved hypothetical protein [Bacteroides sp. D2] Length = 800 Score = 37.1 bits (85), Expect = 0.77, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G ++P+LD+ P + + P E + Sbjct: 197 ADEAKALGYTNIYAPILDIAQDPR--WGRVVESYGEDPYLVGELGKQMILGLQ 247 >gi|255693561|ref|ZP_05417236.1| periplasmic beta-glucosidase(Cellobiase) [Bacteroides finegoldii DSM 17565] gi|260620626|gb|EEX43497.1| periplasmic beta-glucosidase(Cellobiase) [Bacteroides finegoldii DSM 17565] Length = 800 Score = 37.1 bits (85), Expect = 0.77, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G ++P+LD+ P + + P E + Sbjct: 197 ADEAKALGYTNIYAPILDIAQDPR--WGRVVESYGEDPYLVGELGKQMILGLQ 247 >gi|299136858|ref|ZP_07030041.1| glycoside hydrolase family 3 domain protein [Acidobacterium sp. MP5ACTX8] gi|298601373|gb|EFI57528.1| glycoside hydrolase family 3 domain protein [Acidobacterium sp. MP5ACTX8] Length = 835 Score = 37.1 bits (85), Expect = 0.79, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A++ G+ + +P +++ P + F P A F + Sbjct: 114 LARDAKARGVGILLAPGVNIYRSPLN--GRNFEYFGEDPYLTSRIAVGFIQGLQ 165 >gi|253564260|ref|ZP_04841717.1| periplasmic beta-glucosidase [Bacteroides sp. 3_2_5] gi|265765067|ref|ZP_06093342.1| periplasmic beta-glucosidase [Bacteroides sp. 2_1_16] gi|251948036|gb|EES88318.1| periplasmic beta-glucosidase [Bacteroides sp. 3_2_5] gi|263254451|gb|EEZ25885.1| periplasmic beta-glucosidase [Bacteroides sp. 2_1_16] gi|301161453|emb|CBW20993.1| putative exported beta-glucosidase [Bacteroides fragilis 638R] Length = 766 Score = 37.1 bits (85), Expect = 0.79, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P A+ R Y Sbjct: 141 AVEASADGISWTFSPMVDISRDPR--WGRVSEGSGEDPFLGALIARAMVRGYQ 191 >gi|320582252|gb|EFW96470.1| beta-glucosidase [Pichia angusta DL-1] Length = 920 Score = 37.1 bits (85), Expect = 0.80, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K G++V P ++ P + FS P + + + + + K Sbjct: 175 KEARAKGVHVILGPTANIQRVPLG--GRGFESFSEDPYLSGILSAAYIKGFQK 225 >gi|302382873|ref|YP_003818696.1| glycoside hydrolase [Brevundimonas subvibrioides ATCC 15264] gi|302193501|gb|ADL01073.1| glycoside hydrolase family 3 domain protein [Brevundimonas subvibrioides ATCC 15264] Length = 827 Score = 37.1 bits (85), Expect = 0.80, Method: Composition-based stats. Identities = 6/46 (13%), Positives = 13/46 (28%), Gaps = 2/46 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQ 47 A + +G + F P + + + + P A Sbjct: 182 ALEVAATGADWTFGPTVAVPRDDR--WGRTYEGYGEDPEIVAAYAG 225 >gi|190894034|ref|YP_001984328.1| beta-glucosidase protein [Rhizobium etli CIAT 652] gi|190699695|gb|ACE93778.1| beta-glucosidase protein [Rhizobium etli CIAT 652] Length = 814 Score = 37.1 bits (85), Expect = 0.80, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ G +V+ +P +++ + FS P E A + Sbjct: 85 LGDEVLSKGAHVSLAPTVNIQRSVTN--GRNFECFSEDPILTAELAVGYIEGLQ 136 >gi|254832432|ref|ZP_05237087.1| hypothetical protein Lmon1_13839 [Listeria monocytogenes 10403S] Length = 723 Score = 37.1 bits (85), Expect = 0.80, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKALVDGYQ 173 >gi|21492919|ref|NP_659994.1| beta-glucosidase protein [Rhizobium etli CFN 42] gi|21467344|gb|AAM55007.1| beta-glucosidase protein [Rhizobium etli CFN 42] gi|327191684|gb|EGE58691.1| beta-glucosidase protein [Rhizobium etli CNPAF512] Length = 814 Score = 37.1 bits (85), Expect = 0.80, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ G +V+ +P +++ + FS P E A + Sbjct: 85 LGDEVLSKGAHVSLAPTVNIQRSVTN--GRNFECFSEDPILTAELAVGYIEGLQ 136 >gi|47095655|ref|ZP_00233262.1| beta-glucosidase [Listeria monocytogenes str. 1/2a F6854] gi|254900766|ref|ZP_05260690.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Listeria monocytogenes J0161] gi|254913748|ref|ZP_05263760.1| beta-glucosidase [Listeria monocytogenes J2818] gi|254938135|ref|ZP_05269832.1| beta-glucosidase [Listeria monocytogenes F6900] gi|47015940|gb|EAL06866.1| beta-glucosidase [Listeria monocytogenes str. 1/2a F6854] gi|258610749|gb|EEW23357.1| beta-glucosidase [Listeria monocytogenes F6900] gi|293591765|gb|EFG00100.1| beta-glucosidase [Listeria monocytogenes J2818] Length = 723 Score = 37.1 bits (85), Expect = 0.80, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKALVDGYQ 173 >gi|251797617|ref|YP_003012348.1| glycoside hydrolase [Paenibacillus sp. JDR-2] gi|247545243|gb|ACT02262.1| glycoside hydrolase family 3 domain protein [Paenibacillus sp. JDR-2] Length = 840 Score = 37.1 bits (85), Expect = 0.81, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK SGI N P++D+ P + P A+ Y + Sbjct: 240 AKEASASGIMYNHGPMIDISREPR--WGRVVEGAGEDPYLGSLIAKAQVEGYQGH 292 >gi|60679928|ref|YP_210072.1| putative exported beta-glucosidase [Bacteroides fragilis NCTC 9343] gi|60491362|emb|CAH06110.1| putative exported beta-glucosidase [Bacteroides fragilis NCTC 9343] Length = 766 Score = 37.1 bits (85), Expect = 0.81, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P A+ R Y Sbjct: 141 AVEASADGISWTFSPMVDISRDPR--WGRVSEGSGEDPFLGALIARAMVRGYQ 191 >gi|322711299|gb|EFZ02873.1| glycosyl hydrolase, putative [Metarhizium anisopliae ARSEF 23] Length = 369 Score = 37.1 bits (85), Expect = 0.81, Method: Composition-based stats. Identities = 12/50 (24%), Positives = 17/50 (34%) Query: 5 LVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L+ N N +PVLD+ P F F + +A F Sbjct: 150 LLRYQCNSNLAPVLDVFRQPGDFTDYYGRSFGNTSREVVRAAVPFITAQQ 199 >gi|256378975|ref|YP_003102635.1| glycoside hydrolase family 3 domain protein [Actinosynnema mirum DSM 43827] gi|255923278|gb|ACU38789.1| glycoside hydrolase family 3 domain protein [Actinosynnema mirum DSM 43827] Length = 877 Score = 37.1 bits (85), Expect = 0.81, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 A+ + +G + F+P L + + FS P ++ + K Sbjct: 195 AEQIRATGQDWAFAPTLAVPRDDR--WGRTYEGFSEDPRIVRAYGYEATKGLQDDAK 249 >gi|332828906|gb|EGK01589.1| hypothetical protein HMPREF9455_02121 [Dysgonomonas gadei ATCC BAA-286] Length = 765 Score = 37.1 bits (85), Expect = 0.82, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P + A+ Y Sbjct: 142 AIEASADGISWTFSPMVDISRDPR--WGRFSEGSGEDPYLGGQIAKAMIHGYQ 192 >gi|315923713|ref|ZP_07919953.1| beta-glucosidase [Bacteroides sp. D2] gi|313697588|gb|EFS34423.1| beta-glucosidase [Bacteroides sp. D2] Length = 546 Score = 37.1 bits (85), Expect = 0.83, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +AK + + G ++++ PVLDL P ++ F P + Sbjct: 86 IAKEIRSQGGHISYGPVLDLTRDPR--WSRVEETFGEDPVLSGILGASMVDGL 136 >gi|291514450|emb|CBK63660.1| Beta-glucosidase-related glycosidases [Alistipes shahii WAL 8301] Length = 701 Score = 37.1 bits (85), Expect = 0.83, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 14/53 (26%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + GI V P +++ + + P A + + Sbjct: 124 GEECRAGGIEVLLGPGMNIYRNSQN--GRNFEYMGEDPLLASAMVAEYVKGMQ 174 >gi|260175481|ref|ZP_05761893.1| periplasmic beta-glucosidase precursor, xylosidase/arabinosidase [Bacteroides sp. D2] Length = 561 Score = 37.1 bits (85), Expect = 0.83, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +AK + + G ++++ PVLDL P ++ F P + Sbjct: 101 IAKEIRSQGGHISYGPVLDLTRDPR--WSRVEETFGEDPVLSGILGASMVDGL 151 >gi|53711683|ref|YP_097675.1| periplasmic beta-glucosidase [Bacteroides fragilis YCH46] gi|52214548|dbj|BAD47141.1| periplasmic beta-glucosidase precursor [Bacteroides fragilis YCH46] Length = 739 Score = 37.1 bits (85), Expect = 0.83, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P A+ R Y Sbjct: 114 AVEASADGISWTFSPMVDISRDPR--WGRVSEGSGEDPFLGALIARAMVRGYQ 164 >gi|300362277|ref|ZP_07058453.1| beta-glucosidase [Lactobacillus gasseri JV-V03] gi|300353268|gb|EFJ69140.1| beta-glucosidase [Lactobacillus gasseri JV-V03] Length = 742 Score = 37.1 bits (85), Expect = 0.85, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ SG V F+P++D+++ + P ++ +N Sbjct: 119 AEEASASGNQVAFAPMVDVVHDAR--WGRVLESPGEDPYLNSVYSKSMVEGLQEN 171 >gi|87199628|ref|YP_496885.1| Beta-glucosidase [Novosphingobium aromaticivorans DSM 12444] gi|87135309|gb|ABD26051.1| exo-1,4-beta-glucosidase [Novosphingobium aromaticivorans DSM 12444] Length = 811 Score = 37.1 bits (85), Expect = 0.85, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + SGI F+P L + + +S P A Sbjct: 178 AAEVAGSGIEWTFAPTLAVPQDLR--WGRAYEGYSSDPQVIARYAPAMVEGLQ 228 >gi|16126293|ref|NP_420857.1| 1,4-beta-D-glucan glucohydrolase D [Caulobacter crescentus CB15] gi|221235068|ref|YP_002517504.1| glucan 1,4-beta-glucosidase [Caulobacter crescentus NA1000] gi|13423529|gb|AAK24025.1| 1,4-beta-D-glucan glucohydrolase D [Caulobacter crescentus CB15] gi|220964240|gb|ACL95596.1| glucan 1,4-beta-glucosidase [Caulobacter crescentus NA1000] Length = 821 Score = 37.1 bits (85), Expect = 0.85, Method: Composition-based stats. Identities = 6/46 (13%), Positives = 15/46 (32%), Gaps = 2/46 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQ 47 AK + +G + F P + + + + P + + Sbjct: 178 AKEMAATGADWTFGPTVAVPRDSR--WGRAYEGYGENPEIVKAYSG 221 >gi|260172289|ref|ZP_05758701.1| periplasmic beta-glucosidase precursor [Bacteroides sp. D2] gi|315920595|ref|ZP_07916835.1| conserved hypothetical protein [Bacteroides sp. D2] gi|313694470|gb|EFS31305.1| conserved hypothetical protein [Bacteroides sp. D2] Length = 769 Score = 37.1 bits (85), Expect = 0.86, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A GI+ FSP++D+ P + P A+ R Y KN Sbjct: 142 AVEASADGISWTFSPMVDISRDPR--WGRVSEGNGEDPFLGAMIAEAMVRGYQGKN 195 >gi|265752259|ref|ZP_06088052.1| glycoside hydrolase family beta-glycosidase [Bacteroides sp. 3_1_33FAA] gi|263237051|gb|EEZ22521.1| glycoside hydrolase family beta-glycosidase [Bacteroides sp. 3_1_33FAA] Length = 448 Score = 37.1 bits (85), Expect = 0.88, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK V G +SP+LD+ P + + P E + + K+ Sbjct: 184 AKEAVALGYTNIYSPILDIAQDPR--WGRCVETYGEDPYLVGELGKQMITSLQKH 236 >gi|237712573|ref|ZP_04543054.1| glycoside hydrolase family 3 protein [Bacteroides sp. 9_1_42FAA] gi|237726883|ref|ZP_04557364.1| glycoside hydrolase family beta-glycosidase [Bacteroides sp. D4] gi|229435409|gb|EEO45486.1| glycoside hydrolase family beta-glycosidase [Bacteroides dorei 5_1_36/D4] gi|229453894|gb|EEO59615.1| glycoside hydrolase family 3 protein [Bacteroides sp. 9_1_42FAA] Length = 788 Score = 37.1 bits (85), Expect = 0.88, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK V G +SP+LD+ P + + P E + + K+ Sbjct: 184 AKEAVALGYTNIYSPILDIAQDPR--WGRCVETYGEDPYLVGELGKQMITSLQKH 236 >gi|212690938|ref|ZP_03299066.1| hypothetical protein BACDOR_00428 [Bacteroides dorei DSM 17855] gi|212666170|gb|EEB26742.1| hypothetical protein BACDOR_00428 [Bacteroides dorei DSM 17855] Length = 448 Score = 37.1 bits (85), Expect = 0.88, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK V G +SP+LD+ P + + P E + + K+ Sbjct: 184 AKEAVALGYTNIYSPILDIAQDPR--WGRCVETYGEDPYLVGELGKQMITSLQKH 236 >gi|154484102|ref|ZP_02026550.1| hypothetical protein EUBVEN_01813 [Eubacterium ventriosum ATCC 27560] gi|149735144|gb|EDM51030.1| hypothetical protein EUBVEN_01813 [Eubacterium ventriosum ATCC 27560] Length = 723 Score = 37.1 bits (85), Expect = 0.88, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK G+N ++P++D+ + A ++ R + Sbjct: 142 AKESAAGGVNWTYAPMVDVARDSR--WGRVAEGAGEDTYLASRFSRAKVRGFQ 192 >gi|302917655|ref|XP_003052487.1| hypothetical protein NECHADRAFT_122418 [Nectria haematococca mpVI 77-13-4] gi|256733427|gb|EEU46774.1| hypothetical protein NECHADRAFT_122418 [Nectria haematococca mpVI 77-13-4] Length = 835 Score = 37.1 bits (85), Expect = 0.90, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + GINV +P + L P I + F P + A + Sbjct: 87 LGEEARFRGINVLLAPTVCLQRSPL--IGRGFEAFGEDPFMSGVLAAAYINGIQ 138 >gi|218670507|ref|ZP_03520178.1| beta-glucosidase protein [Rhizobium etli GR56] Length = 296 Score = 37.1 bits (85), Expect = 0.90, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ G +V+ +P +++ + FS P E A + Sbjct: 85 LGDEVLSKGAHVSLAPTVNIQRSVTN--GRNFECFSEDPILTAELAVGYIEGLQ 136 >gi|302696929|ref|XP_003038143.1| glycoside hydrolase family 3 protein [Schizophyllum commune H4-8] gi|300111840|gb|EFJ03241.1| glycoside hydrolase family 3 protein [Schizophyllum commune H4-8] Length = 838 Score = 37.1 bits (85), Expect = 0.91, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A G ++ P ++ P + FS P A + Sbjct: 88 LADECRAKGCHILLGPTVNTQRSPLG--GRGFESFSEDPVLNGTIAAAYINGLQ 139 >gi|29347282|ref|NP_810785.1| periplasmic beta-glucosidase [Bacteroides thetaiotaomicron VPI-5482] gi|29339181|gb|AAO76979.1| periplasmic beta-glucosidase precursor [Bacteroides thetaiotaomicron VPI-5482] Length = 759 Score = 37.1 bits (85), Expect = 0.93, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI FSP++D+ + P A A+ + Y Sbjct: 143 AIEASADGICWTFSPMVDICRDAR--WGRIAEGSGEDPYLASLLAKAYVHGYQ 193 >gi|41052566|dbj|BAD07748.1| putative beta-D-glucan exohydrolase [Oryza sativa Japonica Group] gi|125537957|gb|EAY84352.1| hypothetical protein OsI_05727 [Oryza sativa Indica Group] Length = 648 Score = 37.1 bits (85), Expect = 0.93, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI F+P + + P + FS P + + + + Sbjct: 172 AAEVRATGIPYVFAPCVAVCRDPR--WGRCYESFSEDPRVVQRMSSI-ISGFQ 221 >gi|90416657|ref|ZP_01224587.1| 1,4-beta-D-glucan glucohydrolase D [marine gamma proteobacterium HTCC2207] gi|90331410|gb|EAS46646.1| 1,4-beta-D-glucan glucohydrolase D [marine gamma proteobacterium HTCC2207] Length = 834 Score = 37.1 bits (85), Expect = 0.94, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 AK + +GI+ F+P + ++ + +S A + A R P Sbjct: 168 AKEVAATGIDWVFAPTVAVVKDLR--WGRTYEGYSSDAALVKAYAGEIVRGIQGEP 221 >gi|297598532|ref|NP_001045791.2| Os02g0131400 [Oryza sativa Japonica Group] gi|255670573|dbj|BAF07705.2| Os02g0131400 [Oryza sativa Japonica Group] Length = 620 Score = 36.7 bits (84), Expect = 0.97, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI F+P + + P + FS P + + + + Sbjct: 144 AAEVRATGIPYVFAPCVAVCRDPR--WGRCYESFSEDPRVVQRMSSI-ISGFQ 193 >gi|227819833|ref|YP_002823804.1| beta-hexosaminidase [Sinorhizobium fredii NGR234] gi|227338832|gb|ACP23051.1| beta-hexosaminidase [Sinorhizobium fredii NGR234] Length = 335 Score = 36.7 bits (84), Expect = 0.97, Method: Composition-based stats. Identities = 5/53 (9%), Positives = 13/53 (24%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK G+ + +P+ D+ + + + Sbjct: 119 AKAARALGVTMYLAPIADI-VDGQNPW-LAGRTLGIDKEEVGRLVSAYISGVQ 169 >gi|326332712|ref|ZP_08198974.1| glycosyl hyrolase, family 3 [Nocardioidaceae bacterium Broad-1] gi|325949493|gb|EGD41571.1| glycosyl hyrolase, family 3 [Nocardioidaceae bacterium Broad-1] Length = 449 Score = 36.7 bits (84), Expect = 0.98, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L G F+PV D+ G S P A + + Y + Sbjct: 209 ELRDLGFTWVFAPVADVTVGAADPTIGS-RSPSEKPRVAATAVSAAVQGYNE 259 >gi|156509594|gb|ABU68675.1| beta-glucosidase [uncultured microorganism] Length = 740 Score = 36.7 bits (84), Expect = 0.98, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + GI SP +DL P ++ F P A+ + + Sbjct: 203 SAEYRALGIATALSPQIDLATEPR--WSRFNGTFGEDPELDVALARAYVDGFQ 253 >gi|282878201|ref|ZP_06286997.1| glycosyl hydrolase family 3 C-terminal domain protein [Prevotella buccalis ATCC 35310] gi|281299619|gb|EFA91992.1| glycosyl hydrolase family 3 C-terminal domain protein [Prevotella buccalis ATCC 35310] Length = 947 Score = 36.7 bits (84), Expect = 0.99, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + G ++P+LD+ + ++ P E +R N Sbjct: 205 GREARLLGYTNVYAPILDVGRDQR--WGRYEEVYGESPFLVAELGIQMTRGLQTN 257 >gi|262089670|gb|ACY24766.1| beta-D-xylosidase [uncultured organism] Length = 819 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 7/55 (12%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A + + G ++ +P +++ + +S P + E A + + Sbjct: 87 LADEVKSKGAHMLLAPTVNIHRSVTN--GRNFECYSEDPILSAELAVSYITGLQE 139 >gi|326402791|ref|YP_004282872.1| beta-glucosidase [Acidiphilium multivorum AIU301] gi|325049652|dbj|BAJ79990.1| beta-glucosidase [Acidiphilium multivorum AIU301] Length = 927 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 14/54 (25%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G V+ P +++ P + S P A R Sbjct: 124 IGAEQKAKGTAVDLGPTVNIDRDPR--WGRSFESLSEDPYLAARIGVAEIRGIQ 175 >gi|148259584|ref|YP_001233711.1| glycoside hydrolase family 3 protein [Acidiphilium cryptum JF-5] gi|146401265|gb|ABQ29792.1| glycoside hydrolase, family 3 domain protein [Acidiphilium cryptum JF-5] Length = 927 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 14/54 (25%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G V+ P +++ P + S P A R Sbjct: 124 IGAEQKAKGTAVDLGPTVNIDRDPR--WGRSFESLSEDPYLAARIGVAEIRGIQ 175 >gi|222622110|gb|EEE56242.1| hypothetical protein OsJ_05253 [Oryza sativa Japonica Group] Length = 627 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI F+P + + P + FS P + + + + Sbjct: 172 AAEVRATGIPYVFAPCVAVCRDPR--WGRCYESFSEDPRVVQRMSSI-ISGFQ 221 >gi|283479031|emb|CAY74947.1| beta-D-glucoside glucohydrolase, periplasmic [Erwinia pyrifoliae DSM 12163] Length = 743 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A G+N+ ++P++D+ P + F E ++ + N Sbjct: 121 AYEAADDGLNMTWAPMVDVTREPR--WGRGSEGFGEDTWLTSEMGRVLVKAMQGN 173 >gi|259909017|ref|YP_002649373.1| Periplasmic beta-glucosidase [Erwinia pyrifoliae Ep1/96] gi|224964639|emb|CAX56153.1| Periplasmic beta-glucosidase [Erwinia pyrifoliae Ep1/96] Length = 765 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A G+N+ ++P++D+ P + F E ++ + N Sbjct: 143 AYEAADDGLNMTWAPMVDVTREPR--WGRGSEGFGEDTWLTSEMGRVLVKAMQGN 195 >gi|86749865|ref|YP_486361.1| Beta-N-acetylhexosaminidase [Rhodopseudomonas palustris HaA2] gi|86572893|gb|ABD07450.1| Beta-N-acetylhexosaminidase [Rhodopseudomonas palustris HaA2] Length = 341 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 7/36 (19%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFS 36 +A +L GI V+ P+ D+ + + Sbjct: 110 IASDLFDLGITVDCLPLADVPVSGADAVIG-DRAYG 144 >gi|300778434|ref|ZP_07088292.1| beta-glucosidase [Chryseobacterium gleum ATCC 35910] gi|300503944|gb|EFK35084.1| beta-glucosidase [Chryseobacterium gleum ATCC 35910] Length = 740 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ F+P++D+ P + + + + Sbjct: 137 ATEAAAYGIHWTFAPMVDIARDPR--WGRVMEGSGEDTYLGTKIGLARIKGFQ 187 >gi|282852773|ref|ZP_06262115.1| glycosyl hydrolase family 3 N-terminal domain protein [Lactobacillus gasseri 224-1] gi|282556515|gb|EFB62135.1| glycosyl hydrolase family 3 N-terminal domain protein [Lactobacillus gasseri 224-1] Length = 316 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ SG V F+P++D+++ + P ++ +N Sbjct: 119 AEEASASGNQVAFAPMVDVVHDAR--WGRVLESPGEDPYLNSVYSKNMVEGLQEN 171 >gi|262195301|ref|YP_003266510.1| glycoside hydrolase [Haliangium ochraceum DSM 14365] gi|262078648|gb|ACY14617.1| glycoside hydrolase family 3 domain protein [Haliangium ochraceum DSM 14365] Length = 900 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 A + +G++ F+P + ++ + FS P + A R +P+ Sbjct: 197 AAEVSVTGLDWTFAPTVAVVRDDR--WGRTYEGFSEDPEIVRDYAGKIVRGVQGDPQ 251 >gi|291298614|ref|YP_003509892.1| glycoside hydrolase family 3 domain-containing protein [Stackebrandtia nassauensis DSM 44728] gi|290567834|gb|ADD40799.1| glycoside hydrolase family 3 domain protein [Stackebrandtia nassauensis DSM 44728] Length = 818 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A G++V +P ++L P + FS P A F R + Sbjct: 94 LAAEARRKGVHVLLAPTINLHRSPLG--GRHFEAFSEDPLLTGAMAAAFVRGVQE 146 >gi|145299478|ref|YP_001142319.1| beta-glucosidase [Aeromonas salmonicida subsp. salmonicida A449] gi|142852250|gb|ABO90571.1| beta-glucosidase [Aeromonas salmonicida subsp. salmonicida A449] Length = 793 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 7/56 (12%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 M + G+++ +P +++ P + +S P + N Sbjct: 149 MGDEVRQYGVDILLAPGMNIQRNPLN--GRNFEYYSEDPLLTGKIGAAMVNGVESN 202 >gi|146312373|ref|YP_001177447.1| beta-galactosidase [Enterobacter sp. 638] gi|145319249|gb|ABP61396.1| beta-glucosidase [Enterobacter sp. 638] Length = 772 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 150 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTATLGKTMVEAMQGKSP 204 >gi|120437787|ref|YP_863473.1| beta-glucosidase [Gramella forsetii KT0803] gi|117579937|emb|CAL68406.1| beta-glucosidase [Gramella forsetii KT0803] Length = 757 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 21/61 (34%), Gaps = 6/61 (9%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI----KNP 57 A V G+N FSP++D+ + P + A + Y NP Sbjct: 147 ALESVAEGVNWTFSPMIDISRDAR--WGRIMEGSGEDPYLTSKVAVAKVKGYQGEDLSNP 204 Query: 58 K 58 K Sbjct: 205 K 205 >gi|331083437|ref|ZP_08332549.1| hypothetical protein HMPREF0992_01473 [Lachnospiraceae bacterium 6_1_63FAA] gi|330404130|gb|EGG83678.1| hypothetical protein HMPREF0992_01473 [Lachnospiraceae bacterium 6_1_63FAA] Length = 748 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K L G+++ +LD++ P + FS P + A+ + Sbjct: 147 GKQLREMGVDLALISLLDVVRDPR--WGRSEECFSEDPYLCSKMAEQIVKAVQD 198 >gi|297811163|ref|XP_002873465.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. lyrata] gi|297319302|gb|EFH49724.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. lyrata] Length = 796 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 7/42 (16%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Query: 14 FSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 ++P ++L P + + P E F R + + Sbjct: 153 WAPNINLFRDPR--WGRGQETPGEDPKVVSEYGVEFVRGFQE 192 >gi|260588872|ref|ZP_05854785.1| beta-glucosidase [Blautia hansenii DSM 20583] gi|260540651|gb|EEX21220.1| beta-glucosidase [Blautia hansenii DSM 20583] Length = 748 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 K L G+++ +LD++ P + FS P + A+ + Sbjct: 147 GKQLREMGVDLALISLLDVVRDPR--WGRSEECFSEDPYLCSKMAEQIVKAVQD 198 >gi|224024049|ref|ZP_03642415.1| hypothetical protein BACCOPRO_00766 [Bacteroides coprophilus DSM 18228] gi|224017271|gb|EEF75283.1| hypothetical protein BACCOPRO_00766 [Bacteroides coprophilus DSM 18228] Length = 781 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A I ++PV+DL P + + E + + N Sbjct: 170 AYETRACCIPWTYAPVVDLGRDPRWP--RMWENYGEDCYVNAEMGKAAVAGFQGN 222 >gi|332881338|ref|ZP_08448988.1| glycosyl hydrolase family 3 protein [Capnocytophaga sp. oral taxon 329 str. F0087] gi|332680714|gb|EGJ53661.1| glycosyl hydrolase family 3 protein [Capnocytophaga sp. oral taxon 329 str. F0087] Length = 756 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + GI PVLD+ + F P E F R Sbjct: 147 IGRESHVIGIRQLQCPVLDIARDLR--WGRVEETFGEDPFLIGEMGTAFVRGSQ 198 >gi|261416451|ref|YP_003250134.1| glycoside hydrolase family 3 domain protein [Fibrobacter succinogenes subsp. succinogenes S85] gi|261372907|gb|ACX75652.1| glycoside hydrolase family 3 domain protein [Fibrobacter succinogenes subsp. succinogenes S85] gi|302326383|gb|ADL25584.1| glycosyl hydrolase, family 3 [Fibrobacter succinogenes subsp. succinogenes S85] Length = 678 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A+ + + I++NF+P + + + F A + F R N Sbjct: 207 AEEMWAAHIDLNFAPAITVPQDER--WGRVYEGFGETTELAVDLGAAFVRGQQGDN 260 >gi|224536377|ref|ZP_03676916.1| hypothetical protein BACCELL_01251 [Bacteroides cellulosilyticus DSM 14838] gi|224522015|gb|EEF91120.1| hypothetical protein BACCELL_01251 [Bacteroides cellulosilyticus DSM 14838] Length = 954 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +G +SPVLD+ + + F P + + + Y Sbjct: 255 GDETLAAGTMQAWSPVLDV--AQDARWGRCEETFGEDPVLVSQIGGAWIKGYQ 305 >gi|218661925|ref|ZP_03517855.1| beta-glucosidase protein [Rhizobium etli IE4771] Length = 575 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G V +P +++ + +S P E A + Sbjct: 84 LARQAKSKGAAVLLAPTVNIHRSGLN--GRNFECYSEDPMLTAELAVAYIEGVQ 135 >gi|218515360|ref|ZP_03512200.1| beta-glucosidase protein [Rhizobium etli 8C-3] Length = 148 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G V +P +++ + +S P E A + Sbjct: 83 LARQAKSKGAAVLLAPTVNIHRSGLN--GRNFECYSEDPMLTAELAVAYIEGVQ 134 >gi|327194365|gb|EGE61225.1| beta-glucosidase [Rhizobium etli CNPAF512] Length = 821 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G V +P +++ + +S P E A + Sbjct: 83 LARQAKSKGAAVLLAPTVNIHRSGLN--GRNFECYSEDPMLTAELAVAYIEGVQ 134 >gi|162456842|ref|YP_001619209.1| Beta-glucosidase [Sorangium cellulosum 'So ce 56'] gi|161167424|emb|CAN98729.1| Beta-glucosidase [Sorangium cellulosum 'So ce 56'] Length = 739 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK ++ +G++ F+P L + + +S P + Sbjct: 245 AKEVLATGLDWTFAPTLATVRDDR--WGRTYEGYSEDPEIVNAYGGRIVQGIQ 295 >gi|325569616|ref|ZP_08145663.1| beta-glucosidase [Enterococcus casseliflavus ATCC 12755] gi|325157172|gb|EGC69337.1| beta-glucosidase [Enterococcus casseliflavus ATCC 12755] Length = 508 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK +G++V FSP+LDL+ P + A+ A+ Y N Sbjct: 121 AKECYQNGLHVIFSPMLDLVRDPR--WGRVMESPGEDVYTAKRFAKSVVTGYQGN 173 >gi|310767086|gb|ADP12036.1| Periplasmic beta-glucosidase [Erwinia sp. Ejp617] Length = 765 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A G+N+ ++P++D+ P + F E ++ + N Sbjct: 143 AYEAADDGLNMTWAPMVDVTREPR--WGRGSEGFGEDTWLTSEMGRVLVKAMQGN 195 >gi|299144988|ref|ZP_07038056.1| xylosidase [Bacteroides sp. 3_1_23] gi|298515479|gb|EFI39360.1| xylosidase [Bacteroides sp. 3_1_23] Length = 800 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A G +SP+LD+ P + + P E + Sbjct: 197 ADEAKALGYTNIYSPILDIAQDPR--WGRVVESYGEDPYLVGELGKQMILGLQN 248 >gi|192359181|ref|YP_001981983.1| glucan 1,4-beta-glucosidase cel3B [Cellvibrio japonicus Ueda107] gi|190685346|gb|ACE83024.1| glucan 1,4-beta-glucosidase, putative, cel3B [Cellvibrio japonicus Ueda107] Length = 820 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G++ +FSP + + + +S PA A Sbjct: 141 ATEIAVTGLDWDFSPTVAVARDDR--WGRTYESYSEDPAIVRLYAAEMVAGLQ 191 >gi|153808530|ref|ZP_01961198.1| hypothetical protein BACCAC_02824 [Bacteroides caccae ATCC 43185] gi|149128852|gb|EDM20069.1| hypothetical protein BACCAC_02824 [Bacteroides caccae ATCC 43185] Length = 775 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 16/56 (28%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A + F+PV+DL P + F + A R N Sbjct: 160 AYETRACCVPWTFAPVMDLGRDPRWP--RMWESFGEDAYVNAQMAVQAVRGLQGDN 213 >gi|315225737|ref|ZP_07867525.1| thermostable beta-glucosidase B [Parascardovia denticolens DSM 10105] gi|315119869|gb|EFT83001.1| thermostable beta-glucosidase B [Parascardovia denticolens DSM 10105] Length = 846 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + T G+ V+ P + + P + +S P A A F R N Sbjct: 113 LGEEAKTLGVQVSLGPGICMKRSPLC--GRNFEYYSEDPLLAGRLAGGFVRGLQSN 166 >gi|294786208|ref|ZP_06751462.1| thermostable beta-glucosidase B [Parascardovia denticolens F0305] gi|294485041|gb|EFG32675.1| thermostable beta-glucosidase B [Parascardovia denticolens F0305] Length = 821 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + T G+ V+ P + + P + +S P A A F R N Sbjct: 88 LGEEAKTLGVQVSLGPGICMKRSPLC--GRNFEYYSEDPLLAGRLAGGFVRGLQSN 141 >gi|293373755|ref|ZP_06620101.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides ovatus SD CMC 3f] gi|292631245|gb|EFF49877.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides ovatus SD CMC 3f] Length = 800 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A G +SP+LD+ P + + P E + Sbjct: 197 ADEAKALGYTNIYSPILDIAQDPR--WGRVVESYGEDPYLVGELGKQMILGLQN 248 >gi|154319766|ref|XP_001559200.1| hypothetical protein BC1G_02364 [Botryotinia fuckeliana B05.10] gi|150856022|gb|EDN31214.1| hypothetical protein BC1G_02364 [Botryotinia fuckeliana B05.10] Length = 777 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G+N F P+ DL + F A E + + Sbjct: 158 IAQESLALGVNQIFGPLGDLARELRY--GRVEETFGEDGYLAGELGYAYVKGLQ 209 >gi|315185692|gb|EFU19459.1| beta-glucosidase [Spirochaeta thermophila DSM 6578] Length = 768 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKR-SIFSRIPAKAEESAQLFSRTYI 54 M + + G+++ +P +++ + + +S P + A F R Sbjct: 153 MGEEALAYGVDMILAPGMNIHR---HPLGGRNFEYYSEDPLITGKMAAAFVRGVQ 204 >gi|312215372|emb|CBX95324.1| hypothetical protein [Leptosphaeria maculans] Length = 279 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G NV +P + + P + +S P + A + R Sbjct: 149 LGEEAKARGANVLLAPTVGMHRSPLG--GRNFESYSEDPFLTGKLAASYIRGLQ 200 >gi|160884749|ref|ZP_02065752.1| hypothetical protein BACOVA_02738 [Bacteroides ovatus ATCC 8483] gi|156109784|gb|EDO11529.1| hypothetical protein BACOVA_02738 [Bacteroides ovatus ATCC 8483] Length = 800 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A G +SP+LD+ P + + P E + Sbjct: 197 ADEAKALGYTNIYSPILDIAQDPR--WGRVVESYGEDPYLVGELGKQMILGLQN 248 >gi|163752776|ref|ZP_02159900.1| glycoside hydrolase, family 3-like protein [Kordia algicida OT-1] gi|161326508|gb|EDP97833.1| glycoside hydrolase, family 3-like protein [Kordia algicida OT-1] Length = 404 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A ++GIN F+P++D+ P + P + A + Sbjct: 160 AIEASSAGINWTFAPMVDISRDPR--WGRVMEGGGEDPYLGSKIASARVHGFQ 210 >gi|160895029|ref|ZP_02075803.1| hypothetical protein CLOL250_02579 [Clostridium sp. L2-50] gi|156863460|gb|EDO56891.1| hypothetical protein CLOL250_02579 [Clostridium sp. L2-50] Length = 850 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 7/56 (12%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Query: 1 MAKNLVTSGINVNFS-PVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + G+++ P +++ P + + FS P + A + + + Sbjct: 167 LGREARAYGVHMLLGTPNINIHRDPLS--GRLFEGFSEDPCLVSKLAPEYVKGVQE 220 >gi|311278884|ref|YP_003941115.1| glycoside hydrolase family 3 domain-containing protein [Enterobacter cloacae SCF1] gi|308748079|gb|ADO47831.1| glycoside hydrolase family 3 domain protein [Enterobacter cloacae SCF1] Length = 765 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRVSEGFGEDTYLTATMGKTMVEAMQGKSP 197 >gi|117620313|ref|YP_857197.1| beta-glucosidase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] gi|117561720|gb|ABK38668.1| beta-glucosidase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] Length = 888 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 7/56 (12%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 M + G+++ +P +++ P + +S P + N Sbjct: 244 MGDEVRQYGVDILLAPGMNIQRNPLN--GRNFEYYSEDPLLTGKIGAAMVNGVESN 297 >gi|70728731|ref|YP_258480.1| periplasmic beta-glucosidase [Pseudomonas fluorescens Pf-5] gi|68343030|gb|AAY90636.1| periplasmic beta-glucosidase [Pseudomonas fluorescens Pf-5] Length = 763 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK +++ F+P++D+ P + F A++ + Y Sbjct: 138 AKEASADSLDITFAPMVDISRDPR--WGRTSEGFGEDTYLVSRIAKVMVKAYQ 188 >gi|317477144|ref|ZP_07936385.1| glycosyl hydrolase family 3 C terminal domain-containing protein [Bacteroides eggerthii 1_2_48FAA] gi|316906687|gb|EFV28400.1| glycosyl hydrolase family 3 C terminal domain-containing protein [Bacteroides eggerthii 1_2_48FAA] Length = 814 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A G ++ + PVLDL P ++ + + + Sbjct: 194 IATEASAQGAHIGYGPVLDLARDPR--WSRVEETYGEDAYLNGVMGAALVKGFQ 245 >gi|285808617|gb|ADC36136.1| glycoside hydrolase family 3 protein [uncultured bacterium 253] Length = 752 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ +G+ F+P+LD+ P + A+ R + Sbjct: 142 AREARAAGVRWTFAPMLDIARDPR--WGRITEGAGEDQFLGAAFARARVRGFQ 192 >gi|282881076|ref|ZP_06289763.1| glycosyl hydrolase family 3 N-terminal domain protein [Prevotella timonensis CRIS 5C-B1] gi|281304880|gb|EFA96953.1| glycosyl hydrolase family 3 N-terminal domain protein [Prevotella timonensis CRIS 5C-B1] Length = 851 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 AK GI V + P + + ++ P A E A F + +N Sbjct: 116 AKEWKARGIQVFYGP--GVNIYRSSKDSRNFEYMGEDPYLASEMAVPFIQGIQQN 168 >gi|218658314|ref|ZP_03514244.1| beta-glucosidase protein [Rhizobium etli IE4771] Length = 143 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ G +V+ +P +++ + FS P E A + Sbjct: 52 LGDEVLSKGAHVSLAPTVNIQRSVTN--GRNFECFSEDPILTAELAVGYIEGLQ 103 >gi|189464211|ref|ZP_03012996.1| hypothetical protein BACINT_00548 [Bacteroides intestinalis DSM 17393] gi|189438001|gb|EDV06986.1| hypothetical protein BACINT_00548 [Bacteroides intestinalis DSM 17393] Length = 814 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A G ++ + PVLDL P ++ + + + Sbjct: 194 IATEASAQGAHIGYGPVLDLARDPR--WSRVEETYGEDAYLNGVMGAALVKGFQ 245 >gi|91766362|gb|ABE60716.1| beta-glucosidase [uncultured bacterium] Length = 793 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 7/56 (12%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 M + G+++ +P +++ P + +S P + N Sbjct: 149 MGDEVRQYGVDILLAPGMNIQRNPLN--GRNFEYYSEDPLLTGKIGAAMVNGVESN 202 >gi|326333680|ref|ZP_08199917.1| 1,4-beta-D-glucan glucohydrolase D [Nocardioidaceae bacterium Broad-1] gi|325948586|gb|EGD40689.1| 1,4-beta-D-glucan glucohydrolase D [Nocardioidaceae bacterium Broad-1] Length = 667 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG F+P + + + F P A + +Q + Sbjct: 180 AEETRASGPQWTFAPCICVARDDR--WGRTYESFGEDPKLAAKMSQ-MIEGFQ 229 >gi|237732180|ref|ZP_04562661.1| yohA [Citrobacter sp. 30_2] gi|226907719|gb|EEH93637.1| yohA [Citrobacter sp. 30_2] Length = 765 Score = 36.3 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTATMGKTMVEAMQGKSP 197 >gi|222080945|ref|YP_002540308.1| beta-glucosidase protein [Agrobacterium radiobacter K84] gi|221725624|gb|ACM28713.1| beta-glucosidase protein [Agrobacterium radiobacter K84] Length = 817 Score = 36.3 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G V +P +++ + +S P E A + Sbjct: 83 LAEEAKSKGARVVLAPTVNIQRSGLN--GRNFECYSEDPHLTSEIAVGYIDGLQ 134 >gi|329962183|ref|ZP_08300190.1| glycosyl hydrolase family 3 protein [Bacteroides fluxus YIT 12057] gi|328530470|gb|EGF57344.1| glycosyl hydrolase family 3 protein [Bacteroides fluxus YIT 12057] Length = 736 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A SG++ FSP++D+ + + P + Y Sbjct: 150 ALESRMSGVDWTFSPMIDIARDGR--WGRVAEGYGEDPYATAVYTVAAVKGYQ 200 >gi|284800333|ref|YP_003412198.1| hypothetical protein LM5578_0078 [Listeria monocytogenes 08-5578] gi|284993518|ref|YP_003415286.1| hypothetical protein LM5923_0078 [Listeria monocytogenes 08-5923] gi|284055895|gb|ADB66836.1| hypothetical protein LM5578_0078 [Listeria monocytogenes 08-5578] gi|284058985|gb|ADB69924.1| hypothetical protein LM5923_0078 [Listeria monocytogenes 08-5923] Length = 756 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + GI++ + LD+L P + + P A E + + Sbjct: 151 ITEEISEKGIHLALASALDILRDPR--WGRAEECYGEDPYLAAELTAAITEGFQ 202 >gi|224498373|ref|ZP_03666722.1| hypothetical protein LmonF1_01220 [Listeria monocytogenes Finland 1988] Length = 756 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + GI++ + LD+L P + + P A E + + Sbjct: 151 ITEEISEKGIHLALASALDILRDPR--WGRAEECYGEDPYLAAELTAAITEGFQ 202 >gi|190895032|ref|YP_001985325.1| beta-glucosidase [Rhizobium etli CIAT 652] gi|190700693|gb|ACE94775.1| beta-glucosidase protein [Rhizobium etli CIAT 652] Length = 821 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G V +P +++ + +S P E A + Sbjct: 83 LARQAKSKGAAVLLAPTVNIHRSGLN--GRNFECYSEDPMLTAELAVAYIEGVQ 134 >gi|254830782|ref|ZP_05235437.1| hypothetical protein Lmon1_05459 [Listeria monocytogenes 10403S] Length = 756 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + GI++ + LD+L P + + P A E + + Sbjct: 151 ITEEISEKGIHLALASALDILRDPR--WGRAEECYGEDPYLAAELTAAITEGFQ 202 >gi|238494478|ref|XP_002378475.1| beta-glucosidase, putative [Aspergillus flavus NRRL3357] gi|220695125|gb|EED51468.1| beta-glucosidase, putative [Aspergillus flavus NRRL3357] Length = 815 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + G+N PV+DL + + P A E +++ + Sbjct: 196 IGQEASALGVNHVMGPVVDLARELR--FGRVEETYGEDPFLAGEIGYHYTKGIQSH 249 >gi|265765006|ref|ZP_06093281.1| beta-glucosidase [Bacteroides sp. 2_1_16] gi|263254390|gb|EEZ25824.1| beta-glucosidase [Bacteroides sp. 2_1_16] Length = 832 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K+ G++V P +++ P + P A + + Sbjct: 116 LGKDCRARGVHVLLGPAVNIYRAPMC--GRNFEYMGEDPYLTSRMATGYIKGVQ 167 >gi|301113770|ref|XP_002998655.1| glycoside hydrolase, putative [Phytophthora infestans T30-4] gi|262111956|gb|EEY70008.1| glycoside hydrolase, putative [Phytophthora infestans T30-4] Length = 146 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 ++ +G+ F P+L + P A+ F P + R N Sbjct: 51 GRDSEAAGMPWVFGPILGISRSPL--WARTFETFGEDPYLSSVLGDAIIRGLQSN 103 >gi|253564322|ref|ZP_04841779.1| beta-glucosidase [Bacteroides sp. 3_2_5] gi|251948098|gb|EES88380.1| beta-glucosidase [Bacteroides sp. 3_2_5] gi|301161396|emb|CBW20936.1| putative beta-glucosidase [Bacteroides fragilis 638R] Length = 832 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K+ G++V P +++ P + P A + + Sbjct: 116 LGKDCRARGVHVLLGPAVNIYRAPMC--GRNFEYMGEDPYLTSRMATGYIKGVQ 167 >gi|218515758|ref|ZP_03512598.1| beta-glucosidase protein [Rhizobium etli 8C-3] Length = 151 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ G +V+ +P +++ + FS P E A + Sbjct: 85 LGDEVLSKGAHVSLAPTVNIQRSVTN--GRNFECFSEDPILTAELAVGYIEGLQ 136 >gi|156046198|ref|XP_001589644.1| hypothetical protein SS1G_09366 [Sclerotinia sclerotiorum 1980] gi|154693761|gb|EDN93499.1| hypothetical protein SS1G_09366 [Sclerotinia sclerotiorum 1980 UF-70] Length = 777 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G+N F P+ DL + F A E + + Sbjct: 158 IAQESLALGVNQIFGPLGDLARELRY--GRVEETFGEDGYLAGEMGYAYVKGLQ 209 >gi|160878857|ref|YP_001557825.1| glycoside hydrolase family 3 protein [Clostridium phytofermentans ISDg] gi|160427523|gb|ABX41086.1| glycoside hydrolase family 3 domain protein [Clostridium phytofermentans ISDg] Length = 743 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK SG++V F+P++DL+ + + A + Sbjct: 128 AKESAVSGVHVTFAPMVDLVRDAR--WGRVMESTGEDTKLNSDFAIAMVEGFQ 178 >gi|60679871|ref|YP_210015.1| putative beta-glucosidase [Bacteroides fragilis NCTC 9343] gi|60491305|emb|CAH06053.1| putative beta-glucosidase [Bacteroides fragilis NCTC 9343] Length = 832 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K+ G++V P +++ P + P A + + Sbjct: 116 LGKDCRARGVHVLLGPAVNIYRAPMC--GRNFEYMGEDPYLTSRMATGYIKGVQ 167 >gi|288562870|pdb|2X42|A Chain A, Structure Of Beta-Glucosidase 3b From Thermotoga Neapolitana In Complex With Alpha-D-Glucose gi|288965297|pdb|2WT5|A Chain A, Structure Of Beta-Glucosidase 3b From Thermotoga Neapolitana: Mutant D242a In Complex With Alpha-D-Glucose Length = 721 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M + + G++V +P +++ P + +S P + E A F + Sbjct: 103 MGEEVREYGVDVLLAPAMNIHRNPLC--GRNFEYYSEDPVLSGEMASSFVKGVQ 154 >gi|222099644|ref|YP_002534212.1| Beta-glucosidase [Thermotoga neapolitana DSM 4359] gi|221572034|gb|ACM22846.1| Beta-glucosidase [Thermotoga neapolitana DSM 4359] Length = 723 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M + + G++V +P +++ P + +S P + E A F + Sbjct: 105 MGEEVREYGVDVLLAPAMNIHRNPLC--GRNFEYYSEDPVLSGEMASSFVKGVQ 156 >gi|288562868|pdb|2X40|A Chain A, Structure Of Beta-Glucosidase 3b From Thermotoga Neapolitana In Complex With Glycerol gi|288562869|pdb|2X41|A Chain A, Structure Of Beta-Glucosidase 3b From Thermotoga Neapolitana In Complex With Glucose gi|288965296|pdb|2WT3|A Chain A, Structural Of Beta-Glucosidase 3b From Thermotoga Neapolitana In Complex With Glucose: A Thermostable 3- Domain Representative Of Glycoside Hydrolase Family 3 gi|288965298|pdb|2WT6|A Chain A, Structural Of Beta-Glucosidase 3b From Thermotoga Neapolitana In Complex With Glycerol gi|113015391|gb|ABI29899.1| beta-glucosidase [Thermotoga neapolitana DSM 4359] Length = 721 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M + + G++V +P +++ P + +S P + E A F + Sbjct: 103 MGEEVREYGVDVLLAPAMNIHRNPLC--GRNFEYYSEDPVLSGEMASSFVKGVQ 154 >gi|315225249|ref|ZP_07867066.1| periplasmic beta-glucosidase [Capnocytophaga ochracea F0287] gi|314944932|gb|EFS96964.1| periplasmic beta-glucosidase [Capnocytophaga ochracea F0287] Length = 770 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI--KN 56 A+ GIN F+P++D+ + P A+ + + N Sbjct: 156 AREASADGINWTFAPMVDITRDAR--WGRAMEGAGEDPYLGSLIAEARVKGFQGGDN 210 >gi|311893679|dbj|BAJ26087.1| putative beta-glucosidase [Kitasatospora setae KM-6054] Length = 822 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 10/50 (20%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFS 50 +A G++V +P L+L P + FS P + Sbjct: 95 LAAEARRKGVHVVLAPTLNLHRSPLG--GRNFECFSEDPLLTARIGAAYI 142 >gi|256819849|ref|YP_003141128.1| glycoside hydrolase family 3 domain-containing protein [Capnocytophaga ochracea DSM 7271] gi|256581432|gb|ACU92567.1| glycoside hydrolase family 3 domain protein [Capnocytophaga ochracea DSM 7271] Length = 804 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI--KN 56 A+ GIN F+P++D+ + P A+ + + N Sbjct: 190 AREASADGINWTFAPMVDITRDAR--WGRAMEGAGEDPYLGSLIAEARVKGFQGGDN 244 >gi|218679246|ref|ZP_03527143.1| beta-glucosidase protein [Rhizobium etli CIAT 894] Length = 164 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + +++ G +V+ +P +++ + FS P E A + Sbjct: 85 LGDEVLSKGAHVSLAPTVNIQRSVTN--GRNFECFSEDPILTAELAVGYIEGLQ 136 >gi|153809244|ref|ZP_01961912.1| hypothetical protein BACCAC_03555 [Bacteroides caccae ATCC 43185] gi|149128220|gb|EDM19440.1| hypothetical protein BACCAC_03555 [Bacteroides caccae ATCC 43185] Length = 769 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P A+ R Y Sbjct: 142 AVEASADGISWTFSPMVDISRDPR--WGRVSEGNGEDPFLGAMIAEAMVRGYQ 192 >gi|296103779|ref|YP_003613925.1| putative periplasmic beta-glucosidase precursor [Enterobacter cloacae subsp. cloacae ATCC 13047] gi|295058238|gb|ADF62976.1| putative periplasmic beta-glucosidase precursor [Enterobacter cloacae subsp. cloacae ATCC 13047] Length = 765 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTATMGKTMVEAMQGKSP 197 >gi|163846650|ref|YP_001634694.1| glycoside hydrolase family 3 protein [Chloroflexus aurantiacus J-10-fl] gi|222524451|ref|YP_002568922.1| glycoside hydrolase family 3 domain-containing protein [Chloroflexus sp. Y-400-fl] gi|163667939|gb|ABY34305.1| glycoside hydrolase family 3 domain protein [Chloroflexus aurantiacus J-10-fl] gi|222448330|gb|ACM52596.1| glycoside hydrolase family 3 domain protein [Chloroflexus sp. Y-400-fl] Length = 817 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ G ++ +P +++ P + FS P A + Sbjct: 87 LAEETRDKGAHILLAPTVNIHRSPLA--GRNFECFSEDPYLTGVMASAYINGLQ 138 >gi|169777347|ref|XP_001823139.1| beta-glucosidase [Aspergillus oryzae RIB40] gi|83771876|dbj|BAE62006.1| unnamed protein product [Aspergillus oryzae] Length = 779 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + G+N PV+DL + + P A E +++ + Sbjct: 160 IGQEASALGVNHVMGPVVDLARELR--FGRVEETYGEDPFLAGEIGYHYTKGIQSH 213 >gi|50554925|ref|XP_504871.1| YALI0F01672p [Yarrowia lipolytica] gi|49650741|emb|CAG77673.1| YALI0F01672p [Yarrowia lipolytica] Length = 862 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A+ +V +P +++ P + FS P + + A + + N Sbjct: 117 LAEESRAKSAHVVLAPTINIQRSPLG--GRSFESFSEDPLLSGKLATQYVKGLQDN 170 >gi|283832442|ref|ZP_06352183.1| periplasmic beta-glucosidase [Citrobacter youngae ATCC 29220] gi|291072102|gb|EFE10211.1| periplasmic beta-glucosidase [Citrobacter youngae ATCC 29220] Length = 765 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTATMGKTMVEAMQGKSP 197 >gi|325956120|ref|YP_004286730.1| beta-N-acetylhexosaminidase [Lactobacillus acidophilus 30SC] gi|325332685|gb|ADZ06593.1| beta-N-acetylhexosaminidase [Lactobacillus acidophilus 30SC] Length = 584 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSR 37 A L + G+N N++P D P++FI + F Sbjct: 173 ATLLRSLGVNWNYAPDADYSDNPKSFI--YQRGFGG 206 >gi|329957143|ref|ZP_08297710.1| glycosyl hydrolase family 3 protein [Bacteroides clarus YIT 12056] gi|328523411|gb|EGF50510.1| glycosyl hydrolase family 3 protein [Bacteroides clarus YIT 12056] Length = 803 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 14/53 (26%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G ++P+LD++ P + + P Sbjct: 188 GQEAKALGYTNVYAPILDVVRDPR--WGRTLECYGEEPFLIAALGTEMVNGIQ 238 >gi|332884768|gb|EGK05024.1| hypothetical protein HMPREF9456_03177 [Dysgonomonas mossii DSM 22836] Length = 808 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 7/56 (12%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + ++ G ++ +P ++++ P + +S P + A +N Sbjct: 164 IGNEVLEYGSDIQLAPAINIMRNPLC--GRNYEYYSEDPLLTGKIAAAMINGIQEN 217 >gi|116629068|ref|YP_814240.1| Beta-glucosidase-related glycosidase [Lactobacillus gasseri ATCC 33323] gi|116094650|gb|ABJ59802.1| Beta-glucosidase-related glycosidase [Lactobacillus gasseri ATCC 33323] Length = 760 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ SG V F+P++D+++ + P ++ +N Sbjct: 137 AEEASASGNQVAFAPMVDVVHDAR--WGRVLESPGEDPYLNSVYSKNMVEGLQEN 189 >gi|291542938|emb|CBL16048.1| Beta-glucosidase-related glycosidases [Ruminococcus bromii L2-63] Length = 427 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 14/51 (27%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRT 52 A L++ GINVN +PV D+ F+ FS + T Sbjct: 192 ADLLLSLGINVNLAPVCDMTSDEYGFM--YDRSFSSDVDMENRYVRTVVET 240 >gi|170735455|ref|YP_001774569.1| glycoside hydrolase family 3 protein [Burkholderia cenocepacia MC0-3] gi|169821493|gb|ACA96074.1| glycoside hydrolase family 3 domain protein [Burkholderia cenocepacia MC0-3] Length = 346 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 9/49 (18%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Query: 6 VTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 G+N+ SP+ D++ G A A+ F + Sbjct: 125 RELGVNLFLSPIADVVVG-ANPW-LDGRHLGADAADVLRIARAFVQGVQ 171 >gi|257052239|ref|YP_003130072.1| glycoside hydrolase family 3 domain protein [Halorhabdus utahensis DSM 12940] gi|256691002|gb|ACV11339.1| glycoside hydrolase family 3 domain protein [Halorhabdus utahensis DSM 12940] Length = 762 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G + N +PV D+ + F P+ + R Y Sbjct: 154 ATEVAATGAHQNLNPVADVGREAR--WGRIYETFGESPSLCASMSAAAVRGYQ 204 >gi|261340566|ref|ZP_05968424.1| periplasmic beta-glucosidase [Enterobacter cancerogenus ATCC 35316] gi|288316974|gb|EFC55912.1| periplasmic beta-glucosidase [Enterobacter cancerogenus ATCC 35316] Length = 765 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTATMGKTMVEAMQGKSP 197 >gi|313204469|ref|YP_004043126.1| glycoside hydrolase family 3 domain protein [Paludibacter propionicigenes WB4] gi|312443785|gb|ADQ80141.1| glycoside hydrolase family 3 domain protein [Paludibacter propionicigenes WB4] Length = 786 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ GI FSP++D+ P + + A+ Y N Sbjct: 166 AQEATADGICWTFSPMVDVSRDPR--WGRVAEGSGEDVYLGSQIAKAMVHGYQGN 218 >gi|225012449|ref|ZP_03702885.1| glycoside hydrolase family 3 domain protein [Flavobacteria bacterium MS024-2A] gi|225003426|gb|EEG41400.1| glycoside hydrolase family 3 domain protein [Flavobacteria bacterium MS024-2A] Length = 655 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 14/53 (26%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 ++ GI V P+ D+ P F + + + Sbjct: 218 SEEYKALGIRVALGPMADIASEPRWTRING--TFGEDAFVNAKLTAAYIKGIQ 268 >gi|167765233|ref|ZP_02437346.1| hypothetical protein BACSTE_03621 [Bacteroides stercoris ATCC 43183] gi|167696861|gb|EDS13440.1| hypothetical protein BACSTE_03621 [Bacteroides stercoris ATCC 43183] Length = 818 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 14/53 (26%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G ++P+LD++ P + + P Sbjct: 203 GQEAKALGYTNVYAPILDIVRDPR--WGRTLECYGEEPYLIAALGTEMVNGIQ 253 >gi|313116897|ref|YP_004038021.1| beta-glucosidase-like glycosyl hydrolase [Halogeometricum borinquense DSM 11551] gi|312294849|gb|ADQ68885.1| beta-glucosidase-like glycosyl hydrolase [Halogeometricum borinquense DSM 11551] Length = 739 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 11/59 (18%), Positives = 18/59 (30%), Gaps = 5/59 (8%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI---KNP 57 + +G VN+ P D+ + + P E A +R NP Sbjct: 143 GREAAATGATVNYGPTCDVARDQR--WGRVFETYGESPYLCGELAAAEARGLRGSADNP 199 >gi|332828764|gb|EGK01456.1| hypothetical protein HMPREF9455_02289 [Dysgonomonas gadei ATCC BAA-286] Length = 775 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 20/56 (35%), Gaps = 8/56 (14%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSI---FSRIPAKAEESAQLFSRTYI 54 A+ GI SP +DL P + F PA + + A+ + + Sbjct: 229 AQEYRALGIGTALSPQIDLASEP-----RWYRASMTFGESPALSTDMARAYIDGFQ 279 >gi|241258654|ref|YP_002978538.1| glycoside hydrolase family 3 domain protein [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240863124|gb|ACS60787.1| glycoside hydrolase family 3 domain protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 780 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 8/56 (14%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A G+++ P +++ P + +S P + + A N Sbjct: 119 LAAECQDFGVHLVLGPGINIRRTPLA--GRAYEYYSEDPVISGDMAAAVICGLQDN 172 >gi|119479889|ref|XP_001259973.1| beta-glucosidase, putative [Neosartorya fischeri NRRL 181] gi|119408127|gb|EAW18076.1| beta-glucosidase, putative [Neosartorya fischeri NRRL 181] Length = 780 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ T G+ F+PV+DL + F P + E + + Sbjct: 162 AQEARTLGVTQIFAPVVDLARELR--FGRVEETFGEDPYLSGEMGYSYVKGLQ 212 >gi|295098160|emb|CBK87250.1| beta-glucosidase [Enterobacter cloacae subsp. cloacae NCTC 9394] Length = 765 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTATMGKTMVEAMQGKSP 197 >gi|299140913|ref|ZP_07034051.1| periplasmic beta-glucosidase [Prevotella oris C735] gi|298577879|gb|EFI49747.1| periplasmic beta-glucosidase [Prevotella oris C735] Length = 767 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A+ G ++P+LD+ P + +S P A E + +N Sbjct: 145 AQEASALGYTNVYAPILDVSRDPR--WGRVVECYSESPYLAGELGKQMVLGLQEN 197 >gi|116249013|ref|YP_764854.1| putative beta-glucosidase protein [Rhizobium leguminosarum bv. viciae 3841] gi|115253663|emb|CAK12056.1| putative beta-glucosidase protein [Rhizobium leguminosarum bv. viciae 3841] Length = 827 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G V +P +++ + +S P E A + + Sbjct: 83 LAQQAKSKGAAVLLAPTVNIHRSGLN--GRNFECYSEDPMLTAELAVAYIKGVQ 134 >gi|289450455|ref|YP_003474649.1| glycosyl hydrolase family 3 protein [Clostridiales genomosp. BVAB3 str. UPII9-5] gi|289185002|gb|ADC91427.1| glycosyl hydrolase family 3 [Clostridiales genomosp. BVAB3 str. UPII9-5] Length = 735 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 12/47 (25%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Query: 8 SGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 GIN +SP++DL+ P + P A R Y Sbjct: 138 CGINYVYSPMVDLVRDPR--WGRVAESAGEDPFLGSAIAAALVRGYQ 182 >gi|256393789|ref|YP_003115353.1| beta-glucosidase [Catenulispora acidiphila DSM 44928] gi|256360015|gb|ACU73512.1| Beta-glucosidase [Catenulispora acidiphila DSM 44928] Length = 1548 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 8/43 (18%), Positives = 14/43 (32%), Gaps = 2/43 (4%) Query: 14 FSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 ++P +++ P + F P A F Y N Sbjct: 193 WAPTVNMDRDPR--WGRTDEAFGEDPYLTSTMAGAFVNGYEGN 233 >gi|227432977|ref|ZP_03914913.1| conserved hypothetical protein [Leuconostoc mesenteroides subsp. cremoris ATCC 19254] gi|227351263|gb|EEJ41553.1| conserved hypothetical protein [Leuconostoc mesenteroides subsp. cremoris ATCC 19254] Length = 173 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+ V F+P+ DL+ P + P A + + Sbjct: 35 ASESAAGGVRVTFAPMTDLVRDPR--WGRVMESTGEDPYLNSVMAAASVKGFQ 85 >gi|229822521|ref|YP_002884047.1| glycoside hydrolase family 3 domain protein [Beutenbergia cavernae DSM 12333] gi|229568434|gb|ACQ82285.1| glycoside hydrolase family 3 domain protein [Beutenbergia cavernae DSM 12333] Length = 874 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 18/55 (32%), Gaps = 4/55 (7%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKR-SIFSRIPAKAEESAQLFSRTYI 54 MA G++V +PVL+L T + + FS P Sbjct: 109 MAAEAREKGVDVVLAPVLNLQR---TPVGGRHFECFSEDPTLVAAVGGRLIAAIQ 160 >gi|255029197|ref|ZP_05301148.1| hypothetical protein LmonL_08861 [Listeria monocytogenes LO28] Length = 467 Score = 35.9 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G+++ + LD+L P + + P A E + + Sbjct: 151 ITEEISEKGVHLALASALDVLRDPR--WGRAEECYGEDPYLAAELTAAITEGFQ 202 >gi|224502806|ref|ZP_03671113.1| hypothetical protein LmonFR_09834 [Listeria monocytogenes FSL R2-561] Length = 696 Score = 35.9 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G+++ + LD+L P + + P A E + + Sbjct: 151 ITEEISEKGVHLALASALDVLRDPR--WGRAEECYGEDPYLAAELTAAITEGFQ 202 >gi|16804818|ref|NP_466303.1| hypothetical protein lmo2781 [Listeria monocytogenes EGD-e] gi|16412281|emb|CAD00994.1| lmo2781 [Listeria monocytogenes EGD-e] Length = 756 Score = 35.9 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G+++ + LD+L P + + P A E + + Sbjct: 151 ITEEISEKGVHLALASALDVLRDPR--WGRAEECYGEDPYLAAELTAAITEGFQ 202 >gi|294637165|ref|ZP_06715473.1| periplasmic beta-glucosidase [Edwardsiella tarda ATCC 23685] gi|291089629|gb|EFE22190.1| periplasmic beta-glucosidase [Edwardsiella tarda ATCC 23685] Length = 767 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N+ ++P++D+ P + F E +L Sbjct: 145 AYEASEDGLNMTWAPMVDVTRDPR--WGRTSEGFGEDTYLTSEMGRLMVEAMQ 195 >gi|302187765|ref|ZP_07264438.1| beta-glucosidase [Pseudomonas syringae pv. syringae 642] Length = 765 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 143 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 196 >gi|91217267|ref|ZP_01254228.1| periplasmic beta-glucosidase precursor [Psychroflexus torquis ATCC 700755] gi|91184610|gb|EAS70992.1| periplasmic beta-glucosidase precursor [Psychroflexus torquis ATCC 700755] Length = 758 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/46 (19%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 GIN F+P++D+ + P E A+ + + Sbjct: 156 GINWTFAPMVDISRDAR--WGRVMEGAGEDPFLGSEIAKARIQGFQ 199 >gi|171687205|ref|XP_001908543.1| hypothetical protein [Podospora anserina S mat+] gi|170943564|emb|CAP69216.1| unnamed protein product [Podospora anserina S mat+] Length = 914 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 8/57 (14%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKR-SIFSRIPAKAEESAQLFSRTYIKN 56 +A+ N+ +P + + + + FS P + A + + +N Sbjct: 161 LAEEAKARQANILLAPTVCMHR---HPLGGRNFESFSEDPLLTGKLAAQYIQGLQEN 214 >gi|315921654|ref|ZP_07917894.1| periplasmic beta-glucosidase [Bacteroides sp. D2] gi|313695529|gb|EFS32364.1| periplasmic beta-glucosidase [Bacteroides sp. D2] Length = 950 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + V + +SPVLD+ + + F P + + + Y Sbjct: 250 IGDETVAANTKQAWSPVLDV--AQDARWGRCEETFGEDPVLVSQIGGAWIKGYQ 301 >gi|313157978|gb|EFR57384.1| putative beta-glucosidase [Alistipes sp. HGB5] Length = 824 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ G+++ P +++ P + F P A E+A + Sbjct: 105 LGQDARARGVHIMLGPGVNIYRSPLC--GRNFEYFGEDPYLASETAVQYIEGMQ 156 >gi|299149395|ref|ZP_07042452.1| periplasmic beta-glucosidase [Bacteroides sp. 3_1_23] gi|298512582|gb|EFI36474.1| periplasmic beta-glucosidase [Bacteroides sp. 3_1_23] Length = 950 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + V + +SPVLD+ + + F P + + + Y Sbjct: 250 IGDETVAANTKQAWSPVLDV--AQDARWGRCEETFGEDPVLVSQIGGAWIKGYQ 301 >gi|298387489|ref|ZP_06997041.1| periplasmic beta-glucosidase [Bacteroides sp. 1_1_14] gi|298259696|gb|EFI02568.1| periplasmic beta-glucosidase [Bacteroides sp. 1_1_14] Length = 950 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + V + +SPVLD+ + + F P + + + Y Sbjct: 250 IGDETVAANTKQAWSPVLDV--AQDARWGRCEETFGEDPVLVSQIGGAWIKGYQ 301 >gi|291514786|emb|CBK63996.1| Beta-glucosidase-related glycosidases [Alistipes shahii WAL 8301] Length = 733 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/52 (17%), Positives = 15/52 (28%), Gaps = 3/52 (5%) Query: 6 VTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 SG+ FSP++D+ + + P Y N Sbjct: 151 RMSGVEWTFSPMIDVARDGR--WGRVSEGYGEDPYANAVYGVAAVEGYQGDN 200 >gi|260173382|ref|ZP_05759794.1| periplasmic beta-glucosidase precursor [Bacteroides sp. D2] Length = 954 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + V + +SPVLD+ + + F P + + + Y Sbjct: 254 IGDETVAANTKQAWSPVLDV--AQDARWGRCEETFGEDPVLVSQIGGAWIKGYQ 305 >gi|229588928|ref|YP_002871047.1| periplasmic beta-glucosidase [Pseudomonas fluorescens SBW25] gi|229360794|emb|CAY47652.1| periplasmic beta-glucosidase precursor [Pseudomonas fluorescens SBW25] Length = 763 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ +++ F+P++D+ P + F A++ + + Sbjct: 138 AQEAAADSLDITFAPMVDISRDPR--WGRTSEGFGEDTYLVSRIAEVMVKAFQ 188 >gi|29347190|ref|NP_810693.1| periplasmic beta-glucosidase [Bacteroides thetaiotaomicron VPI-5482] gi|253571928|ref|ZP_04849333.1| periplasmic beta-glucosidase [Bacteroides sp. 1_1_6] gi|29339089|gb|AAO76887.1| periplasmic beta-glucosidase precursor [Bacteroides thetaiotaomicron VPI-5482] gi|251838525|gb|EES66611.1| periplasmic beta-glucosidase [Bacteroides sp. 1_1_6] Length = 950 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + V + +SPVLD+ + + F P + + + Y Sbjct: 250 IGDETVAANTKQAWSPVLDV--AQDARWGRCEETFGEDPVLVSQIGGAWIKGYQ 301 >gi|330973508|gb|EGH73574.1| beta-D-glucoside glucohydrolase [Pseudomonas syringae pv. aceris str. M302273PT] Length = 765 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 143 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 196 >gi|289617044|emb|CBI56271.1| unnamed protein product [Sordaria macrospora] Length = 885 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 8/57 (14%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKR-SIFSRIPAKAEESAQLFSRTYIKN 56 +A+ N+ +P + + + + FS P + A + + +N Sbjct: 138 LAEEAKARQANILLAPTVCMHR---HPLGGRNFESFSEDPLLTGKLAAQYIKGLQEN 191 >gi|300777062|ref|ZP_07086920.1| beta-glucosidase [Chryseobacterium gleum ATCC 35910] gi|300502572|gb|EFK33712.1| beta-glucosidase [Chryseobacterium gleum ATCC 35910] Length = 775 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ + GIN FSP++D+ P + P E ++ Y Sbjct: 151 AREAASDGINWTFSPMVDISREPR--WGRVSEGSGEDPYLGSEISKNMVYGYQ 201 >gi|121712846|ref|XP_001274034.1| beta-glucosidase, putative [Aspergillus clavatus NRRL 1] gi|119402187|gb|EAW12608.1| beta-glucosidase, putative [Aspergillus clavatus NRRL 1] Length = 780 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G+N F+PV+DL + FS P + E + + Sbjct: 162 GQEARALGVNQIFAPVVDLARELR--FGRVEETFSEDPYLSGEIGYSYVKGIQ 212 >gi|2921740|gb|AAC38196.1| cellobiase [Cellulomonas biazotea] Length = 828 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ + I+V P ++L + +S P A + R Sbjct: 89 LAEEALAQQIHVVLGPTINLHRSVLG--GRLFEAYSEDPLLTGRLAAAYVRGLQD 141 >gi|332278714|ref|ZP_08391127.1| conserved hypothetical protein [Shigella sp. D9] gi|332101066|gb|EGJ04412.1| conserved hypothetical protein [Shigella sp. D9] Length = 789 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 167 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 221 >gi|332093254|gb|EGI98314.1| periplasmic beta-glucosidase [Shigella boydii 5216-82] Length = 755 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 133 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 187 >gi|331018042|gb|EGH98098.1| beta-D-glucoside glucohydrolase [Pseudomonas syringae pv. lachrymans str. M302278PT] Length = 765 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 143 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 196 >gi|323184244|gb|EFZ69621.1| periplasmic beta-glucosidase [Escherichia coli 1357] Length = 765 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 197 >gi|323168731|gb|EFZ54411.1| periplasmic beta-glucosidase domain protein [Shigella sonnei 53G] Length = 415 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 133 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 187 >gi|320184843|gb|EFW59633.1| Periplasmic beta-glucosidase [Shigella flexneri CDC 796-83] Length = 755 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 133 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 187 >gi|309702446|emb|CBJ01772.1| periplasmic beta-glucosidase [Escherichia coli ETEC H10407] Length = 765 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 197 >gi|300948231|ref|ZP_07162352.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 116-1] gi|300452237|gb|EFK15857.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 116-1] Length = 789 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 167 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 221 >gi|300818868|ref|ZP_07099073.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 107-1] gi|300902218|ref|ZP_07120218.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 84-1] gi|300924493|ref|ZP_07140462.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 182-1] gi|301305176|ref|ZP_07211275.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 124-1] gi|301325242|ref|ZP_07218760.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 78-1] gi|300405737|gb|EFJ89275.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 84-1] gi|300419302|gb|EFK02613.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 182-1] gi|300528487|gb|EFK49549.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 107-1] gi|300839580|gb|EFK67340.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 124-1] gi|300847902|gb|EFK75662.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 78-1] gi|315255355|gb|EFU35323.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 85-1] gi|324015918|gb|EGB85137.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 117-3] Length = 789 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 167 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 221 >gi|300901249|ref|ZP_07119350.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 198-1] gi|300355323|gb|EFJ71193.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 198-1] Length = 789 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 167 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 221 >gi|218705661|ref|YP_002413180.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli UMN026] gi|293405601|ref|ZP_06649593.1| periplasmic beta-glucosidase [Escherichia coli FVEC1412] gi|298381283|ref|ZP_06990882.1| periplasmic beta-glucosidase [Escherichia coli FVEC1302] gi|218432758|emb|CAR13652.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli UMN026] gi|284922118|emb|CBG35199.1| periplasmic beta-glucosidase [Escherichia coli 042] gi|291427809|gb|EFF00836.1| periplasmic beta-glucosidase [Escherichia coli FVEC1412] gi|298278725|gb|EFI20239.1| periplasmic beta-glucosidase [Escherichia coli FVEC1302] Length = 765 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 197 >gi|218695744|ref|YP_002403411.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli 55989] gi|218352476|emb|CAU98253.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli 55989] Length = 765 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 197 >gi|194431481|ref|ZP_03063773.1| beta-glucosidase, periplasmic [Shigella dysenteriae 1012] gi|194420306|gb|EDX36383.1| beta-glucosidase, periplasmic [Shigella dysenteriae 1012] gi|320178921|gb|EFW53884.1| Periplasmic beta-glucosidase [Shigella boydii ATCC 9905] Length = 787 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 165 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 219 >gi|187734005|ref|YP_001879540.1| beta-glucosidase, periplasmic [Shigella boydii CDC 3083-94] gi|187430997|gb|ACD10271.1| beta-glucosidase, periplasmic [Shigella boydii CDC 3083-94] Length = 765 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 197 >gi|300821764|ref|ZP_07101909.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 119-7] gi|300917029|ref|ZP_07133724.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 115-1] gi|300929307|ref|ZP_07144781.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 187-1] gi|309793010|ref|ZP_07687438.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 145-7] gi|331678081|ref|ZP_08378756.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Escherichia coli H591] gi|300415704|gb|EFJ99014.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 115-1] gi|300462726|gb|EFK26219.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 187-1] gi|300525606|gb|EFK46675.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 119-7] gi|308123296|gb|EFO60558.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 145-7] gi|331074541|gb|EGI45861.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Escherichia coli H591] Length = 789 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 167 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 221 >gi|146299324|ref|YP_001193915.1| glycoside hydrolase family 3 protein [Flavobacterium johnsoniae UW101] gi|146153742|gb|ABQ04596.1| Candidate beta-glycosidase; Glycoside hydrolase family 3 [Flavobacterium johnsoniae UW101] Length = 755 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A S I FSP LD P ++ F + + A + N Sbjct: 159 AYETRASSIPWVFSPDLDFPRNPA--WSRMWESFGEDAYLSSKMAVALVDGFEGN 211 >gi|332092627|gb|EGI97698.1| periplasmic beta-glucosidase [Shigella dysenteriae 155-74] Length = 765 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 197 >gi|320176631|gb|EFW51673.1| Periplasmic beta-glucosidase [Shigella dysenteriae CDC 74-1112] Length = 755 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 133 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 187 >gi|293446483|ref|ZP_06662905.1| beta-glucosidase [Escherichia coli B088] gi|307311288|ref|ZP_07590932.1| glycoside hydrolase family 3 domain protein [Escherichia coli W] gi|291323313|gb|EFE62741.1| beta-glucosidase [Escherichia coli B088] gi|306908794|gb|EFN39291.1| glycoside hydrolase family 3 domain protein [Escherichia coli W] Length = 755 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 133 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 187 >gi|82543548|ref|YP_407495.1| beta-D-glucoside glucohydrolase, periplasmic [Shigella boydii Sb227] gi|81244959|gb|ABB65667.1| beta-D-glucoside glucohydrolase, periplasmic [Shigella boydii Sb227] gi|332097401|gb|EGJ02381.1| periplasmic beta-glucosidase [Shigella boydii 3594-74] Length = 765 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 197 >gi|82777386|ref|YP_403735.1| beta-D-glucoside glucohydrolase, periplasmic [Shigella dysenteriae Sd197] gi|309788010|ref|ZP_07682619.1| periplasmic beta-glucosidase [Shigella dysenteriae 1617] gi|81241534|gb|ABB62244.1| beta-D-glucoside glucohydrolase, periplasmic [Shigella dysenteriae Sd197] gi|308924144|gb|EFP69642.1| periplasmic beta-glucosidase [Shigella dysenteriae 1617] Length = 765 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 197 >gi|74312656|ref|YP_311075.1| beta-D-glucoside glucohydrolase, periplasmic [Shigella sonnei Ss046] gi|73856133|gb|AAZ88840.1| beta-D-glucoside glucohydrolase, periplasmic [Shigella sonnei Ss046] Length = 765 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 197 >gi|300955846|ref|ZP_07168187.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 175-1] gi|405863|gb|AAA60495.1| yohA [Escherichia coli] gi|300317313|gb|EFJ67097.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 175-1] gi|744170|prf||2014253AD beta-glucosidase Length = 789 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 167 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 221 >gi|170019550|ref|YP_001724504.1| glycoside hydrolase family 3 protein [Escherichia coli ATCC 8739] gi|194436057|ref|ZP_03068159.1| beta-glucosidase, periplasmic [Escherichia coli 101-1] gi|253772940|ref|YP_003035771.1| glycoside hydrolase [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|254162147|ref|YP_003045255.1| beta-D-glucoside glucohydrolase [Escherichia coli B str. REL606] gi|297518468|ref|ZP_06936854.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli OP50] gi|301029467|ref|ZP_07192554.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 196-1] gi|312973618|ref|ZP_07787790.1| periplasmic beta-glucosidase [Escherichia coli 1827-70] gi|331663629|ref|ZP_08364539.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Escherichia coli TA143] gi|331668831|ref|ZP_08369679.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Escherichia coli TA271] gi|331673657|ref|ZP_08374420.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Escherichia coli TA280] gi|169754478|gb|ACA77177.1| glycoside hydrolase family 3 domain protein [Escherichia coli ATCC 8739] gi|194424785|gb|EDX40770.1| beta-glucosidase, periplasmic [Escherichia coli 101-1] gi|242377774|emb|CAQ32537.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli BL21(DE3)] gi|253323984|gb|ACT28586.1| glycoside hydrolase family 3 domain protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|253974048|gb|ACT39719.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli B str. REL606] gi|253978216|gb|ACT43886.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli BL21(DE3)] gi|299877670|gb|EFI85881.1| glycosyl hydrolase family 3 protein [Escherichia coli MS 196-1] gi|310332213|gb|EFP99448.1| periplasmic beta-glucosidase [Escherichia coli 1827-70] gi|320199726|gb|EFW74315.1| Periplasmic beta-glucosidase [Escherichia coli EC4100B] gi|323171784|gb|EFZ57428.1| periplasmic beta-glucosidase [Escherichia coli LT-68] gi|323961640|gb|EGB57245.1| glycosyl hydrolase 3 domain-containing protein [Escherichia coli H489] gi|323972884|gb|EGB68082.1| glycosyl hydrolase 3 domain-containing protein [Escherichia coli TA007] gi|331059428|gb|EGI31405.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Escherichia coli TA143] gi|331064025|gb|EGI35936.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Escherichia coli TA271] gi|331068930|gb|EGI40322.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Escherichia coli TA280] Length = 765 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 197 >gi|157154880|ref|YP_001463478.1| beta-glucosidase, periplasmic [Escherichia coli E24377A] gi|191165415|ref|ZP_03027257.1| beta-glucosidase, periplasmic [Escherichia coli B7A] gi|193062306|ref|ZP_03043401.1| beta-glucosidase, periplasmic [Escherichia coli E22] gi|193070494|ref|ZP_03051434.1| beta-glucosidase, periplasmic [Escherichia coli E110019] gi|194427113|ref|ZP_03059664.1| beta-glucosidase, periplasmic [Escherichia coli B171] gi|209919591|ref|YP_002293675.1| beta-D-glucoside glucohydrolase [Escherichia coli SE11] gi|218554698|ref|YP_002387611.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli IAI1] gi|256017700|ref|ZP_05431565.1| beta-D-glucoside glucohydrolase, periplasmic [Shigella sp. D9] gi|260844739|ref|YP_003222517.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli O103:H2 str. 12009] gi|260856106|ref|YP_003229997.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli O26:H11 str. 11368] gi|260868835|ref|YP_003235237.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli O111:H- str. 11128] gi|331653559|ref|ZP_08354560.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Escherichia coli M718] gi|157076910|gb|ABV16618.1| beta-glucosidase, periplasmic [Escherichia coli E24377A] gi|190904578|gb|EDV64285.1| beta-glucosidase, periplasmic [Escherichia coli B7A] gi|192931972|gb|EDV84571.1| beta-glucosidase, periplasmic [Escherichia coli E22] gi|192956188|gb|EDV86651.1| beta-glucosidase, periplasmic [Escherichia coli E110019] gi|194414734|gb|EDX31005.1| beta-glucosidase, periplasmic [Escherichia coli B171] gi|209912850|dbj|BAG77924.1| beta-D-glucoside glucohydrolase [Escherichia coli SE11] gi|218361466|emb|CAQ99055.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli IAI1] gi|257754755|dbj|BAI26257.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli O26:H11 str. 11368] gi|257759886|dbj|BAI31383.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli O103:H2 str. 12009] gi|257765191|dbj|BAI36686.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli O111:H- str. 11128] gi|315061443|gb|ADT75770.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli W] gi|323152359|gb|EFZ38648.1| periplasmic beta-glucosidase [Escherichia coli EPECa14] gi|323161760|gb|EFZ47641.1| periplasmic beta-glucosidase [Escherichia coli E128010] gi|323176973|gb|EFZ62563.1| periplasmic beta-glucosidase [Escherichia coli 1180] gi|323377976|gb|ADX50244.1| glycoside hydrolase family 3 domain protein [Escherichia coli KO11] gi|323944949|gb|EGB41014.1| glycosyl hydrolase 3 domain-containing protein [Escherichia coli H120] gi|324118027|gb|EGC11926.1| glycosyl hydrolase 3 domain-containing protein [Escherichia coli E1167] gi|331048408|gb|EGI20484.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Escherichia coli M718] Length = 765 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 197 >gi|16130070|ref|NP_416636.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli str. K-12 substr. MG1655] gi|89108949|ref|AP_002729.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli str. K-12 substr. W3110] gi|157161614|ref|YP_001458932.1| beta-glucosidase, periplasmic [Escherichia coli HS] gi|170081755|ref|YP_001731075.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli str. K-12 substr. DH10B] gi|188494437|ref|ZP_03001707.1| glycosyl hydrolase, family 3 [Escherichia coli 53638] gi|238901316|ref|YP_002927112.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli BW2952] gi|728965|sp|P33363|BGLX_ECOLI RecName: Full=Periplasmic beta-glucosidase; AltName: Full=Beta-D-glucoside glucohydrolase; AltName: Full=Cellobiase; AltName: Full=Gentiobiase; Flags: Precursor gi|555956|gb|AAB38487.1| beta-glucosidase precursor [Escherichia coli str. K-12 substr. W3110] gi|1788453|gb|AAC75193.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli str. K-12 substr. MG1655] gi|85675246|dbj|BAE76609.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli str. K12 substr. W3110] gi|157067294|gb|ABV06549.1| beta-glucosidase, periplasmic [Escherichia coli HS] gi|169889590|gb|ACB03297.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli str. K-12 substr. DH10B] gi|188489636|gb|EDU64739.1| glycosyl hydrolase, family 3 [Escherichia coli 53638] gi|238860057|gb|ACR62055.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli BW2952] gi|260448772|gb|ACX39194.1| glycoside hydrolase family 3 domain protein [Escherichia coli DH1] gi|315136765|dbj|BAJ43924.1| beta-D-glucoside glucohydrolase, periplasmic [Escherichia coli DH1] gi|323940799|gb|EGB36987.1| glycosyl hydrolase 3 domain-containing protein [Escherichia coli E482] gi|332343909|gb|AEE57243.1| periplasmic beta-glucosidase [Escherichia coli UMNK88] Length = 765 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 197 >gi|332668373|ref|YP_004451161.1| beta-glucosidase [Haliscomenobacter hydrossis DSM 1100] gi|332337187|gb|AEE54288.1| Beta-glucosidase [Haliscomenobacter hydrossis DSM 1100] Length = 767 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI FSP++D+ P + P + A+ + Y Sbjct: 144 AIEASADGICWTFSPMVDIARDPR--WGRIAEGSGEDPYLGSQIARAMVKGYQ 194 >gi|189464325|ref|ZP_03013110.1| hypothetical protein BACINT_00666 [Bacteroides intestinalis DSM 17393] gi|189438115|gb|EDV07100.1| hypothetical protein BACINT_00666 [Bacteroides intestinalis DSM 17393] Length = 935 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +++G +SPVLD+ + + F P + + + Y Sbjct: 236 GDETLSAGTMQAWSPVLDV--AQDARWGRCEETFGEDPVLVSQIGGAWIKGYQ 286 >gi|289677876|ref|ZP_06498766.1| glycoside hydrolase family protein [Pseudomonas syringae pv. syringae FF5] gi|330937709|gb|EGH41607.1| beta-D-glucoside glucohydrolase [Pseudomonas syringae pv. pisi str. 1704B] gi|330981496|gb|EGH79599.1| beta-D-glucoside glucohydrolase [Pseudomonas syringae pv. aptata str. DSM 50252] Length = 765 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 143 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 196 >gi|28871427|ref|NP_794046.1| beta-glucosidase [Pseudomonas syringae pv. tomato str. DC3000] gi|213970252|ref|ZP_03398382.1| beta-glucosidase [Pseudomonas syringae pv. tomato T1] gi|301382910|ref|ZP_07231328.1| beta-glucosidase [Pseudomonas syringae pv. tomato Max13] gi|302059265|ref|ZP_07250806.1| beta-glucosidase [Pseudomonas syringae pv. tomato K40] gi|302131071|ref|ZP_07257061.1| beta-glucosidase [Pseudomonas syringae pv. tomato NCPPB 1108] gi|28854678|gb|AAO57741.1| beta-glucosidase [Pseudomonas syringae pv. tomato str. DC3000] gi|213924924|gb|EEB58489.1| beta-glucosidase [Pseudomonas syringae pv. tomato T1] Length = 765 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 143 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 196 >gi|66047220|ref|YP_237061.1| glycoside hydrolase family protein [Pseudomonas syringae pv. syringae B728a] gi|63257927|gb|AAY39023.1| Glycoside hydrolase, family 3, N-terminal:Glycoside hydrolase, family 3, C-terminal [Pseudomonas syringae pv. syringae B728a] Length = 753 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 131 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 184 >gi|116686693|ref|YP_839940.1| glycoside hydrolase family 3 protein [Burkholderia cenocepacia HI2424] gi|116652408|gb|ABK13047.1| glycoside hydrolase, family 3 domain protein [Burkholderia cenocepacia HI2424] Length = 346 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 9/49 (18%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Query: 6 VTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 G+N+ SP+ D++ G A A+ F + Sbjct: 125 RELGVNLFLSPIADVVVG-ANPW-LDGRHLGADAADVLRIARAFVQGVQ 171 >gi|107023066|ref|YP_621393.1| glycoside hydrolase family protein [Burkholderia cenocepacia AU 1054] gi|105893255|gb|ABF76420.1| glycoside hydrolase, family 3-like protein [Burkholderia cenocepacia AU 1054] Length = 379 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 9/49 (18%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Query: 6 VTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 G+N+ SP+ D++ G A A+ F + Sbjct: 125 RELGVNLFLSPIADVVVG-ANPW-LDGRHLGADAADVLRIARAFVQGVQ 171 >gi|322831259|ref|YP_004211286.1| glycoside hydrolase family 3 domain protein [Rahnella sp. Y9602] gi|321166460|gb|ADW72159.1| glycoside hydrolase family 3 domain protein [Rahnella sp. Y9602] Length = 765 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ G+N+ FSP++D+ P + F A Y Sbjct: 143 AQETAADGLNMTFSPMVDITRDPR--WGRVSEGFGEDTYLTSRLAHEMVTGYQ 193 >gi|315498613|ref|YP_004087417.1| glycoside hydrolase family 3 domain protein [Asticcacaulis excentricus CB 48] gi|315416625|gb|ADU13266.1| glycoside hydrolase family 3 domain protein [Asticcacaulis excentricus CB 48] Length = 794 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 8/52 (15%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 AK + G N+ +PV+D+ P + + + + Sbjct: 186 AKEMRARGANLALAPVVDVCREPR--WGRVEETYGEDTHLMGVMGKAAVLGF 235 >gi|323936747|gb|EGB33032.1| glycosyl hydrolase 3 domain-containing protein [Escherichia coli E1520] Length = 448 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 167 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTSTMGKTMVEAMQGKSP 221 >gi|237728562|ref|ZP_04559043.1| beta-glucosidase [Citrobacter sp. 30_2] gi|226910040|gb|EEH95958.1| beta-glucosidase [Citrobacter sp. 30_2] Length = 657 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 11/63 (17%), Positives = 18/63 (28%), Gaps = 7/63 (11%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK----- 55 + + GI SP D+ P F P A + + + Sbjct: 203 IGQEYRAVGITEALSPQADIATEPRWARISG--TFGEDPELARKLVRGYITGMQNGTQGL 260 Query: 56 NPK 58 NP+ Sbjct: 261 NPQ 263 >gi|15232711|ref|NP_190288.1| glycosyl hydrolase family 3 protein [Arabidopsis thaliana] gi|6522585|emb|CAB61950.1| beta-D-glucan exohydrolase-like protein [Arabidopsis thaliana] gi|332644714|gb|AEE78235.1| Glycosyl hydrolase family protein [Arabidopsis thaliana] Length = 636 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 9/46 (19%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQ 47 A + G + F+P + L P + +S P E + Sbjct: 162 ALEVRACGAHWAFAPCVAALRDPR--WGRSYESYSEDPDIICELSS 205 >gi|188581694|ref|YP_001925139.1| glycoside hydrolase family 3 domain protein [Methylobacterium populi BJ001] gi|179345192|gb|ACB80604.1| glycoside hydrolase family 3 domain protein [Methylobacterium populi BJ001] Length = 742 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 14/54 (25%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + G+N FSP+ D+ + P + + Sbjct: 132 GRESAVIGLNWTFSPMADVARDLR--WGRVVEGLGEDPWLTGQLTAAQVEGFRD 183 >gi|110638664|ref|YP_678873.1| b-glucosidase [Cytophaga hutchinsonii ATCC 33406] gi|110281345|gb|ABG59531.1| b-glucosidase, glycoside hydrolase family 3 protein [Cytophaga hutchinsonii ATCC 33406] Length = 758 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 9/50 (18%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSR 51 + + G+ NF+PVLD+ P + ++ F + + Sbjct: 164 STEARSVGLTWNFAPVLDVGREP--YWSRFEETFGEDVYITTQMGSAAVQ 211 >gi|330996450|ref|ZP_08320332.1| glycosyl hydrolase family 3 protein [Paraprevotella xylaniphila YIT 11841] gi|329573006|gb|EGG54625.1| glycosyl hydrolase family 3 protein [Paraprevotella xylaniphila YIT 11841] Length = 757 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + GI PVLD+ + F P E F R Sbjct: 146 IGREAHVIGIRQLQCPVLDIARELR--WGRVEETFGEDPFLIGEMGTSFVRGSQ 197 >gi|330957854|gb|EGH58114.1| beta-D-glucoside glucohydrolase [Pseudomonas syringae pv. maculicola str. ES4326] Length = 765 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 143 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 196 >gi|330950101|gb|EGH50361.1| beta-D-glucoside glucohydrolase [Pseudomonas syringae Cit 7] Length = 752 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 130 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 183 >gi|312959511|ref|ZP_07774028.1| periplasmic beta-glucosidase [Pseudomonas fluorescens WH6] gi|311286228|gb|EFQ64792.1| periplasmic beta-glucosidase [Pseudomonas fluorescens WH6] Length = 763 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ +++ F+P++D+ P + F A++ + + Sbjct: 138 AQEAAADSLDITFAPMVDISRDPR--WGRTSEGFGEDTYLVSRIAEVMVKAFQ 188 >gi|320592477|gb|EFX04907.1| beta-glucosidase-like glycosyl hydrolase [Grosmannia clavigera kw1407] Length = 799 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + T GI+ P +++ P + +S P + A Sbjct: 131 LGRECRTMGIHTLLGPGINIRRTPLA--GRSYEYYSEDPLLTGKLAAAVITGIQD 183 >gi|298488636|ref|ZP_07006666.1| Periplasmic beta-glucosidase [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] gi|298156977|gb|EFH98067.1| Periplasmic beta-glucosidase [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] Length = 765 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 143 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 196 >gi|289625655|ref|ZP_06458609.1| beta-glucosidase [Pseudomonas syringae pv. aesculi str. NCPPB3681] gi|330868795|gb|EGH03504.1| beta-D-glucoside glucohydrolase [Pseudomonas syringae pv. aesculi str. 0893_23] Length = 765 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 143 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 196 >gi|257486468|ref|ZP_05640509.1| beta-glucosidase [Pseudomonas syringae pv. tabaci ATCC 11528] gi|330987806|gb|EGH85909.1| beta-D-glucoside glucohydrolase [Pseudomonas syringae pv. lachrymans str. M301315] gi|331009954|gb|EGH90010.1| beta-D-glucoside glucohydrolase [Pseudomonas syringae pv. tabaci ATCC 11528] Length = 765 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 143 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 196 >gi|71733626|ref|YP_276131.1| beta-glucosidase [Pseudomonas syringae pv. phaseolicola 1448A] gi|71554179|gb|AAZ33390.1| beta-glucosidase [Pseudomonas syringae pv. phaseolicola 1448A] Length = 764 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 142 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 195 >gi|308186142|ref|YP_003930273.1| beta-D-glucoside glucohydrolase, periplasmic [Pantoea vagans C9-1] gi|308056652|gb|ADO08824.1| beta-D-glucoside glucohydrolase, periplasmic [Pantoea vagans C9-1] Length = 737 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N+ ++P++D+ P + F E + + Sbjct: 115 AYEAADDGLNMTWAPMVDVSREPR--WGRGSEGFGEDTYLTSEMGRSMVQAMQ 165 >gi|114571270|ref|YP_757950.1| exo-1,4-beta-glucosidase [Maricaulis maris MCS10] gi|114341732|gb|ABI67012.1| exo-1,4-beta-glucosidase [Maricaulis maris MCS10] Length = 856 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A+ L SG + F+P L + + FS PA + P Sbjct: 196 ARELSVSGHDWTFAPTLAVPRDDR--WGRTYEGFSEDPAIVAAYGERIVWGLQGRP 249 >gi|330888462|gb|EGH21123.1| beta-D-glucoside glucohydrolase [Pseudomonas syringae pv. mori str. 301020] Length = 765 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 143 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 196 >gi|323344052|ref|ZP_08084278.1| beta-glucosidase [Prevotella oralis ATCC 33269] gi|323094781|gb|EFZ37356.1| beta-glucosidase [Prevotella oralis ATCC 33269] Length = 779 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +AK + G ++++ PVLDL + P ++ P + A + Sbjct: 173 IAKEIRLQGGHISYGPVLDLAHEPR--WSRVEETMGEDPVLSGTIAVAQVKGL 223 >gi|320325518|gb|EFW81580.1| beta-glucosidase [Pseudomonas syringae pv. glycinea str. B076] gi|330880797|gb|EGH14946.1| beta-D-glucoside glucohydrolase [Pseudomonas syringae pv. glycinea str. race 4] Length = 764 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 142 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 195 >gi|291551113|emb|CBL27375.1| Beta-glucosidase-related glycosidases [Ruminococcus torques L2-14] Length = 222 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ VT G+NV P L++ P + FS P A + A + R Sbjct: 92 LAEEAVTMGVNVILGPGLNIKRSPLC--GRNFEYFSEDPYHAGKMAAAYVRGIQ 143 >gi|145519826|ref|XP_001445774.1| hypothetical protein [Paramecium tetraurelia strain d4-2] gi|124413240|emb|CAK78377.1| unnamed protein product [Paramecium tetraurelia] Length = 979 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 11/51 (21%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSR 51 M +++ SG N FSP + + + P+ + K +E ++ F Sbjct: 170 MRDSVIESGFNFVFSPTVAVSHNPQ--WGRFYETLGDDTTKVKEYSKAFVE 218 >gi|283554629|gb|ACZ66247.2| beta-glycosidase [Terrabacter ginsenosidimutans] Length = 648 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Query: 1 MAK-NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ V GI P LDL P A++ F + P E + + + Sbjct: 205 IARQEYVAVGIRAALHPTLDLATEPR--WARQAGTFGQDPDLVTELGVAYLKGFQ 257 >gi|282861300|ref|ZP_06270365.1| glycoside hydrolase family 3 domain protein [Streptomyces sp. ACTE] gi|282563958|gb|EFB69495.1| glycoside hydrolase family 3 domain protein [Streptomyces sp. ACTE] Length = 1028 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 7/55 (12%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A + +G+ +F+P + + + + PA E + + Sbjct: 479 ANEVRATGVPWDFAPCVCVTRDER--WGRSYEAYGEDPALVEAM-ETVITGMQGH 530 >gi|227510048|ref|ZP_03940097.1| beta-glucosidase [Lactobacillus brevis subsp. gravesensis ATCC 27305] gi|227190427|gb|EEI70494.1| beta-glucosidase [Lactobacillus brevis subsp. gravesensis ATCC 27305] Length = 822 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 6/54 (11%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + +++ P +++ P + FS P A + + Sbjct: 121 IGQEARSLNVDMVLGPGINIKRNPLC--GRNFEYFSEDPYLAGTIGAAWIKGLQ 172 >gi|330898457|gb|EGH29876.1| beta-D-glucoside glucohydrolase [Pseudomonas syringae pv. japonica str. M301072PT] Length = 674 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 143 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 196 >gi|320327194|gb|EFW83208.1| beta-glucosidase [Pseudomonas syringae pv. glycinea str. race 4] Length = 752 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 130 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 183 >gi|289648216|ref|ZP_06479559.1| beta-glucosidase [Pseudomonas syringae pv. aesculi str. 2250] Length = 753 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 AK I++ F+P++D+ P + F + + R++ KN Sbjct: 131 AKEASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 184 >gi|124359290|gb|ABN05788.1| Glycoside hydrolase, family 3, N-terminal [Medicago truncatula] Length = 465 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI F+P + + P + +S+ P + ++ Sbjct: 151 ALEVRATGIQYVFAPCVAVCRNPR--WGRCYESYSQDPKIVQAMTEI-ISGLQ 200 >gi|227512978|ref|ZP_03943027.1| beta-glucosidase [Lactobacillus buchneri ATCC 11577] gi|227083735|gb|EEI19047.1| beta-glucosidase [Lactobacillus buchneri ATCC 11577] Length = 822 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 6/54 (11%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + +++ P +++ P + FS P A + + Sbjct: 121 IGQEARSLNVDMVLGPGINIKRNPLC--GRNFEYFSEDPYLAGTIGAAWIKGLQ 172 >gi|319900331|ref|YP_004160059.1| beta-glucosidase [Bacteroides helcogenes P 36-108] gi|319415362|gb|ADV42473.1| beta-glucosidase [Bacteroides helcogenes P 36-108] Length = 765 Score = 35.5 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M ++ G++V +P +++ P + +S P + A F R Sbjct: 133 MGNEILEYGVDVILAPGMNIHRSPLC--GRNYEYYSEDPVVTGKIAAAFVRGIQ 184 >gi|227524194|ref|ZP_03954243.1| beta-glucosidase [Lactobacillus hilgardii ATCC 8290] gi|227088650|gb|EEI23962.1| beta-glucosidase [Lactobacillus hilgardii ATCC 8290] Length = 822 Score = 35.5 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 6/54 (11%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + +++ P +++ P + FS P A + + Sbjct: 121 IGQEARSLNVDMVLGPGINIKRNPLC--GRNFEYFSEDPYLAGTIGAAWIKGLQ 172 >gi|223936933|ref|ZP_03628842.1| Beta-glucosidase [bacterium Ellin514] gi|223894502|gb|EEF60954.1| Beta-glucosidase [bacterium Ellin514] Length = 774 Score = 35.5 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G + +PV+D+ + + P + R + Sbjct: 158 AHETRVRGGHQALTPVVDVARDAR--WGRVEETYGEDPFLNTQLGIAAVRGFQ 208 >gi|168059435|ref|XP_001781708.1| predicted protein [Physcomitrella patens subsp. patens] gi|162666877|gb|EDQ53521.1| predicted protein [Physcomitrella patens subsp. patens] Length = 626 Score = 35.5 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 16/53 (30%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI F+P + + P + +S P + Sbjct: 156 ALEVRATGITYTFAPCIAVCRDPR--WGRCYESYSEDPEVVRSMTTI-IDGLQ 205 >gi|330877806|gb|EGH11955.1| beta-D-glucoside glucohydrolase [Pseudomonas syringae pv. morsprunorum str. M302280PT] Length = 765 Score = 35.5 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A+ I++ F+P++D+ P + F + + R++ KN Sbjct: 143 AREASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 196 >gi|332671963|ref|YP_004454971.1| glycoside hydrolase family 3 domain-containing protein [Cellulomonas fimi ATCC 484] gi|332341001|gb|AEE47584.1| glycoside hydrolase family 3 domain protein [Cellulomonas fimi ATCC 484] Length = 771 Score = 35.5 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 9/46 (19%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 GI+ F+P++D+ P + P A R + Sbjct: 161 GIHWTFAPMVDIARDPR--WGRIVEGAGEDPYLGSAVAAAQVRGFQ 204 >gi|328957749|ref|YP_004375135.1| periplasmic beta-glucosidase [Carnobacterium sp. 17-4] gi|328674073|gb|AEB30119.1| periplasmic beta-glucosidase [Carnobacterium sp. 17-4] Length = 714 Score = 35.5 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ SG++V FSP++DL+ + ++ A+ F R Y Sbjct: 120 ARESSVSGLHVTFSPMVDLVRDAR--WGRVMESTGEDAYLNQQMARAFVRGYQ 170 >gi|326488663|dbj|BAJ97943.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 232 Score = 35.5 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 6/41 (14%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKA 42 A + +G++ F+P + + + +S P Sbjct: 139 ALEVRATGMHWTFAPCVAVCRDSR--WGRCYESYSEDPEIV 177 >gi|307130600|ref|YP_003882616.1| Periplasmic beta-glucosidase [Dickeya dadantii 3937] gi|306528129|gb|ADM98059.1| Periplasmic beta-glucosidase [Dickeya dadantii 3937] Length = 768 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N+ ++P++D+ P + F E A++ + + Sbjct: 146 AYEATEDGLNMTWAPMVDITRDPR--WGRVSEGFGEDTYLTSEIARVMVKGFQ 196 >gi|238852774|ref|ZP_04643180.1| beta-N-acetylhexosaminidase [Lactobacillus gasseri 202-4] gi|238834624|gb|EEQ26855.1| beta-N-acetylhexosaminidase [Lactobacillus gasseri 202-4] Length = 641 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEES 45 A L + GIN N++P D P TF+ F + + + Sbjct: 162 ATLLRSLGINWNYAPDADYSTKPGTFM--WDRTFGQGYQQTADY 203 >gi|284034207|ref|YP_003384138.1| glycoside hydrolase family 3 domain-containing protein [Kribbella flavida DSM 17836] gi|283813500|gb|ADB35339.1| glycoside hydrolase family 3 domain protein [Kribbella flavida DSM 17836] Length = 1046 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI +F+P + ++ + FS PA + + Sbjct: 459 ATEVRATGIPWDFAPCVCVVRDDR--WGRTYEGFSEDPALVKAMST-VITGMQ 508 >gi|123443871|ref|YP_001007842.1| glycosyl hydrolase family protein [Yersinia enterocolitica subsp. enterocolitica 8081] gi|122090832|emb|CAL13714.1| glycosyl hydrolase family protein [Yersinia enterocolitica subsp. enterocolitica 8081] Length = 625 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 L + G N F PV+D+ + +S P E A+ + K Sbjct: 166 GYELSSLGFN--FGPVVDVNNNQNNPVIGV-RSYSNDPVLVAELARSYISGIHK 216 >gi|189460899|ref|ZP_03009684.1| hypothetical protein BACCOP_01546 [Bacteroides coprocola DSM 17136] gi|189432473|gb|EDV01458.1| hypothetical protein BACCOP_01546 [Bacteroides coprocola DSM 17136] Length = 718 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 8/48 (16%), Positives = 16/48 (33%), Gaps = 3/48 (6%) Query: 12 VNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 + ++P +DL P + + A F + +PK Sbjct: 135 IMWTPNVDLGRDPR--WGRTEECYGEDAFLTSRLAVAFIKGIQGDHPK 180 >gi|330966641|gb|EGH66901.1| beta-D-glucoside glucohydrolase [Pseudomonas syringae pv. actinidiae str. M302091] Length = 765 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A+ I++ F+P++D+ P + F + + R++ KN Sbjct: 143 AREASADSIDMTFAPMVDISRDPR--WGRSSEGFGEDTYLVSRISDVMVRSFQGKN 196 >gi|212541580|ref|XP_002150945.1| glycosyl hydrolase, putative [Penicillium marneffei ATCC 18224] gi|210068244|gb|EEA22336.1| glycosyl hydrolase, putative [Penicillium marneffei ATCC 18224] Length = 357 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 20/53 (37%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A L +N N +PVLD+ P F Q + +S A F+ Sbjct: 134 AAALGAYNMNTNLAPVLDVFRTPGDFEDQYQRSYSDNATLAGICGAAFTTAQQ 186 >gi|256394020|ref|YP_003115584.1| glycoside hydrolase family 3 domain-containing protein [Catenulispora acidiphila DSM 44928] gi|256360246|gb|ACU73743.1| glycoside hydrolase family 3 domain protein [Catenulispora acidiphila DSM 44928] Length = 1212 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 7/41 (17%), Positives = 14/41 (34%), Gaps = 2/41 (4%) Query: 14 FSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 ++P +++ P + F P + A F Y Sbjct: 174 WAPTVNMDRDPR--WGRTDEAFGEDPYLVGKMAGAFVAGYQ 212 >gi|251790095|ref|YP_003004816.1| glycoside hydrolase family 3 domain-containing protein [Dickeya zeae Ech1591] gi|247538716|gb|ACT07337.1| glycoside hydrolase family 3 domain protein [Dickeya zeae Ech1591] Length = 769 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N+ ++P++D+ P + F E A++ + + Sbjct: 147 AYEATEDGLNMTWAPMVDITRDPR--WGRVSEGFGEDTYLTSEIARVMVKGFQ 197 >gi|188534369|ref|YP_001908166.1| Periplasmic beta-glucosidase [Erwinia tasmaniensis Et1/99] gi|188029411|emb|CAO97288.1| Periplasmic beta-glucosidase [Erwinia tasmaniensis Et1/99] Length = 765 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 A G+N+ ++P++D+ P + F E ++ + N Sbjct: 143 AYEAADDGLNMTWAPMVDVTREPR--WGRGSEGFGEDTWLTGEMGRVLVKAMQGN 195 >gi|126137271|ref|XP_001385159.1| beta-glucosidase [Scheffersomyces stipitis CBS 6054] gi|126092381|gb|ABN67130.1| beta-glucosidase [Scheffersomyces stipitis CBS 6054] Length = 839 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M + G +V P +++ GP + FS P ++A R Sbjct: 88 MGEEAKHKGAHVILGPTMNMQRGPLG--GRGFESFSEDPHLTGQAASSIIRGIQD 140 >gi|253687936|ref|YP_003017126.1| glycoside hydrolase family 3 domain protein [Pectobacterium carotovorum subsp. carotovorum PC1] gi|251754514|gb|ACT12590.1| glycoside hydrolase family 3 domain protein [Pectobacterium carotovorum subsp. carotovorum PC1] Length = 768 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N+ ++P++D+ P + F + A + + + Sbjct: 146 AYEATEDGLNMTWAPMVDITRDPR--WGRVSEGFGEDTWLTSKIAGVVVKAFQ 196 >gi|156740923|ref|YP_001431052.1| glycoside hydrolase family 3 protein [Roseiflexus castenholzii DSM 13941] gi|156232251|gb|ABU57034.1| glycoside hydrolase family 3 domain protein [Roseiflexus castenholzii DSM 13941] Length = 914 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ + G + +P +++ P + +S P + A + Sbjct: 98 LAEEAQSKGARLLLAPTVNIHRSPLN--GRNFECYSEDPYLSARMAVAYITGLQ 149 >gi|291240561|ref|XP_002740190.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii] Length = 763 Score = 35.5 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 9/46 (19%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Query: 14 FSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNPK 58 FSPV+++ P + + + P E + R +P+ Sbjct: 140 FSPVINIARHPL--WGRNQETYGEDPFLIGELGSAYVRGLQGDHPR 183 >gi|157144933|ref|YP_001452252.1| hypothetical protein CKO_00662 [Citrobacter koseri ATCC BAA-895] gi|157082138|gb|ABV11816.1| hypothetical protein CKO_00662 [Citrobacter koseri ATCC BAA-895] Length = 823 Score = 35.5 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 201 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTAIMGKTMVEAMQGKSP 255 >gi|324497317|gb|ADY39467.1| putative periplasmic beta-glucosidase precursor [bacterium enrichment culture clone P69-9E] Length = 765 Score = 35.5 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRGSEGFGEDTYLTSTMGKTMVEAMQGKSP 197 >gi|315282694|ref|ZP_07871045.1| periplasmic beta-glucosidase [Listeria marthii FSL S4-120] gi|313613661|gb|EFR87454.1| periplasmic beta-glucosidase [Listeria marthii FSL S4-120] Length = 723 Score = 35.5 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATAEGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVAGYQ 173 >gi|159126340|gb|EDP51456.1| beta-glucosidase, putative [Aspergillus fumigatus A1163] Length = 797 Score = 35.5 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ T G+ F+PV+DL + F P + E + + Sbjct: 179 AQEARTLGVTQLFAPVVDLARELR--FGRVEETFGEDPYLSGEMGYSYVKGLQ 229 >gi|70998408|ref|XP_753926.1| beta-glucosidase [Aspergillus fumigatus Af293] gi|66851562|gb|EAL91888.1| beta-glucosidase, putative [Aspergillus fumigatus Af293] Length = 797 Score = 35.5 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ T G+ F+PV+DL + F P + E + + Sbjct: 179 AQEARTLGVTQLFAPVVDLARELR--FGRVEETFGEDPYLSGEMGYSYVKGLQ 229 >gi|67525805|ref|XP_660964.1| hypothetical protein AN3360.2 [Aspergillus nidulans FGSC A4] gi|40744148|gb|EAA63328.1| hypothetical protein AN3360.2 [Aspergillus nidulans FGSC A4] gi|259485659|tpe|CBF82868.1| TPA: glycosyl hydrolase, putative (AFU_orthologue; AFUA_4G13770) [Aspergillus nidulans FGSC A4] Length = 463 Score = 35.5 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 16/51 (31%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L + +N N +PVL + F + +S A F Sbjct: 130 TLTSYNMNANLAPVLAVYREEGDFTDRYGRSYSNNATVVSGCAAQFVENQQ 180 >gi|288928960|ref|ZP_06422806.1| beta-glucosidase [Prevotella sp. oral taxon 317 str. F0108] gi|288329944|gb|EFC68529.1| beta-glucosidase [Prevotella sp. oral taxon 317 str. F0108] Length = 757 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 10/48 (20%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 GI+ F+P++D+ P + A + A R + N Sbjct: 162 GIHWTFAPMVDIARDPR--WGRIVEGAGEDTYLASQIAAARVRGFQWN 207 >gi|261368557|ref|ZP_05981440.1| thermostable beta-glucosidase B [Subdoligranulum variabile DSM 15176] gi|282569441|gb|EFB74976.1| thermostable beta-glucosidase B [Subdoligranulum variabile DSM 15176] Length = 809 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+N+ P L++ P + FS P A + A + R Sbjct: 89 LGEEAAAQGVNIVLGPGLNIKRSPLC--GRNFEYFSEDPYLAGKLAAGYIRGIQ 140 >gi|322434506|ref|YP_004216718.1| glycoside hydrolase family 3 domain protein [Acidobacterium sp. MP5ACTX9] gi|321162233|gb|ADW67938.1| glycoside hydrolase family 3 domain protein [Acidobacterium sp. MP5ACTX9] Length = 784 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ +G+ F+P++D+ + P A+ + Sbjct: 168 AREASAAGVKWTFAPMVDIARDAR--WGRIMEGAGEDPYLGARIAEAQVHGFQ 218 >gi|290891963|ref|ZP_06554960.1| beta-glucosidase [Listeria monocytogenes FSL J2-071] gi|290558557|gb|EFD92074.1| beta-glucosidase [Listeria monocytogenes FSL J2-071] Length = 756 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G+++ + LD+L P + + P A E + + Sbjct: 151 ITEEISEKGVHLALASALDILRDPR--WGRAEECYGEDPYLAAELTAAITEGFQ 202 >gi|254882241|ref|ZP_05254951.1| glycoside hydrolase family beta-glycosidase [Bacteroides sp. 4_3_47FAA] gi|319643197|ref|ZP_07997825.1| glycoside hydrolase family 3 [Bacteroides sp. 3_1_40A] gi|254835034|gb|EET15343.1| glycoside hydrolase family beta-glycosidase [Bacteroides sp. 4_3_47FAA] gi|317385101|gb|EFV66052.1| glycoside hydrolase family 3 [Bacteroides sp. 3_1_40A] Length = 788 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK V G +SP+LD+ P + + P E + + K Sbjct: 184 AKEAVALGYTNIYSPILDIAQDPR--WGRCVETYGEDPYLVGELGKQMITSLQK 235 >gi|226225334|ref|YP_002759441.1| beta-glucosidase [Listeria monocytogenes Clip81459] gi|225877796|emb|CAS06511.1| Putative beta-glucosidase [Listeria monocytogenes serotype 4b str. CLIP 80459] Length = 756 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G+++ + LD+L P + + P A E + + Sbjct: 151 ITEEISEKGVHLALASALDILRDPR--WGRAEECYGEDPYLAAELTAAITEGFQ 202 >gi|217966012|ref|YP_002351690.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Listeria monocytogenes HCC23] gi|217335282|gb|ACK41076.1| periplasmic beta-glucosidase (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Listeria monocytogenes HCC23] gi|307572372|emb|CAR85551.1| beta-glucosidase [Listeria monocytogenes L99] Length = 756 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G+++ + LD+L P + + P A E + + Sbjct: 151 ITEEISEKGVHLALASALDILRDPR--WGRAEECYGEDPYLAAELTAAITEGFQ 202 >gi|254851912|ref|ZP_05241260.1| beta-glucosidase [Listeria monocytogenes FSL R2-503] gi|254992805|ref|ZP_05274995.1| beta-glucosidase [Listeria monocytogenes FSL J2-064] gi|300763458|ref|ZP_07073456.1| beta-glucosidase [Listeria monocytogenes FSL N1-017] gi|258605208|gb|EEW17816.1| beta-glucosidase [Listeria monocytogenes FSL R2-503] gi|300515735|gb|EFK42784.1| beta-glucosidase [Listeria monocytogenes FSL N1-017] Length = 756 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G+++ + LD+L P + + P A E + + Sbjct: 151 ITEEISEKGVHLALASALDILRDPR--WGRAEECYGEDPYLAAELTAAITEGFQ 202 >gi|254827349|ref|ZP_05232036.1| beta-glucosidase [Listeria monocytogenes FSL N3-165] gi|258599727|gb|EEW13052.1| beta-glucosidase [Listeria monocytogenes FSL N3-165] Length = 756 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G+++ + LD+L P + + P A E + + Sbjct: 151 ITEEISEKGVHLALASALDILRDPR--WGRAEECYGEDPYLAAELTAAITEGFQ 202 >gi|150002739|ref|YP_001297483.1| glycoside hydrolase family beta-glycosidase [Bacteroides vulgatus ATCC 8482] gi|294776994|ref|ZP_06742455.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides vulgatus PC510] gi|149931163|gb|ABR37861.1| glycoside hydrolase family 3, candidate beta-glycosidase [Bacteroides vulgatus ATCC 8482] gi|294449242|gb|EFG17781.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides vulgatus PC510] Length = 788 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK V G +SP+LD+ P + + P E + + K Sbjct: 184 AKEAVALGYTNIYSPILDIAQDPR--WGRCVETYGEDPYLVGELGKQMITSLQK 235 >gi|46908971|ref|YP_015360.1| beta-glucosidase [Listeria monocytogenes serotype 4b str. F2365] gi|254824850|ref|ZP_05229851.1| beta-glucosidase [Listeria monocytogenes FSL J1-194] gi|254930942|ref|ZP_05264301.1| beta-glucosidase [Listeria monocytogenes HPB2262] gi|46882244|gb|AAT05537.1| beta-glucosidase [Listeria monocytogenes serotype 4b str. F2365] gi|293582489|gb|EFF94521.1| beta-glucosidase [Listeria monocytogenes HPB2262] gi|293594092|gb|EFG01853.1| beta-glucosidase [Listeria monocytogenes FSL J1-194] gi|328469125|gb|EGF40073.1| beta-glucosidase [Listeria monocytogenes 220] gi|332313214|gb|EGJ26309.1| Glycoside hydrolase [Listeria monocytogenes str. Scott A] Length = 756 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G+++ + LD+L P + + P A E + + Sbjct: 151 ITEEISEKGVHLALASALDILRDPR--WGRAEECYGEDPYLAAELTAAITEGFQ 202 >gi|47092671|ref|ZP_00230458.1| beta-glucosidase [Listeria monocytogenes str. 4b H7858] gi|255521557|ref|ZP_05388794.1| beta-glucosidase [Listeria monocytogenes FSL J1-175] gi|47018966|gb|EAL09712.1| beta-glucosidase [Listeria monocytogenes str. 4b H7858] gi|328468259|gb|EGF39265.1| beta-glucosidase [Listeria monocytogenes 1816] Length = 756 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G+++ + LD+L P + + P A E + + Sbjct: 151 ITEEISEKGVHLALASALDILRDPR--WGRAEECYGEDPYLAAELTAAITEGFQ 202 >gi|283785933|ref|YP_003365798.1| periplasmic beta-glucosidase [Citrobacter rodentium ICC168] gi|282949387|emb|CBG88999.1| periplasmic beta-glucosidase [Citrobacter rodentium ICC168] Length = 765 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRVSEGFGEDTYLTAIMGKTMVEAMQGKSP 197 >gi|62198735|gb|AAX76619.1| BglX [Pectobacterium carotovorum subsp. carotovorum] Length = 768 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N+ ++P++D+ P + F + A + + + Sbjct: 146 ASEATEDGLNMTWAPMVDITRDPR--WGRVSEGFGEDTWLTSKIAGVVVKAFQ 196 >gi|310815914|ref|YP_003963878.1| putative beta-glucosidase [Ketogulonicigenium vulgare Y25] gi|308754649|gb|ADO42578.1| putative beta-glucosidase [Ketogulonicigenium vulgare Y25] Length = 815 Score = 35.5 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + G V P ++L GP + +S P E A Sbjct: 87 LADEALDKGARVLLGPTINLQRGPLN--GRNFECYSEDPILTAELAIAMVEGLQ 138 >gi|218460084|ref|ZP_03500175.1| beta-glucosidase protein [Rhizobium etli Kim 5] Length = 332 Score = 35.5 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G V +P +++ + +S P E A + Sbjct: 83 LGRQAKSKGAAVLLAPTVNIHRSGLN--GRNFECYSEDPMLTAELAVAYIEGVQ 134 >gi|83594629|ref|YP_428381.1| glycoside hydrolase family protein [Rhodospirillum rubrum ATCC 11170] gi|83577543|gb|ABC24094.1| Glycoside hydrolase, family 3-like [Rhodospirillum rubrum ATCC 11170] Length = 716 Score = 35.5 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 8/46 (17%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 G+++ F+P++D+ P + P A+ R + Sbjct: 120 GLHMTFAPMIDIARDPR--WGRIAEGPGEDPWVGARMAEAKVRGFQ 163 >gi|303279871|ref|XP_003059228.1| glycoside hydrolase family 3 protein [Micromonas pusilla CCMP1545] gi|226459064|gb|EEH56360.1| glycoside hydrolase family 3 protein [Micromonas pusilla CCMP1545] Length = 387 Score = 35.5 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 5/28 (17%), Positives = 12/28 (42%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQ 30 L +++ +PV+D+ P + Sbjct: 118 SELRAVNVDMTLAPVVDVHTNPLNTVIG 145 >gi|312199020|ref|YP_004019081.1| glycoside hydrolase family 3 domain protein [Frankia sp. EuI1c] gi|311230356|gb|ADP83211.1| glycoside hydrolase family 3 domain protein [Frankia sp. EuI1c] Length = 864 Score = 35.5 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A G++V P ++L P + + P + R Sbjct: 90 AAQARAKGVHVVLGPTVNLHRSPLG--GRHFECLAEDPLLTARAGGALVRGIQD 141 >gi|268316106|ref|YP_003289825.1| glycoside hydrolase family 3 domain-containing protein [Rhodothermus marinus DSM 4252] gi|262333640|gb|ACY47437.1| glycoside hydrolase family 3 domain protein [Rhodothermus marinus DSM 4252] Length = 754 Score = 35.5 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N F+P++D+ + P A R + Sbjct: 142 AGEASAVGLNWTFAPMVDIARDAR--WGRIVEGSGEDPYLGAVMAAARVRGFQ 192 >gi|269925523|ref|YP_003322146.1| NMT1/THI5 like domain protein [Thermobaculum terrenum ATCC BAA-798] gi|269789183|gb|ACZ41324.1| NMT1/THI5 like domain protein [Thermobaculum terrenum ATCC BAA-798] Length = 360 Score = 35.5 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 11/58 (18%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI---KNPK 58 L G+ VN PV + L + + S P +A + + +P+ Sbjct: 222 QLRHLGVKVNTIPVWEHLNLVSNGLITSQDKLSSDPQEAAAVVRATMKGLQYTIDHPE 279 >gi|222631786|gb|EEE63918.1| hypothetical protein OsJ_18743 [Oryza sativa Japonica Group] Length = 606 Score = 35.5 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 7/48 (14%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLF 49 A + +GI+ F+P + + P + +S + Sbjct: 134 ALEVRATGIHWTFAPCVAVCRDPR--WGRCYECYSEDTEVVRSLTTIV 179 >gi|218196890|gb|EEC79317.1| hypothetical protein OsI_20160 [Oryza sativa Indica Group] Length = 606 Score = 35.5 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 7/48 (14%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLF 49 A + +GI+ F+P + + P + +S + Sbjct: 134 ALEVRATGIHWTFAPCVAVCRDPR--WGRCYECYSEDTEVVRSLTTIV 179 >gi|322433841|ref|YP_004216053.1| glycoside hydrolase family 3 domain protein [Acidobacterium sp. MP5ACTX9] gi|321161568|gb|ADW67273.1| glycoside hydrolase family 3 domain protein [Acidobacterium sp. MP5ACTX9] Length = 870 Score = 35.5 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 6/54 (11%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + ++ G++ P +++ P + F P + + A + Sbjct: 128 IGRDARARGVHFMLGPGVNIYRSPRN--GRNFEYFGEDPFLSGQIATGYITGMQ 179 >gi|87303567|ref|ZP_01086350.1| putative glycosyl hydrolase [Synechococcus sp. WH 5701] gi|87281980|gb|EAQ73943.1| putative glycosyl hydrolase [Synechococcus sp. WH 5701] Length = 736 Score = 35.5 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 6/56 (10%), Positives = 17/56 (30%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + + N ++LL P + + + P +R ++ Sbjct: 111 IGREARSFKANWVAGVCINLLRHPG--WGRAQETYGEDPVHVGAMGAAMTRGLERH 164 >gi|269139716|ref|YP_003296417.1| beta-glucosidase-related glycosidase [Edwardsiella tarda EIB202] gi|267985377|gb|ACY85206.1| beta-glucosidase-related glycosidase [Edwardsiella tarda EIB202] gi|304559583|gb|ADM42247.1| Periplasmic beta-glucosidase [Edwardsiella tarda FL6-60] Length = 767 Score = 35.1 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N+ ++P++D+ P + F E +L + Sbjct: 145 AYEASEDGLNMTWAPMVDITRDPR--WGRTSEGFGEDTYLTSEMGRLMVKAMQ 195 >gi|300770073|ref|ZP_07079952.1| xylosidase [Sphingobacterium spiritivorum ATCC 33861] gi|300762549|gb|EFK59366.1| xylosidase [Sphingobacterium spiritivorum ATCC 33861] Length = 887 Score = 35.1 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A GI +PV++L + + P + F + K Sbjct: 164 IATESRLRGIRQILTPVVNLANDVR--WGRTEETYGEDPYLSSVMGVAFVSAFEK 216 >gi|238920553|ref|YP_002934068.1| periplasmic beta-glucosidase [Edwardsiella ictaluri 93-146] gi|238870122|gb|ACR69833.1| periplasmic beta-glucosidase [Edwardsiella ictaluri 93-146] Length = 767 Score = 35.1 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N+ ++P++D+ P + F E +L + Sbjct: 145 AYEASEDGLNMTWAPMVDITRDPR--WGRTSEGFGEDTYLTSEMGRLMVKAMQ 195 >gi|227538527|ref|ZP_03968576.1| possible beta-glucosidase [Sphingobacterium spiritivorum ATCC 33300] gi|227241446|gb|EEI91461.1| possible beta-glucosidase [Sphingobacterium spiritivorum ATCC 33300] Length = 888 Score = 35.1 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A GI +PV++L + + P + F + K Sbjct: 164 IATESRLRGIRQILTPVVNLANDVR--WGRTEETYGEDPYLSSVMGVAFVSAFEK 216 >gi|300362737|ref|ZP_07058912.1| beta-N-acetylhexosaminidase [Lactobacillus gasseri JV-V03] gi|300353165|gb|EFJ69038.1| beta-N-acetylhexosaminidase [Lactobacillus gasseri JV-V03] Length = 641 Score = 35.1 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEES 45 A L + GIN N++P D P TF+ F + + + Sbjct: 162 ATLLRSLGINWNYAPDADYSTKPGTFM--WDRTFGQGYQQTADY 203 >gi|116494248|ref|YP_805982.1| Beta-glucosidase-related glycosidase [Lactobacillus casei ATCC 334] gi|116104398|gb|ABJ69540.1| Beta-glucosidase-related glycosidase [Lactobacillus casei ATCC 334] Length = 795 Score = 35.1 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+++ P +++ P + FS P A + + Sbjct: 93 IGLEAQSLGVDMVLGPGVNMKRNPLC--GRNFEYFSEDPFLAGKLGAAWINGIQ 144 >gi|153948994|ref|YP_001401954.1| glycosy hydrolase family protein [Yersinia pseudotuberculosis IP 31758] gi|152960489|gb|ABS47950.1| glycosyl hydrolase, family 3 [Yersinia pseudotuberculosis IP 31758] Length = 793 Score = 35.1 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 5/54 (9%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G+++ P +++ P + F+ P + Sbjct: 124 IGDEAKRYGVDLILGPAINIQRHPLN--GRNFEYFTEDPLLNAIMTASYIDGMQ 175 >gi|271500972|ref|YP_003333997.1| glycoside hydrolase family 3 domain-containing protein [Dickeya dadantii Ech586] gi|270344527|gb|ACZ77292.1| glycoside hydrolase family 3 domain protein [Dickeya dadantii Ech586] Length = 771 Score = 35.1 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N+ ++P++D+ P + F E A++ + + Sbjct: 149 AYEATEDGLNMTWAPMVDITRDPR--WGRVSEGFGEDTYLTSEIARMMVKGFQ 199 >gi|320161158|ref|YP_004174382.1| beta-glucosidase [Anaerolinea thermophila UNI-1] gi|319995011|dbj|BAJ63782.1| beta-glucosidase [Anaerolinea thermophila UNI-1] Length = 822 Score = 35.1 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 5/54 (9%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ ++ P ++++ P + +S P + + + Sbjct: 96 LAEETRAMDCDILLGPCVNIVRHPLA--GRNFESYSEDPYLNGKMGVAWVKGLQ 147 >gi|224536509|ref|ZP_03677048.1| hypothetical protein BACCELL_01384 [Bacteroides cellulosilyticus DSM 14838] gi|224521866|gb|EEF90971.1| hypothetical protein BACCELL_01384 [Bacteroides cellulosilyticus DSM 14838] Length = 773 Score = 35.1 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP++D+ P + P A+ Y Sbjct: 144 ATEASADGISWTFSPMVDISRDPR--WGRVSEGNGEDPFLGGAIAKAMVSGYQ 194 >gi|191637581|ref|YP_001986747.1| Thermostable beta-glucosidase B (Gentiobiase) (Cellobiase) (Beta-D-glucoside glucohydrolase) [Lactobacillus casei BL23] gi|190711883|emb|CAQ65889.1| Thermostable beta-glucosidase B (Gentiobiase) (Cellobiase) (Beta-D-glucoside glucohydrolase) [Lactobacillus casei BL23] gi|327381630|gb|AEA53106.1| Beta-glucosidase [Lactobacillus casei LC2W] gi|327384797|gb|AEA56271.1| Beta-glucosidase [Lactobacillus casei BD-II] Length = 795 Score = 35.1 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+++ P +++ P + FS P A + + Sbjct: 93 IGLEAQSLGVDMVLGPGVNMKRNPLC--GRNFEYFSEDPFLAGKLGAAWINGIQ 144 >gi|315302635|ref|ZP_07873439.1| periplasmic beta-glucosidase/beta-xylosidase [Listeria ivanovii FSL F6-596] gi|313628999|gb|EFR97328.1| periplasmic beta-glucosidase/beta-xylosidase [Listeria ivanovii FSL F6-596] Length = 739 Score = 35.1 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Query: 1 MAK-NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A GI SP +D+ P + F + + A+ + + Sbjct: 213 IASLEYRALGITTALSPQVDIATEPR--WMRFNGTFGEDSKLSADMAKAYCEGFQN 266 >gi|227534384|ref|ZP_03964433.1| Thermostable beta-glucosidase B (beta-D-glucoside glucohydrolase) [Lactobacillus paracasei subsp. paracasei ATCC 25302] gi|227188001|gb|EEI68068.1| Thermostable beta-glucosidase B (beta-D-glucoside glucohydrolase) [Lactobacillus paracasei subsp. paracasei ATCC 25302] Length = 795 Score = 35.1 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+++ P +++ P + FS P A + + Sbjct: 93 IGLEAQSLGVDMVLGPGVNMKRNPLC--GRNFEYFSEDPFLAGKLGAAWINGIQ 144 >gi|253761872|ref|XP_002489310.1| hypothetical protein SORBIDRAFT_0010s010920 [Sorghum bicolor] gi|241946958|gb|EES20103.1| hypothetical protein SORBIDRAFT_0010s010920 [Sorghum bicolor] Length = 772 Score = 35.1 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 11/63 (17%), Positives = 21/63 (33%), Gaps = 10/63 (15%) Query: 1 MAKNLVTS-------GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + + G+ + +SP +++ P + + PA A A F R Sbjct: 138 IGREARALFNVGQAEGLTI-WSPNVNIFRDPR--WGRGQETPGEDPAVASRYAVAFVRGI 194 Query: 54 IKN 56 N Sbjct: 195 QGN 197 >gi|186894428|ref|YP_001871540.1| glycoside hydrolase family 3 protein [Yersinia pseudotuberculosis PB1/+] gi|186697454|gb|ACC88083.1| glycoside hydrolase family 3 domain protein [Yersinia pseudotuberculosis PB1/+] Length = 793 Score = 35.1 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 5/54 (9%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G+++ P +++ P + F+ P + Sbjct: 124 IGDEAKRYGVDLILGPAINIQRHPLN--GRNFEYFTEDPLLNAIMTASYIDGMQ 175 >gi|239629629|ref|ZP_04672660.1| beta-glucosidase [Lactobacillus paracasei subsp. paracasei 8700:2] gi|239528315|gb|EEQ67316.1| beta-glucosidase [Lactobacillus paracasei subsp. paracasei 8700:2] Length = 786 Score = 35.1 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+++ P +++ P + FS P A + + Sbjct: 84 IGLEAQSLGVDMVLGPGVNMKRNPLC--GRNFEYFSEDPFLAGKLGAAWINGIQ 135 >gi|170025291|ref|YP_001721796.1| glycoside hydrolase family 3 protein [Yersinia pseudotuberculosis YPIII] gi|169751825|gb|ACA69343.1| glycoside hydrolase family 3 domain protein [Yersinia pseudotuberculosis YPIII] Length = 793 Score = 35.1 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 5/54 (9%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G+++ P +++ P + F+ P + Sbjct: 124 IGDEAKRYGVDLILGPAINIQRHPLN--GRNFEYFTEDPLLNAIMTASYIDGMQ 175 >gi|282878479|ref|ZP_06287265.1| glycosyl hydrolase family 3 N-terminal domain protein [Prevotella buccalis ATCC 35310] gi|281299465|gb|EFA91848.1| glycosyl hydrolase family 3 N-terminal domain protein [Prevotella buccalis ATCC 35310] Length = 753 Score = 35.1 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N +SP++D+ + P A+ + Y Sbjct: 137 ALEASAEGVNWTYSPMVDISRDAR--WGRIVEGAGEDPYLGSLIAKAMVKGYQ 187 >gi|51595403|ref|YP_069594.1| beta-glucosidase [Yersinia pseudotuberculosis IP 32953] gi|51588685|emb|CAH20295.1| putative beta-glucosidase [Yersinia pseudotuberculosis IP 32953] Length = 793 Score = 35.1 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 5/54 (9%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G+++ P +++ P + F+ P + Sbjct: 124 IGDEAKRYGVDLILGPAINIQRHPLN--GRNFEYFTEDPLLNAIMTASYIDGMQ 175 >gi|332884771|gb|EGK05027.1| hypothetical protein HMPREF9456_03180 [Dysgonomonas mossii DSM 22836] Length = 757 Score = 35.1 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 ++GIN +SP++D+ P + P A+ R Sbjct: 141 EATSTGINWVYSPMVDISRDPR--WGRVAEGAGEDPYLGGLVAKAMIRGIQ 189 >gi|298244743|ref|ZP_06968549.1| glycoside hydrolase family 3 domain protein [Ktedonobacter racemifer DSM 44963] gi|297552224|gb|EFH86089.1| glycoside hydrolase family 3 domain protein [Ktedonobacter racemifer DSM 44963] Length = 609 Score = 35.1 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Query: 1 MAK-NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 MA+ GI V P+ DL P F ++ + + R + Sbjct: 168 MARQEYTAVGIRVALHPMADLATEPRWARING--TFGEDAERSGKMTAAYIRGFQ 220 >gi|301065752|ref|YP_003787775.1| beta-glucosidase-like glycosidase [Lactobacillus casei str. Zhang] gi|300438159|gb|ADK17925.1| Beta-glucosidase-related glycosidase [Lactobacillus casei str. Zhang] Length = 795 Score = 35.1 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+++ P +++ P + FS P A + + Sbjct: 93 IGLEAQSLGVDMVLGPGVNMKRNPLC--GRNFEYFSEDPFLAGKLGAAWINGIQ 144 >gi|115464203|ref|NP_001055701.1| Os05g0449600 [Oryza sativa Japonica Group] gi|113579252|dbj|BAF17615.1| Os05g0449600 [Oryza sativa Japonica Group] Length = 333 Score = 35.1 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 7/48 (14%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLF 49 A + +GI+ F+P + + P + +S + Sbjct: 149 ALEVRATGIHWTFAPCVAVCRDPR--WGRCYECYSEDTEVVRSLTTIV 194 >gi|313632883|gb|EFR99829.1| periplasmic beta-glucosidase [Listeria seeligeri FSL N1-067] Length = 619 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVAGYQ 173 >gi|291616799|ref|YP_003519541.1| BglX [Pantoea ananatis LMG 20103] gi|291151829|gb|ADD76413.1| BglX [Pantoea ananatis LMG 20103] Length = 765 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSREPR--WGRVSEGFGEDTYLTSAMGRTMVQAMQGKSP 197 >gi|289435065|ref|YP_003464937.1| beta-glucosidase [Listeria seeligeri serovar 1/2b str. SLCC3954] gi|289171309|emb|CBH27851.1| beta-glucosidase [Listeria seeligeri serovar 1/2b str. SLCC3954] Length = 722 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +V FSP+LDL+ P + P E + Y Sbjct: 123 ALEATADGHHVTFSPMLDLVRDPR--WGRVMESTGEDPFLNSELGKAMVAGYQ 173 >gi|255535659|ref|YP_003096030.1| Periplasmic beta-glucosidase [Flavobacteriaceae bacterium 3519-10] gi|255341855|gb|ACU07968.1| Periplasmic beta-glucosidase [Flavobacteriaceae bacterium 3519-10] Length = 775 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ FSP+ D+ P + P E A+ Y Sbjct: 151 ANEASADGISWTFSPMTDISREPR--WGRISEGSGEDPYLGSEVAKAMVYGYQ 201 >gi|298482586|ref|ZP_07000771.1| periplasmic beta-glucosidase [Bacteroides sp. D22] gi|298271293|gb|EFI12869.1| periplasmic beta-glucosidase [Bacteroides sp. D22] Length = 761 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK GI FSP++D+ P + P E + + Y Sbjct: 143 AKESSADGICWTFSPMVDICRDPR--WGRMAEGGGEDPYLGSEISAAMVKGYQ 193 >gi|295085728|emb|CBK67251.1| Beta-glucosidase-related glycosidases [Bacteroides xylanisolvens XB1A] Length = 742 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK GI FSP++D+ P + P E + + Y Sbjct: 124 AKESSADGICWTFSPMVDICRDPR--WGRMAEGGGEDPYLGSEISAAMVKGYQ 174 >gi|224104315|ref|XP_002313393.1| predicted protein [Populus trichocarpa] gi|222849801|gb|EEE87348.1| predicted protein [Populus trichocarpa] Length = 603 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 9/48 (18%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLF 49 A + GI F+P + + P + +S E A + Sbjct: 129 ALEVRACGIQYTFAPCVAVCRDPR--WGRCYESYSEDTNIVREMASIV 174 >gi|222107153|ref|YP_002547944.1| hypothetical protein Avi_6257 [Agrobacterium vitis S4] gi|221738332|gb|ACM39228.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 823 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A + + G +V +P +++ + +S P A + + Sbjct: 83 LAGQVKSKGASVLLAPTVNIHRSGLN--GRNFECYSEDPMLTAALAVAYIKGVQ 134 >gi|53749251|gb|AAU90111.1| putative beta-D-glucan exohydrolase [Oryza sativa Japonica Group] gi|215741198|dbj|BAG97693.1| unnamed protein product [Oryza sativa Japonica Group] Length = 318 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 7/48 (14%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLF 49 A + +GI+ F+P + + P + +S + Sbjct: 134 ALEVRATGIHWTFAPCVAVCRDPR--WGRCYECYSEDTEVVRSLTTIV 179 >gi|90423122|ref|YP_531492.1| glycoside hydrolase family protein [Rhodopseudomonas palustris BisB18] gi|90105136|gb|ABD87173.1| glycoside hydrolase, family 3-like [Rhodopseudomonas palustris BisB18] Length = 764 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 8/46 (17%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 G++ F+P++D+ P + P A R + Sbjct: 154 GLHWAFAPMVDIARDPR--WGRMIEGAGEDPYLGAAMAAAQVRGFQ 197 >gi|332885491|gb|EGK05740.1| hypothetical protein HMPREF9456_02542 [Dysgonomonas mossii DSM 22836] Length = 760 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI FSP++D+ P + P + A+ R Y Sbjct: 139 AIEASADGICWTFSPMVDISRDPR--WGRVSEGNGEDPYLGGQIAKAMVRGYQ 189 >gi|325281450|ref|YP_004253992.1| Beta-glucosidase [Odoribacter splanchnicus DSM 20712] gi|324313259|gb|ADY33812.1| Beta-glucosidase [Odoribacter splanchnicus DSM 20712] Length = 778 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 M ++ G ++ +P L++ P + +S P + A + +N Sbjct: 134 MGNEVLEYGCDILLAPALNIHRNPLC--GRNFEYYSEDPFLTGKIAVAMVKGIQQN 187 >gi|300783640|ref|YP_003763931.1| beta-glucosidase [Amycolatopsis mediterranei U32] gi|299793154|gb|ADJ43529.1| beta-glucosidase [Amycolatopsis mediterranei U32] Length = 684 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 16/56 (28%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + NV+ P +++ P + P A A R +N Sbjct: 122 IGDETRALAHNVSEGPDINMARVPRN--GRTFEGMGEDPVLAGALAAADIRGIQEN 175 >gi|327393225|dbj|BAK10647.1| periplasmic beta-glucosidase precursor BglX [Pantoea ananatis AJ13355] Length = 765 Score = 35.1 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F + + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSREPR--WGRVSEGFGEDTYLTSAMGRTMVQAMQGKSP 197 >gi|47095588|ref|ZP_00233196.1| beta-glucosidase [Listeria monocytogenes str. 1/2a F6854] gi|254899761|ref|ZP_05259685.1| hypothetical protein LmonJ_08106 [Listeria monocytogenes J0161] gi|254913036|ref|ZP_05263048.1| beta-glucosidase [Listeria monocytogenes J2818] gi|254937417|ref|ZP_05269114.1| beta-glucosidase [Listeria monocytogenes F6900] gi|47016018|gb|EAL06943.1| beta-glucosidase [Listeria monocytogenes str. 1/2a F6854] gi|258610019|gb|EEW22627.1| beta-glucosidase [Listeria monocytogenes F6900] gi|293591036|gb|EFF99370.1| beta-glucosidase [Listeria monocytogenes J2818] Length = 756 Score = 35.1 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G+++ + LD+L P + + P A E + + Sbjct: 151 ITEEISKKGVHLALASALDILRDPR--WGRAEECYGEDPYLAAELTAAITEGFQ 202 >gi|108811203|ref|YP_646970.1| beta-glucosidase [Yersinia pestis Nepal516] gi|229901435|ref|ZP_04516557.1| putative beta-glucosidase [Yersinia pestis Nepal516] gi|108774851|gb|ABG17370.1| beta-glucosidase [Yersinia pestis Nepal516] gi|229681364|gb|EEO77458.1| putative beta-glucosidase [Yersinia pestis Nepal516] Length = 793 Score = 35.1 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 5/54 (9%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G+++ P +++ P + F+ P + Sbjct: 124 IGDEAKQYGVDLILGPAINIQRHPLN--GRNFEYFTEDPLLNAIMTASYIDGMQ 175 >gi|300709783|ref|YP_003735597.1| beta-glucosidase [Halalkalicoccus jeotgali B3] gi|299123466|gb|ADJ13805.1| beta-glucosidase [Halalkalicoccus jeotgali B3] Length = 831 Score = 35.1 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 A + G + F+P DL P + + PA E ++ R N + Sbjct: 182 ADSAAAMGAHWTFAPTTDLQRDPR--WGRFYEGITEDPAYLGEVSKARVRGLESNDR 236 >gi|294631576|ref|ZP_06710136.1| beta-glucosidase [Streptomyces sp. e14] gi|292834909|gb|EFF93258.1| beta-glucosidase [Streptomyces sp. e14] Length = 1006 Score = 35.1 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 16/53 (30%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + SG +F+P L + + F PA + + Sbjct: 459 AAEVRASGPQWDFAPCLCVTRDER--WGRSYESFGEDPALVTSM-ETVIQGLQ 508 >gi|240139061|ref|YP_002963536.1| putative Glycoside hydrolase, family 3, N-terminal and C-terminal domain (bglX-like) [Methylobacterium extorquens AM1] gi|240009033|gb|ACS40259.1| putative Glycoside hydrolase, family 3, N-terminal and C-terminal domain (bglX-like) [Methylobacterium extorquens AM1] Length = 743 Score = 35.1 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 8/52 (15%), Positives = 13/52 (25%), Gaps = 2/52 (3%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 T G+N FSP+ D+ + P + Sbjct: 135 ESATVGLNWTFSPMADVARDLR--WGRVVEGLGEDPWLTGRLTAAQVEGFRD 184 >gi|218530688|ref|YP_002421504.1| glycoside hydrolase [Methylobacterium chloromethanicum CM4] gi|218522991|gb|ACK83576.1| glycoside hydrolase family 3 domain protein [Methylobacterium chloromethanicum CM4] Length = 743 Score = 35.1 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 8/52 (15%), Positives = 13/52 (25%), Gaps = 2/52 (3%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 T G+N FSP+ D+ + P + Sbjct: 135 ESATVGLNWTFSPMADVARDLR--WGRVVEGLGEDPWLTGRLTAAQVEGFRD 184 >gi|242239825|ref|YP_002988006.1| glycoside hydrolase [Dickeya dadantii Ech703] gi|242131882|gb|ACS86184.1| glycoside hydrolase family 3 domain protein [Dickeya dadantii Ech703] Length = 769 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N+ ++P++D+ P + F E A++ + + Sbjct: 147 AYEATEDGLNMTWAPMVDITRDPR--WGRVSEGFGEDTYLTSEIARVMVKGFQ 197 >gi|255533519|ref|YP_003093891.1| glycoside hydrolase family 3 domain-containing protein [Pedobacter heparinus DSM 2366] gi|255346503|gb|ACU05829.1| glycoside hydrolase family 3 domain protein [Pedobacter heparinus DSM 2366] Length = 766 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N FSP++D+ P + E A+ + Y Sbjct: 146 AIEATADGLNWTFSPMVDISRDPR--WGRISEGSGEDTYLGSEIARAMVKGYQ 196 >gi|22125032|ref|NP_668455.1| beta-glucosidase [Yersinia pestis KIM 10] gi|45440988|ref|NP_992527.1| putative beta-glucosidase [Yersinia pestis biovar Microtus str. 91001] gi|108808540|ref|YP_652456.1| putative beta-glucosidase [Yersinia pestis Antiqua] gi|145599954|ref|YP_001164030.1| beta-glucosidase [Yersinia pestis Pestoides F] gi|149365270|ref|ZP_01887305.1| putative beta-glucosidase [Yersinia pestis CA88-4125] gi|165925232|ref|ZP_02221064.1| glycosyl hydrolase, family 3 [Yersinia pestis biovar Orientalis str. F1991016] gi|165937110|ref|ZP_02225675.1| glycosyl hydrolase, family 3 [Yersinia pestis biovar Orientalis str. IP275] gi|166008288|ref|ZP_02229186.1| glycosyl hydrolase, family 3 [Yersinia pestis biovar Antiqua str. E1979001] gi|166214574|ref|ZP_02240609.1| glycosyl hydrolase, family 3 [Yersinia pestis biovar Antiqua str. B42003004] gi|167399113|ref|ZP_02304637.1| glycosyl hydrolase, family 3 [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167422527|ref|ZP_02314280.1| glycosyl hydrolase, family 3 [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167423144|ref|ZP_02314897.1| glycosyl hydrolase, family 3 [Yersinia pestis biovar Mediaevalis str. K1973002] gi|167467778|ref|ZP_02332482.1| beta-glucosidase [Yersinia pestis FV-1] gi|218929869|ref|YP_002347744.1| putative beta-glucosidase [Yersinia pestis CO92] gi|229838375|ref|ZP_04458534.1| putative beta-glucosidase [Yersinia pestis biovar Orientalis str. PEXU2] gi|229895891|ref|ZP_04511061.1| putative beta-glucosidase [Yersinia pestis Pestoides A] gi|229898941|ref|ZP_04514085.1| putative beta-glucosidase [Yersinia pestis biovar Orientalis str. India 195] gi|294504622|ref|YP_003568684.1| putative beta-glucosidase [Yersinia pestis Z176003] gi|21957880|gb|AAM84706.1|AE013715_8 putative beta-glucosidase [Yersinia pestis KIM 10] gi|45435847|gb|AAS61404.1| putative beta-glucosidase [Yersinia pestis biovar Microtus str. 91001] gi|108780453|gb|ABG14511.1| putative beta-glucosidase [Yersinia pestis Antiqua] gi|115348480|emb|CAL21417.1| putative beta-glucosidase [Yersinia pestis CO92] gi|145211650|gb|ABP41057.1| beta-glucosidase [Yersinia pestis Pestoides F] gi|149291683|gb|EDM41757.1| putative beta-glucosidase [Yersinia pestis CA88-4125] gi|165914973|gb|EDR33585.1| glycosyl hydrolase, family 3 [Yersinia pestis biovar Orientalis str. IP275] gi|165922839|gb|EDR39990.1| glycosyl hydrolase, family 3 [Yersinia pestis biovar Orientalis str. F1991016] gi|165992670|gb|EDR44971.1| glycosyl hydrolase, family 3 [Yersinia pestis biovar Antiqua str. E1979001] gi|166204248|gb|EDR48728.1| glycosyl hydrolase, family 3 [Yersinia pestis biovar Antiqua str. B42003004] gi|166958541|gb|EDR55562.1| glycosyl hydrolase, family 3 [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167051617|gb|EDR63025.1| glycosyl hydrolase, family 3 [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167057314|gb|EDR67060.1| glycosyl hydrolase, family 3 [Yersinia pestis biovar Mediaevalis str. K1973002] gi|229687886|gb|EEO79958.1| putative beta-glucosidase [Yersinia pestis biovar Orientalis str. India 195] gi|229694741|gb|EEO84788.1| putative beta-glucosidase [Yersinia pestis biovar Orientalis str. PEXU2] gi|229700814|gb|EEO88843.1| putative beta-glucosidase [Yersinia pestis Pestoides A] gi|262362681|gb|ACY59402.1| putative beta-glucosidase [Yersinia pestis D106004] gi|262366608|gb|ACY63165.1| putative beta-glucosidase [Yersinia pestis D182038] gi|294355081|gb|ADE65422.1| putative beta-glucosidase [Yersinia pestis Z176003] gi|320016240|gb|ADV99811.1| putative beta-glucosidase [Yersinia pestis biovar Medievalis str. Harbin 35] Length = 793 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 5/54 (9%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G+++ P +++ P + F+ P + Sbjct: 124 IGDEAKQYGVDLILGPAINIQRHPLN--GRNFEYFTEDPLLNAIMTASYIDGMQ 175 >gi|290508579|ref|ZP_06547950.1| periplasmic beta-glucosidase [Klebsiella sp. 1_1_55] gi|289777973|gb|EFD85970.1| periplasmic beta-glucosidase [Klebsiella sp. 1_1_55] Length = 765 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F Q + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTTMMGQAMVESMQGKSP 197 >gi|288934374|ref|YP_003438433.1| glycoside hydrolase [Klebsiella variicola At-22] gi|288889103|gb|ADC57421.1| glycoside hydrolase family 3 domain protein [Klebsiella variicola At-22] Length = 765 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F Q + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTTMMGQAMVESMQGKSP 197 >gi|206577783|ref|YP_002237450.1| beta-glucosidase, periplasmic [Klebsiella pneumoniae 342] gi|206566841|gb|ACI08617.1| beta-glucosidase, periplasmic [Klebsiella pneumoniae 342] Length = 765 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F Q + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTTMMGQAMVESMQGKSP 197 >gi|152971107|ref|YP_001336216.1| beta-D-glucoside glucohydrolase, periplasmic [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|150955956|gb|ABR77986.1| beta-D-glucoside glucohydrolase, periplasmic [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] Length = 765 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F Q + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTTMMGQAMVESMQGKSP 197 >gi|329999099|ref|ZP_08303305.1| glycosyl hydrolase family 3 protein [Klebsiella sp. MS 92-3] gi|328538460|gb|EGF64577.1| glycosyl hydrolase family 3 protein [Klebsiella sp. MS 92-3] Length = 765 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F Q + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTTMMGQAMVESMQGKSP 197 >gi|255690204|ref|ZP_05413879.1| xylosidase/arabinosidase [Bacteroides finegoldii DSM 17565] gi|260624223|gb|EEX47094.1| xylosidase/arabinosidase [Bacteroides finegoldii DSM 17565] Length = 954 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 8/41 (19%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Query: 14 FSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +SPVLD+ + + F P + + + Y Sbjct: 267 WSPVLDV--AQDARWGRCEETFGEDPVLVSQMGGAWIKGYQ 305 >gi|251794881|ref|YP_003009612.1| glycoside hydrolase [Paenibacillus sp. JDR-2] gi|247542507|gb|ACS99525.1| glycoside hydrolase family 3 domain protein [Paenibacillus sp. JDR-2] Length = 757 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 ++ GI SP +D+ P F F P + + A+ + + Sbjct: 214 SREYRALGIATALSPQIDIATDPRWFRFSG--TFGEDPLLSTDMARAYVDGFQ 264 >gi|238895694|ref|YP_002920429.1| beta-D-glucoside glucohydrolase [Klebsiella pneumoniae NTUH-K2044] gi|238548011|dbj|BAH64362.1| beta-D-glucoside glucohydrolase [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] Length = 765 Score = 35.1 bits (80), Expect = 3.5, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F Q + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTTMMGQAMVESMQGKSP 197 >gi|168049451|ref|XP_001777176.1| predicted protein [Physcomitrella patens subsp. patens] gi|162671404|gb|EDQ57956.1| predicted protein [Physcomitrella patens subsp. patens] Length = 635 Score = 35.1 bits (80), Expect = 3.5, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 15/53 (28%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A +GI+ F+P + + P + +S P Sbjct: 163 ALESRATGISYVFAPCIAVCRDPR--WGRCYESYSEDPEIVRNM-TSLIDGLQ 212 >gi|116872506|ref|YP_849287.1| beta-glucosidase [Listeria welshimeri serovar 6b str. SLCC5334] gi|116741384|emb|CAK20508.1| beta-glucosidase [Listeria welshimeri serovar 6b str. SLCC5334] Length = 739 Score = 35.1 bits (80), Expect = 3.5, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK GI SP +D+ P + + F + + A+ + + Sbjct: 215 AKEYRALGITTALSPQVDIATEPR--WMRFKGTFGEDSVLSADMAKAYCEGFQN 266 >gi|168069539|ref|XP_001786487.1| predicted protein [Physcomitrella patens subsp. patens] gi|162661196|gb|EDQ48701.1| predicted protein [Physcomitrella patens subsp. patens] Length = 630 Score = 35.1 bits (80), Expect = 3.6, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 16/53 (30%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +GI F+P + + P + +S P + Sbjct: 161 ALEVRATGIPYVFAPCIAVCRDPR--WGRCYESYSEDPEVVRSMTTI-IDGLQ 210 >gi|160891565|ref|ZP_02072568.1| hypothetical protein BACUNI_04017 [Bacteroides uniformis ATCC 8492] gi|156858972|gb|EDO52403.1| hypothetical protein BACUNI_04017 [Bacteroides uniformis ATCC 8492] Length = 796 Score = 35.1 bits (80), Expect = 3.6, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A ++ G ++ SP++D++ P + + + F Sbjct: 171 AISMRKIGGMLSLSPMVDVIRNPYFN--RLEESYGEDAYLSAAMGSAFVEGLQD 222 >gi|330972031|gb|EGH72097.1| beta-hexosaminidase [Pseudomonas syringae pv. aceris str. M302273PT] Length = 215 Score = 34.8 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 9/37 (24%), Positives = 12/37 (32%), Gaps = 2/37 (5%) Query: 18 LDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +DL Y + F P +A A F R Sbjct: 1 MDLDYQRSAVVGT--RSFEGDPQRAALLAGAFIRGMN 35 >gi|212530612|ref|XP_002145463.1| beta-glucosidase, putative [Penicillium marneffei ATCC 18224] gi|210074861|gb|EEA28948.1| beta-glucosidase, putative [Penicillium marneffei ATCC 18224] Length = 777 Score = 34.8 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+ F+P+ DL + S P A E A + + Sbjct: 158 IGQEARALGVTQLFAPLADLARELRY--GRVEESNSEDPYLAGEIAYSYVKGLQ 209 >gi|119488193|ref|XP_001262639.1| glycosyl hydrolase, putative [Neosartorya fischeri NRRL 181] gi|119410797|gb|EAW20742.1| glycosyl hydrolase, putative [Neosartorya fischeri NRRL 181] Length = 856 Score = 34.8 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G +V +P ++L P + + P + R Sbjct: 90 LGEETRRKGCHVLLAPTMNLTRSPLG--GRNFEGYGEDPYLVGAMSTAMIRGIQ 141 >gi|296127583|ref|YP_003634835.1| glycoside hydrolase family 3 domain protein [Brachyspira murdochii DSM 12563] gi|296019399|gb|ADG72636.1| glycoside hydrolase family 3 domain protein [Brachyspira murdochii DSM 12563] Length = 367 Score = 34.8 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +K L+ GINV + D+ ++ FS A A+ + Sbjct: 168 SKFLLDLGINVILGSLCDIPSDSNSY--LYNRSFSANTDVAARMAEYTVKAQRD 219 >gi|154496567|ref|ZP_02035263.1| hypothetical protein BACCAP_00859 [Bacteroides capillosus ATCC 29799] gi|150274200|gb|EDN01291.1| hypothetical protein BACCAP_00859 [Bacteroides capillosus ATCC 29799] Length = 816 Score = 34.8 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G++V P L++ P + FS P A + A + R Sbjct: 90 LGEEAKAQGVSVLLGPGLNMKRSPLC--GRNFEYFSEDPYLAGKMAAAYIRGIQ 141 >gi|160881453|ref|YP_001560421.1| glycoside hydrolase family 3 protein [Clostridium phytofermentans ISDg] gi|160430119|gb|ABX43682.1| glycoside hydrolase family 3 domain protein [Clostridium phytofermentans ISDg] Length = 972 Score = 34.8 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 5/41 (12%), Positives = 14/41 (34%), Gaps = 2/41 (4%) Query: 14 FSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 ++P +D+ P + + P + A + + Sbjct: 123 WAPTIDMERDPR--WGRTEEAYGEDPYLTGKMASAYIQGMR 161 >gi|940332|gb|AAA74233.1| beta-glucosidase [Dictyostelium discoideum] Length = 820 Score = 34.8 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +K+ V GI F+PVL + P ++ F P A R + Sbjct: 213 SKDTVAVGIPWVFAPVLGIGVQPL--WSRIYETFGEDPYVASMMGAAAVRGFQ 263 >gi|260062042|ref|YP_003195122.1| beta-glucosidase [Robiginitalea biformata HTCC2501] gi|88783604|gb|EAR14775.1| beta-glucosidase [Robiginitalea biformata HTCC2501] Length = 763 Score = 34.8 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 8/46 (17%), Positives = 15/46 (32%), Gaps = 2/46 (4%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 GI+ F+P++D+ P + P R + Sbjct: 158 GIHWTFAPMVDISRDPR--WGRVMEGAGEDPYLGSRVGVARVRGFQ 201 >gi|295426556|ref|ZP_06819206.1| beta-N-acetylhexosaminidase [Lactobacillus amylolyticus DSM 11664] gi|295063924|gb|EFG54882.1| beta-N-acetylhexosaminidase [Lactobacillus amylolyticus DSM 11664] Length = 571 Score = 34.8 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 19/60 (31%), Gaps = 7/60 (11%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFS-----RIPAKAEESAQLFSRTYIKN 56 A L GIN N++P D P +FI + F + + N Sbjct: 164 ATLLNKLGINWNYAPDADYSDDPSSFI--YQRGFGGVMGKNSYRAVANYIKQVVPAWQHN 221 >gi|262040146|ref|ZP_06013399.1| periplasmic beta-glucosidase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|259042499|gb|EEW43517.1| periplasmic beta-glucosidase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] Length = 666 Score = 34.8 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KNP 57 A G+N+ ++P++D+ P + F Q + K+P Sbjct: 143 AYEAADDGLNMTWAPMVDVSRDPR--WGRASEGFGEDTYLTTMMGQAMVESMQGKSP 197 >gi|116786797|gb|ABK24242.1| unknown [Picea sitchensis] Length = 631 Score = 34.8 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 9/47 (19%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 A + +GI F+P + + P + +S P + Q+ Sbjct: 157 ALEVRATGIQYTFAPCVAVCRDPR--WGRCYESYSEDPKIVKAMTQI 201 >gi|198274480|ref|ZP_03207012.1| hypothetical protein BACPLE_00628 [Bacteroides plebeius DSM 17135] gi|198272682|gb|EDY96951.1| hypothetical protein BACPLE_00628 [Bacteroides plebeius DSM 17135] Length = 912 Score = 34.8 bits (79), Expect = 4.1, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G ++P+LD+ + ++ P E + Sbjct: 164 GREARLLGYTNVYAPILDVGRDQR--WGRYEEVYGESPYLVAELGIAMGKGLQ 214 >gi|300778220|ref|ZP_07088078.1| possible beta-glucosidase [Chryseobacterium gleum ATCC 35910] gi|300503730|gb|EFK34870.1| possible beta-glucosidase [Chryseobacterium gleum ATCC 35910] Length = 818 Score = 34.8 bits (79), Expect = 4.1, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 M + G++V +P L++ P + +S P + ++A Sbjct: 175 MGNEVKEYGVDVLLAPALNIQRNPLN--GRNFEYYSEDPLISGKTAAAIVNGVQ 226 >gi|260172895|ref|ZP_05759307.1| periplasmic beta-glucosidase precursor [Bacteroides sp. D2] gi|315921178|ref|ZP_07917418.1| conserved hypothetical protein [Bacteroides sp. D2] gi|313695053|gb|EFS31888.1| conserved hypothetical protein [Bacteroides sp. D2] Length = 761 Score = 34.8 bits (79), Expect = 4.2, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK GI FSP++D+ P + P E + + Y Sbjct: 143 AKESSADGICWTFSPMVDICRDPR--WGRMSEGGGEDPYLGSEISVAMVKGYQ 193 >gi|145594972|ref|YP_001159269.1| glycoside hydrolase family 3 protein [Salinispora tropica CNB-440] gi|145304309|gb|ABP54891.1| glycoside hydrolase, family 3 domain protein [Salinispora tropica CNB-440] Length = 1271 Score = 34.8 bits (79), Expect = 4.2, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 15/53 (28%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A+ +G +F+P + + + PA + + Sbjct: 670 AEETRATGPQWSFAPCACVARDDR--WGRTYEAYGEDPALVIAN-ETVIDGLQ 719 >gi|325264577|ref|ZP_08131307.1| thermostable beta-glucosidase B (Gentiobiase) [Clostridium sp. D5] gi|324030239|gb|EGB91524.1| thermostable beta-glucosidase B (Gentiobiase) [Clostridium sp. D5] Length = 758 Score = 34.8 bits (79), Expect = 4.2, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A + +++ P ++L P + FS P + A + KN Sbjct: 92 LAGECREAEVDILLGPGVNLKRSPLG--GRNFEYFSEDPYLTAQMAIGYINGVQKN 145 >gi|145236755|ref|XP_001391025.1| beta-glucosidase B [Aspergillus niger CBS 513.88] gi|134075486|emb|CAK48047.1| unnamed protein product [Aspergillus niger] Length = 865 Score = 34.8 bits (79), Expect = 4.2, Method: Composition-based stats. Identities = 8/56 (14%), Positives = 16/56 (28%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + G V +P ++L P + + P A R + Sbjct: 91 LGQEARRKGCQVLLAPTMNLSRSPLG--GRNFESYGEDPYLVGVIATAMIRGIQAH 144 >gi|302696291|ref|XP_003037824.1| glycoside hydrolase family 3 protein [Schizophyllum commune H4-8] gi|300111521|gb|EFJ02922.1| glycoside hydrolase family 3 protein [Schizophyllum commune H4-8] Length = 732 Score = 34.8 bits (79), Expect = 4.2, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ G+N+ P +DL P+ + F P + E+A Sbjct: 110 IAQEFRGKGVNMYLGPAMDLSRNPKG--GRNWESFGPDPYLSGEAAYETIVGVQD 162 >gi|240145730|ref|ZP_04744331.1| beta-glucosidase [Roseburia intestinalis L1-82] gi|257202146|gb|EEV00431.1| beta-glucosidase [Roseburia intestinalis L1-82] gi|291536978|emb|CBL10090.1| exo-1,4-beta-glucosidase [Roseburia intestinalis M50/1] gi|291539818|emb|CBL12929.1| exo-1,4-beta-glucosidase [Roseburia intestinalis XB6B4] Length = 955 Score = 34.8 bits (79), Expect = 4.2, Method: Composition-based stats. Identities = 7/41 (17%), Positives = 14/41 (34%), Gaps = 2/41 (4%) Query: 14 FSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 ++P +D+ P + + P E A + R Sbjct: 125 WAPTIDMERDPR--WGRTEESYGEDPYLTGEMAGAYIRGMR 163 >gi|325261193|ref|ZP_08127931.1| thermostable beta-glucosidase B (Gentiobiase) [Clostridium sp. D5] gi|324032647|gb|EGB93924.1| thermostable beta-glucosidase B (Gentiobiase) [Clostridium sp. D5] Length = 697 Score = 34.8 bits (79), Expect = 4.3, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + GIN P +++ P + FS P + + + + + Sbjct: 110 LGEEYSAYGINAILGPSMNIKRHPLC--GRNFEYFSEDPYLSGKLGSAYVKGVQE 162 >gi|322435442|ref|YP_004217654.1| glycoside hydrolase family 3 domain protein [Acidobacterium sp. MP5ACTX9] gi|321163169|gb|ADW68874.1| glycoside hydrolase family 3 domain protein [Acidobacterium sp. MP5ACTX9] Length = 740 Score = 34.8 bits (79), Expect = 4.3, Method: Composition-based stats. Identities = 5/54 (9%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + G ++ P +++ P + + P + A + + Sbjct: 133 IGQEVAAVGRDMILGPTVNIHRTPL--WGRNFESYGEDPYLSGRMAVGYIKGVQ 184 >gi|148271261|ref|YP_001220822.1| putative beta-glucosidase/beta-xylosidase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] gi|147829191|emb|CAN00102.1| putative beta-glucosidase/beta-xylosidase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] Length = 612 Score = 34.8 bits (79), Expect = 4.4, Method: Composition-based stats. Identities = 10/58 (17%), Positives = 19/58 (32%), Gaps = 9/58 (15%) Query: 1 MAK-NLVTSGINVNFSPVLDLLYGPETFIAQKRS---IFSRIPAKAEESAQLFSRTYI 54 +A+ GI++ P +DL P + F P A + + + Sbjct: 166 IARDEYRAVGISMALHPQVDLASEP-----RWTRQLQSFGADPDLAVDYTTAYLEGFQ 218 >gi|270489624|ref|ZP_06206698.1| glycosyl hydrolase family 3 N-terminal domain protein [Yersinia pestis KIM D27] gi|270338128|gb|EFA48905.1| glycosyl hydrolase family 3 N-terminal domain protein [Yersinia pestis KIM D27] Length = 372 Score = 34.8 bits (79), Expect = 4.4, Method: Composition-based stats. Identities = 5/54 (9%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + G+++ P +++ P + F+ P + Sbjct: 124 IGDEAKQYGVDLILGPAINIQRHPLN--GRNFEYFTEDPLLNAIMTASYIDGMQ 175 >gi|94494945|ref|ZP_01301526.1| Beta-glucosidase [Sphingomonas sp. SKA58] gi|94425211|gb|EAT10231.1| Beta-glucosidase [Sphingomonas sp. SKA58] Length = 808 Score = 34.8 bits (79), Expect = 4.4, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + SGI F+P L + + ++ PA + A Sbjct: 175 AAEIAGSGIEWTFAPTLAVPQDLR--WGRSYEGYAADPALVKSYATAMVDGLQ 225 >gi|313633780|gb|EFS00520.1| periplasmic beta-glucosidase/beta-xylosidase [Listeria seeligeri FSL N1-067] Length = 739 Score = 34.8 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Query: 1 MAK-NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A GI SP +D+ P + F + + A+ + + Sbjct: 213 IASLEYRALGITTALSPQVDIATEPR--WMRFNGTFGEDGELSADMAKAYCEGFQN 266 >gi|289811953|ref|ZP_06542582.1| beta-hexosaminidase [Salmonella enterica subsp. enterica serovar Typhi str. AG3] Length = 94 Score = 34.8 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 12/42 (28%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Query: 14 FSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 F+PVLD+ + I + PAKA A F Sbjct: 1 FAPVLDVGH-ISAAIG--ERSYHADPAKALAMATRFIDGMHD 39 >gi|255282879|ref|ZP_05347434.1| thermostable beta-glucosidase B [Bryantella formatexigens DSM 14469] gi|255266653|gb|EET59858.1| thermostable beta-glucosidase B [Bryantella formatexigens DSM 14469] Length = 801 Score = 34.8 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + ++G++V P +++ P + FS P A E F + Sbjct: 115 LGRECQSTGVHVLLGPGVNIKRSPLC--GRNFEYFSEDPYLAGELGAAFVKGVQ 166 >gi|160884779|ref|ZP_02065782.1| hypothetical protein BACOVA_02769 [Bacteroides ovatus ATCC 8483] gi|156109814|gb|EDO11559.1| hypothetical protein BACOVA_02769 [Bacteroides ovatus ATCC 8483] Length = 745 Score = 34.8 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A GI+ F+P++D+ + + A+ + Sbjct: 143 ASETSAYGIHWTFAPMVDIARDAR--WGRGMEGAGEDTWYGSQVAKARIEGFQ 193 >gi|269954920|ref|YP_003324709.1| beta-N-acetylhexosaminidase [Xylanimonas cellulosilytica DSM 15894] gi|269303601|gb|ACZ29151.1| Beta-N-acetylhexosaminidase [Xylanimonas cellulosilytica DSM 15894] Length = 418 Score = 34.8 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 9/40 (22%), Positives = 14/40 (35%), Gaps = 4/40 (10%) Query: 2 AKNLVTSGINVNFSPVLDL----LYGPETFIAQKRSIFSR 37 L +G++VN PV DL + I + Sbjct: 199 GAQLAAAGVDVNLGPVADLVPADIGAANPPIGAFDRNYGS 238 >gi|160884764|ref|ZP_02065767.1| hypothetical protein BACOVA_02753 [Bacteroides ovatus ATCC 8483] gi|156109799|gb|EDO11544.1| hypothetical protein BACOVA_02753 [Bacteroides ovatus ATCC 8483] Length = 746 Score = 34.8 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 9/48 (18%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 G++ F+P++D+ P + A+ R Y N Sbjct: 153 GLHWTFAPMIDVSRDPR--WGRVLEGAGEDTWLTSRVAEAKVRGYQWN 198 >gi|163851937|ref|YP_001639980.1| glycoside hydrolase family 3 protein [Methylobacterium extorquens PA1] gi|163663542|gb|ABY30909.1| glycoside hydrolase family 3 domain protein [Methylobacterium extorquens PA1] Length = 743 Score = 34.8 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 7/52 (13%), Positives = 12/52 (23%), Gaps = 2/52 (3%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 G+N FSP+ D+ + P + Sbjct: 135 ESAMVGLNWTFSPMADVARDLR--WGRVVEGLGEDPWLTGRLTAAQVEGFRD 184 >gi|304395778|ref|ZP_07377661.1| glycoside hydrolase family 3 domain protein [Pantoea sp. aB] gi|304357072|gb|EFM21436.1| glycoside hydrolase family 3 domain protein [Pantoea sp. aB] Length = 765 Score = 34.8 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G+N+ ++P++D+ P + F E + ++ Sbjct: 143 AYEAADDGLNMTWAPMVDVSREPR--WGRGSEGFGEDTYLTSEMGRSMVQSMQ 193 >gi|298387073|ref|ZP_06996627.1| beta-glucosidase [Bacteroides sp. 1_1_14] gi|298260223|gb|EFI03093.1| beta-glucosidase [Bacteroides sp. 1_1_14] Length = 825 Score = 34.8 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 6/55 (10%), Positives = 15/55 (27%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + ++ INV P +++ P + P + + Sbjct: 108 LGRDCRARNINVILGPAVNIYRAPMC--GRNFEYMGEDPYLTSRICVGYIKGVQD 160 >gi|253568949|ref|ZP_04846359.1| beta-glucosidase [Bacteroides sp. 1_1_6] gi|251840968|gb|EES69049.1| beta-glucosidase [Bacteroides sp. 1_1_6] Length = 825 Score = 34.8 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 6/55 (10%), Positives = 15/55 (27%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + ++ INV P +++ P + P + + Sbjct: 108 LGRDCRARNINVILGPAVNIYRAPMC--GRNFEYMGEDPYLTSRICVGYIKGVQD 160 >gi|29348709|ref|NP_812212.1| beta-glucosidase [Bacteroides thetaiotaomicron VPI-5482] gi|29340615|gb|AAO78406.1| beta-glucosidase [Bacteroides thetaiotaomicron VPI-5482] Length = 825 Score = 34.8 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 6/55 (10%), Positives = 15/55 (27%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + ++ INV P +++ P + P + + Sbjct: 108 LGRDCRARNINVILGPAVNIYRAPMC--GRNFEYMGEDPYLTSRICVGYIKGVQD 160 >gi|261368964|ref|ZP_05981847.1| beta-glucosidase [Subdoligranulum variabile DSM 15176] gi|282568918|gb|EFB74453.1| beta-glucosidase [Subdoligranulum variabile DSM 15176] Length = 808 Score = 34.8 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + + V P L+ P + FS P A + A + R +N Sbjct: 89 LGQEAAAQDVAVVLGPGLNTKRSPLC--GRNFEYFSEDPYLAGKMAAAYIRGIQEN 142 >gi|153807033|ref|ZP_01959701.1| hypothetical protein BACCAC_01310 [Bacteroides caccae ATCC 43185] gi|149130153|gb|EDM21363.1| hypothetical protein BACCAC_01310 [Bacteroides caccae ATCC 43185] Length = 786 Score = 34.8 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G ++P+LD+ P + + P A E + Sbjct: 183 ADEAKALGYTNIYAPILDIAQDPR--WGRVVESYGEDPYLAGELGKQMILGLQ 233 >gi|313638372|gb|EFS03582.1| periplasmic beta-glucosidase/beta-xylosidase [Listeria seeligeri FSL S4-171] Length = 739 Score = 34.4 bits (78), Expect = 4.7, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 AK GI SP +D+ P + F + + A+ + + Sbjct: 214 AKEYRALGIVTALSPQIDIATEPR--WMRFSGTFGEDSRLSADLAKAYCEGFQN 265 >gi|304384572|ref|ZP_07366918.1| beta-glucosidase [Pediococcus acidilactici DSM 20284] gi|304328766|gb|EFL95986.1| beta-glucosidase [Pediococcus acidilactici DSM 20284] Length = 746 Score = 34.4 bits (78), Expect = 4.7, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK +G++V FSP+LDL+ P + A+E + R Y Sbjct: 132 AKESYQNGLHVVFSPMLDLVRDPR--WGRVMESPGEDVYTAKEFGRHVVRGYQ 182 >gi|66801003|ref|XP_629427.1| beta glucosidase [Dictyostelium discoideum AX4] gi|221272026|sp|Q23892|GLUA_DICDI RecName: Full=Lysosomal beta glucosidase; Flags: Precursor gi|60462754|gb|EAL60954.1| beta glucosidase [Dictyostelium discoideum AX4] Length = 821 Score = 34.4 bits (78), Expect = 4.7, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +K+ V GI F+PVL + P ++ F P A R + Sbjct: 213 SKDTVAVGIPWVFAPVLGIGVQPL--WSRIYETFGEDPYVASMMGAAAVRGFQ 263 >gi|312890722|ref|ZP_07750256.1| glycoside hydrolase family 3 domain protein [Mucilaginibacter paludis DSM 18603] gi|311296888|gb|EFQ74023.1| glycoside hydrolase family 3 domain protein [Mucilaginibacter paludis DSM 18603] Length = 754 Score = 34.4 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 8/46 (17%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 GI+ F+P++D+ P + P + A + + Sbjct: 156 GIHWTFAPMVDISRDPR--WGRVMEGAGEDPYLGSQIAIARVKGFQ 199 >gi|300783220|ref|YP_003763511.1| beta-glucosidase [Amycolatopsis mediterranei U32] gi|299792734|gb|ADJ43109.1| beta-glucosidase [Amycolatopsis mediterranei U32] Length = 610 Score = 34.4 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 9/47 (19%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 A+ + +GI+ +F+P L + + F +P A + + Sbjct: 159 AEEVSGTGIDWDFAPCLCVARNDR--WGRTYESFGEVPQLATQMTSI 203 >gi|254561655|ref|YP_003068750.1| glycoside hydrolase, family 3, N-terminal and C-terminal domain [Methylobacterium extorquens DM4] gi|254268933|emb|CAX24894.1| putative Glycoside hydrolase, family 3, N-terminal and C-terminal domain (bglX-like) [Methylobacterium extorquens DM4] Length = 743 Score = 34.4 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 7/52 (13%), Positives = 12/52 (23%), Gaps = 2/52 (3%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 G+N FSP+ D+ + P + Sbjct: 135 ESAIVGLNWTFSPMADVARDLR--WGRVVEGLGEDPWLTGRLTAAQVEGFRD 184 >gi|115437930|ref|XP_001217936.1| conserved hypothetical protein [Aspergillus terreus NIH2624] gi|114188751|gb|EAU30451.1| conserved hypothetical protein [Aspergillus terreus NIH2624] Length = 795 Score = 34.4 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G+N F+P + + +FS P A E +++ Sbjct: 160 IGQEARALGVNQVFAPNFKQATDGPSQV---EEMFSEDPYLAGEMGYHYTKGLQ 210 >gi|261366314|ref|ZP_05979197.1| thermostable beta-glucosidase B [Subdoligranulum variabile DSM 15176] gi|282571913|gb|EFB77448.1| thermostable beta-glucosidase B [Subdoligranulum variabile DSM 15176] Length = 756 Score = 34.4 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + SG+ V P +++ P + +S P A E A F + Sbjct: 90 LGREARASGVGVVLGPAINIKRSPLC--GRNFEYYSEDPFLAGELAAGFIQGVQ 141 >gi|46115136|ref|XP_383586.1| hypothetical protein FG03410.1 [Gibberella zeae PH-1] Length = 831 Score = 34.4 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + G++V +P L L P I + F P + + + Sbjct: 80 LGEEAKYRGVHVLLAPTLCLQRSPL--IGRGFEAFGEDPFLSGTLGAHYINGVQE 132 >gi|218679369|ref|ZP_03527266.1| putative glycoside hydrolase protein [Rhizobium etli CIAT 894] Length = 210 Score = 34.4 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 6/49 (12%), Positives = 13/49 (26%), Gaps = 2/49 (4%) Query: 6 VTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 G+ + +PV D++ G + + F Sbjct: 2 RALGVTLFLAPVADVVTG-TNPW-LENRTMGTNAIAVARLVEAFVAGVQ 48 >gi|285017996|ref|YP_003375707.1| glycosidase [Xanthomonas albilineans GPE PC73] gi|283473214|emb|CBA15719.1| hypothetical glycosidase protein [Xanthomonas albilineans] Length = 865 Score = 34.4 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A T+G+ F+P + + + + +S P A Sbjct: 194 AAETRTTGMEWTFAPTVAV--PQDDRWGRTYEGYSESPEVVSSFAGKMVEGLQ 244 >gi|281421895|ref|ZP_06252894.1| beta-glucosidase [Prevotella copri DSM 18205] gi|281404137|gb|EFB34817.1| beta-glucosidase [Prevotella copri DSM 18205] Length = 789 Score = 34.4 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK GIN FSP++D+ + P + ++ Y Sbjct: 156 AKEASADGINWTFSPMVDIALDAR--WGRISEGNGEDPYLSGVMGAAMTQGYQ 206 >gi|290962043|ref|YP_003493225.1| glycosyl hydrolase [Streptomyces scabiei 87.22] gi|260651569|emb|CBG74693.1| putative glycosyl hydrolase [Streptomyces scabiei 87.22] Length = 611 Score = 34.4 bits (78), Expect = 5.2, Method: Composition-based stats. Identities = 8/52 (15%), Positives = 16/52 (30%), Gaps = 2/52 (3%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + GI + P +DL P A++ F + + + Sbjct: 169 EEYRAVGIRMALHPQVDLASEPR--WARQLQTFGADTDLVVAYTRAYLEGFQ 218 >gi|288927802|ref|ZP_06421649.1| thermostable beta-glucosidase B (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Prevotella sp. oral taxon 317 str. F0108] gi|288330636|gb|EFC69220.1| thermostable beta-glucosidase B (Gentiobiase)(Cellobiase) (Beta-D-glucoside glucohydrolase) [Prevotella sp. oral taxon 317 str. F0108] Length = 743 Score = 34.4 bits (78), Expect = 5.2, Method: Composition-based stats. Identities = 7/56 (12%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + G ++ P +++ P + P A + A + + N Sbjct: 124 LGEEARYRGKDMVLGPGVNIYRTPLN--GRNFEYMGEDPYLAGQMAVPYIQGIQSN 177 >gi|281424177|ref|ZP_06255090.1| beta-glucosidase [Prevotella oris F0302] gi|281401446|gb|EFB32277.1| beta-glucosidase [Prevotella oris F0302] Length = 743 Score = 34.4 bits (78), Expect = 5.2, Method: Composition-based stats. Identities = 7/56 (12%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + G ++ P +++ P + P A + A + + N Sbjct: 124 LGEEARYRGKDMVLGPGVNIYRTPLN--GRNFEYMGEDPYLAGQMAVPYIQGIQSN 177 >gi|302872955|ref|YP_003841588.1| glycoside hydrolase family 3 domain-containing protein [Clostridium cellulovorans 743B] gi|307686530|ref|ZP_07628976.1| glycoside hydrolase family 3 domain-containing protein [Clostridium cellulovorans 743B] gi|302575812|gb|ADL49824.1| glycoside hydrolase family 3 domain protein [Clostridium cellulovorans 743B] Length = 687 Score = 34.4 bits (78), Expect = 5.3, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + G +V +P +++L P + S P A + +N Sbjct: 95 LGNEARGRGKDVILAPGVNILRSP--VCGRNYEYISEDPYLTARMAVAIIKGIQEN 148 >gi|332826548|gb|EGJ99377.1| hypothetical protein HMPREF9455_00410 [Dysgonomonas gadei ATCC BAA-286] Length = 957 Score = 34.4 bits (78), Expect = 5.3, Method: Composition-based stats. Identities = 8/41 (19%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Query: 14 FSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +SPVLD+ + + + P E + + Y Sbjct: 267 WSPVLDV--AQDARWGRCEETYGEDPVLVTEIGGAWIKGYQ 305 >gi|328869381|gb|EGG17759.1| beta glucosidase [Dictyostelium fasciculatum] Length = 832 Score = 34.4 bits (78), Expect = 5.5, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 18/58 (31%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI--KNP 57 AK+ + GI F+PVL + P F P A NP Sbjct: 228 AKDTSSVGIPWIFAPVLGIGVQPLWPRI--YETFGEDPLVAAVMGAATVAGLQGDNNP 283 >gi|306009399|gb|ADM73753.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009401|gb|ADM73754.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009403|gb|ADM73755.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009405|gb|ADM73756.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009407|gb|ADM73757.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009409|gb|ADM73758.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009411|gb|ADM73759.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009413|gb|ADM73760.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009415|gb|ADM73761.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009417|gb|ADM73762.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009419|gb|ADM73763.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009421|gb|ADM73764.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009423|gb|ADM73765.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009425|gb|ADM73766.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009427|gb|ADM73767.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009429|gb|ADM73768.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009431|gb|ADM73769.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009433|gb|ADM73770.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009443|gb|ADM73775.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009447|gb|ADM73777.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009449|gb|ADM73778.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009451|gb|ADM73779.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009453|gb|ADM73780.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009455|gb|ADM73781.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009457|gb|ADM73782.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009459|gb|ADM73783.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009461|gb|ADM73784.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009463|gb|ADM73785.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009465|gb|ADM73786.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009467|gb|ADM73787.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009469|gb|ADM73788.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009471|gb|ADM73789.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009473|gb|ADM73790.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009475|gb|ADM73791.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009477|gb|ADM73792.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009479|gb|ADM73793.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009481|gb|ADM73794.1| glycosyl hydrolase-like protein [Picea sitchensis] Length = 481 Score = 34.4 bits (78), Expect = 5.6, Method: Composition-based stats. Identities = 9/47 (19%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 A + +GI F+P + + P + +S P + Q+ Sbjct: 89 ALEVRATGIQYTFAPCVAVCRDPR--WGRCYESYSEDPKIVKAMTQI 133 >gi|302551134|ref|ZP_07303476.1| beta-glucosidase [Streptomyces viridochromogenes DSM 40736] gi|302468752|gb|EFL31845.1| beta-glucosidase [Streptomyces viridochromogenes DSM 40736] Length = 830 Score = 34.4 bits (78), Expect = 5.6, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +A+ G++V +P ++L P + +S P + R Sbjct: 110 LAQEARRKGVHVLLAPTVNLHRSPLG--GRHFEAYSEDPYLTGRIGTEYVRGVQ 161 >gi|225872380|ref|YP_002753835.1| glycosyl hydrolase, family 3 [Acidobacterium capsulatum ATCC 51196] gi|225791216|gb|ACO31306.1| glycosyl hydrolase, family 3 [Acidobacterium capsulatum ATCC 51196] Length = 361 Score = 34.4 bits (78), Expect = 5.6, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 + K +G N +PV+DL + + + S +P + + A F Sbjct: 112 IGKAAHMAGFNATLAPVVDLALPNSAGVMKT-RVVSALPHEVRQYALTFLEGL 163 >gi|306009445|gb|ADM73776.1| glycosyl hydrolase-like protein [Picea sitchensis] Length = 481 Score = 34.4 bits (78), Expect = 5.6, Method: Composition-based stats. Identities = 9/47 (19%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 A + +GI F+P + + P + +S P + Q+ Sbjct: 89 ALEVRATGIQYTFAPCVAVCRDPR--WGRCYESYSEDPKIVKAMTQI 133 >gi|306009439|gb|ADM73773.1| glycosyl hydrolase-like protein [Picea sitchensis] gi|306009441|gb|ADM73774.1| glycosyl hydrolase-like protein [Picea sitchensis] Length = 481 Score = 34.4 bits (78), Expect = 5.6, Method: Composition-based stats. Identities = 9/47 (19%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 A + +GI F+P + + P + +S P + Q+ Sbjct: 89 ALEVRATGIQYTFAPCVAVCRDPR--WGRCYESYSEDPKIVKAMTQI 133 >gi|306009437|gb|ADM73772.1| glycosyl hydrolase-like protein [Picea sitchensis] Length = 481 Score = 34.4 bits (78), Expect = 5.7, Method: Composition-based stats. Identities = 9/47 (19%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 A + +GI F+P + + P + +S P + Q+ Sbjct: 89 ALEVRATGIQYTFAPCVAVCRDPR--WGRCYESYSEDPKIVKAMTQI 133 >gi|306009435|gb|ADM73771.1| glycosyl hydrolase-like protein [Picea sitchensis] Length = 481 Score = 34.4 bits (78), Expect = 5.7, Method: Composition-based stats. Identities = 9/47 (19%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 A + +GI F+P + + P + +S P + Q+ Sbjct: 89 ALEVRATGIQYTFAPCVAVCRDPR--WGRCYESYSEDPKIVKAMTQI 133 >gi|262194494|ref|YP_003265703.1| glycoside hydrolase [Haliangium ochraceum DSM 14365] gi|262077841|gb|ACY13810.1| glycoside hydrolase family 3 domain protein [Haliangium ochraceum DSM 14365] Length = 644 Score = 34.4 bits (78), Expect = 5.7, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 16/53 (30%), Gaps = 3/53 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK + +GI +F+P L + + F P F Sbjct: 188 AKEVYATGIRWDFAPTLCVGRDER--WGRTYECFGEHPE-VPAMMSSFIDGLQ 237 >gi|60738769|gb|AAX35883.1| BglY [Paenibacillus sp. C7] Length = 756 Score = 34.4 bits (78), Expect = 5.8, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 +K GI SP +D+ P ++ F + + + + + Sbjct: 212 SKEYRALGIATALSPQIDIATDPR--WSRFDGTFGEDSKLSVDLTRAYIDGFQ 262 >gi|319952040|ref|YP_004163307.1| beta-glucosidase [Cellulophaga algicola DSM 14237] gi|319420700|gb|ADV47809.1| Beta-glucosidase [Cellulophaga algicola DSM 14237] Length = 754 Score = 34.4 bits (78), Expect = 5.9, Method: Composition-based stats. Identities = 9/49 (18%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 GIN F+P++D+ + P + A + + N Sbjct: 149 GINWTFAPMIDISRDAR--WGRVMEGAGEDPYLGSKIAYARVKGFQGDN 195 >gi|315652708|ref|ZP_07905682.1| family 3 glycosyl hydrolase [Eubacterium saburreum DSM 3986] gi|315484910|gb|EFU75318.1| family 3 glycosyl hydrolase [Eubacterium saburreum DSM 3986] Length = 810 Score = 34.4 bits (78), Expect = 6.0, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + +NV P +++ P + +S P + + A R N Sbjct: 90 LGAEAAAEDVNVLLGPGINIKRNPLC--GRNFEYYSEDPYLSGKLAAAMIRGIQSN 143 >gi|330917875|ref|XP_003297995.1| hypothetical protein PTT_08572 [Pyrenophora teres f. teres 0-1] gi|311329043|gb|EFQ93907.1| hypothetical protein PTT_08572 [Pyrenophora teres f. teres 0-1] Length = 635 Score = 34.4 bits (78), Expect = 6.1, Method: Composition-based stats. Identities = 7/54 (12%), Positives = 13/54 (24%), Gaps = 3/54 (5%) Query: 1 MAK-NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 +A+ GI P +D+ P E + + Sbjct: 188 IARQEYKAVGIRSALHPQIDVATEPRWSRIGG--TMGENATLIAELVVAYINGF 239 >gi|254292585|ref|YP_003058608.1| glycoside hydrolase [Hirschia baltica ATCC 49814] gi|254041116|gb|ACT57911.1| glycoside hydrolase family 3 domain protein [Hirschia baltica ATCC 49814] Length = 850 Score = 34.4 bits (78), Expect = 6.1, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 AK L SG + F+P L + + FS+ P E + Sbjct: 193 AKALTISGHDWTFAPTLAVPRDAR--WGRTYEGFSQSPEIVSEYSARIVEGLQ 243 >gi|284165671|ref|YP_003403950.1| glycoside hydrolase [Haloterrigena turkmenica DSM 5511] gi|284015326|gb|ADB61277.1| glycoside hydrolase family 3 domain protein [Haloterrigena turkmenica DSM 5511] Length = 860 Score = 34.0 bits (77), Expect = 6.2, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK 58 ++ G + NF P LD+L + S E + +R + +N + Sbjct: 182 GDSVAAIGGHWNFGPTLDVLRDMR--WGRYFEGHSEDAMLLGEMGRARARGFQRNER 236 >gi|281209073|gb|EFA83248.1| hypothetical protein PPL_04038 [Polysphondylium pallidum PN500] Length = 809 Score = 34.0 bits (77), Expect = 6.2, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK--NP 57 K+ G FSPVL L P ++ FS P A + + R + NP Sbjct: 207 GKDSAACGFPWVFSPVLGLGVQPM--WSRMYETFSEDPFVASQLGEASVRGLQRDSNP 262 >gi|146301134|ref|YP_001195725.1| glycoside hydrolase family 3 protein [Flavobacterium johnsoniae UW101] gi|146155552|gb|ABQ06406.1| Candidate beta-glucosidase; Glycoside hydrolase family 3 [Flavobacterium johnsoniae UW101] Length = 814 Score = 34.0 bits (77), Expect = 6.3, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 M + G++V +P L++ P + +S P + + A + N Sbjct: 172 MGNEVKEYGVDVLLAPALNIHRNPLC--GRNFEYYSEDPLVSGKIASAMVKGIQLN 225 >gi|268609208|ref|ZP_06142935.1| beta-N-acetylhexosaminidase [Ruminococcus flavefaciens FD-1] Length = 632 Score = 34.0 bits (77), Expect = 6.3, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A + N+SPVL P + F + + +++ + Sbjct: 182 ADEAKICHMLWNYSPVLAQSVDPR--WGRTYESFGSDLDTIQTLSTAYTKGLVD 233 >gi|154487613|ref|ZP_02029020.1| hypothetical protein BIFADO_01470 [Bifidobacterium adolescentis L2-32] gi|154083742|gb|EDN82787.1| hypothetical protein BIFADO_01470 [Bifidobacterium adolescentis L2-32] Length = 811 Score = 34.0 bits (77), Expect = 6.3, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + K +NV P +++ P + +S P A A R N Sbjct: 86 LGKEAHDLDVNVLLGPGMNIKRNPLC--GRNFEYYSEDPIVAGRMAAGLIRGIQSN 139 >gi|146301600|ref|YP_001196191.1| glycoside hydrolase family 3 protein [Flavobacterium johnsoniae UW101] gi|146156018|gb|ABQ06872.1| Candidate beta-glucosidase; Glycoside hydrolase family 3 [Flavobacterium johnsoniae UW101] Length = 759 Score = 34.0 bits (77), Expect = 6.3, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A SG+N F+P +D+ + + P + A + + Sbjct: 150 ALEASASGLNWTFAPNVDI--SNDARWGRVMEGAGEDPYLGSKIATARVKGFQ 200 >gi|119026616|ref|YP_910461.1| putative glycosyl hydrolase [Bifidobacterium adolescentis ATCC 15703] gi|118766200|dbj|BAF40379.1| putative glycosyl hydrolase [Bifidobacterium adolescentis ATCC 15703] Length = 811 Score = 34.0 bits (77), Expect = 6.3, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + K +NV P +++ P + +S P A A R N Sbjct: 86 LGKEAHDLDVNVLLGPGMNIKRNPLC--GRNFEYYSEDPIVAGRMAAGLIRGIQSN 139 >gi|113476474|ref|YP_722535.1| beta-glucosidase [Trichodesmium erythraeum IMS101] gi|110167522|gb|ABG52062.1| beta-glucosidase [Trichodesmium erythraeum IMS101] Length = 40 Score = 34.0 bits (77), Expect = 6.3, Method: Composition-based stats. Identities = 7/38 (18%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Query: 12 VNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLF 49 + +PV+D+ P+ + F A + +++F Sbjct: 3 LVLAPVVDVNNNPDNPVINI-RAFGETTASVGQFSRVF 39 >gi|260951451|ref|XP_002620022.1| hypothetical protein CLUG_01181 [Clavispora lusitaniae ATCC 42720] gi|238847594|gb|EEQ37058.1| hypothetical protein CLUG_01181 [Clavispora lusitaniae ATCC 42720] Length = 844 Score = 34.0 bits (77), Expect = 6.5, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 M+K G++ P ++ GP + +S P + Sbjct: 86 MSKEAKMKGVHCILGPTCNIARGPLG--GRAFESYSEDPVLSGHIVSAVINGIQD 138 >gi|292656216|ref|YP_003536113.1| xylosidase/arabinosidase [Haloferax volcanii DS2] gi|291370767|gb|ADE02994.1| xylosidase/arabinosidase [Haloferax volcanii DS2] Length = 745 Score = 34.0 bits (77), Expect = 6.6, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A + +G N N++P D+ P + + + E +R Sbjct: 149 AVEMAATGANQNYAPTADVAREPR--WGRTYETYGESSSLVEAFVAAETRGLQ 199 >gi|256783935|ref|ZP_05522366.1| beta-glucosidase [Streptomyces lividans TK24] gi|289767820|ref|ZP_06527198.1| beta-glucosidase [Streptomyces lividans TK24] gi|289698019|gb|EFD65448.1| beta-glucosidase [Streptomyces lividans TK24] Length = 305 Score = 34.0 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 17/56 (30%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A G++V +P L+L P + S P R + Sbjct: 88 LAAEARRKGVDVLLAPTLNLHRSPLG--GRHFECLSEDPELTGRIGAALVRGIQAH 141 >gi|21224897|ref|NP_630676.1| beta-glucosidase [Streptomyces coelicolor A3(2)] gi|3288618|emb|CAA19790.1| putative beta-glucosidase [Streptomyces coelicolor A3(2)] Length = 859 Score = 34.0 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 17/56 (30%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 +A G++V +P L+L P + S P R + Sbjct: 88 LAAEARRKGVDVLLAPTLNLHRSPLG--GRHFECLSEDPELTGRIGAALVRGIQAH 141 >gi|148272127|ref|YP_001221688.1| putative beta-glycosidase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] gi|147830057|emb|CAN00986.1| putative beta-glycosidase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] Length = 620 Score = 34.0 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 8/52 (15%), Positives = 15/52 (28%), Gaps = 2/52 (3%) Query: 3 KNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + V GI P +DL P ++ + E + + Sbjct: 174 QEYVAVGIRAALHPQIDLATEPR--WGRQAQTLGHDADRVAEFTAAYLEGFQ 223 >gi|298482587|ref|ZP_07000772.1| xylosidase [Bacteroides sp. D22] gi|295085727|emb|CBK67250.1| Beta-glucosidase-related glycosidases [Bacteroides xylanisolvens XB1A] gi|298271294|gb|EFI12870.1| xylosidase [Bacteroides sp. D22] Length = 800 Score = 34.0 bits (77), Expect = 6.8, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +SP+LD+ P + + P A E + Sbjct: 197 ANEAKALGYTNIYSPILDIAQDPR--WGRVVESYGEDPYLAGELGKQMILGLQ 247 >gi|237721943|ref|ZP_04552424.1| glycoside hydrolase family 3 protein [Bacteroides sp. 2_2_4] gi|229448812|gb|EEO54603.1| glycoside hydrolase family 3 protein [Bacteroides sp. 2_2_4] Length = 792 Score = 34.0 bits (77), Expect = 6.9, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 A G +SP+LD+ P + + P A E + Sbjct: 189 ANEAKALGYTNIYSPILDIAQDPR--WGRVVESYGEDPYLAGELGKQMILGLQN 240 >gi|154506102|ref|ZP_02042840.1| hypothetical protein RUMGNA_03644 [Ruminococcus gnavus ATCC 29149] gi|153793601|gb|EDN76021.1| hypothetical protein RUMGNA_03644 [Ruminococcus gnavus ATCC 29149] Length = 811 Score = 34.0 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + G++V P L++ P + FS P A + A + R Sbjct: 90 LGEEASALGVDVLLGPGLNIKRSPLC--GRNFEYFSEDPYLAGKMAASYVRGIQ 141 >gi|302534258|ref|ZP_07286600.1| beta-glucosidase [Streptomyces sp. C] gi|302443153|gb|EFL14969.1| beta-glucosidase [Streptomyces sp. C] Length = 841 Score = 34.0 bits (77), Expect = 7.1, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 +A+ G++V +P ++L P + +S P + Sbjct: 121 LAQEARRKGVHVLLAPTVNLHRSPLG--GRHFECYSEDPYLTGAIGSGYVNGVQD 173 >gi|305663349|ref|YP_003859637.1| glycoside hydrolase family 3 domain protein [Ignisphaera aggregans DSM 17230] gi|304377918|gb|ADM27757.1| glycoside hydrolase family 3 domain protein [Ignisphaera aggregans DSM 17230] Length = 757 Score = 34.0 bits (77), Expect = 7.4, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + ++ G +PVLDL P + + A + + Sbjct: 129 IRRQIMAIGSRHTLAPVLDLCREPR--WGRCEETYGEDSYLAASMGIAYVKGIQ 180 >gi|262405837|ref|ZP_06082387.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] gi|294647798|ref|ZP_06725350.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides ovatus SD CC 2a] gi|294806192|ref|ZP_06765039.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides xylanisolvens SD CC 1b] gi|262356712|gb|EEZ05802.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] gi|292636706|gb|EFF55172.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides ovatus SD CC 2a] gi|294446448|gb|EFG15068.1| glycosyl hydrolase family 3 C-terminal domain protein [Bacteroides xylanisolvens SD CC 1b] Length = 800 Score = 34.0 bits (77), Expect = 7.4, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +SP+LD+ P + + P A E + Sbjct: 197 ANEAKALGYTNIYSPILDIAQDPR--WGRVVESYGEDPYLAGELGKQMILGLQ 247 >gi|237717069|ref|ZP_04547550.1| glycoside hydrolase family beta-glycosidase [Bacteroides sp. D1] gi|229443052|gb|EEO48843.1| glycoside hydrolase family beta-glycosidase [Bacteroides sp. D1] Length = 792 Score = 34.0 bits (77), Expect = 7.5, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 A G +SP+LD+ P + + P A E + Sbjct: 189 ANEAKALGYTNIYSPILDIAQDPR--WGRVVESYGEDPYLAGELGKQMILGLQ 239 >gi|225423533|ref|XP_002271545.1| PREDICTED: hypothetical protein [Vitis vinifera] Length = 627 Score = 34.0 bits (77), Expect = 7.7, Method: Composition-based stats. Identities = 8/47 (17%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 A + +GI F+P + + P + +S P + + Sbjct: 154 ALEVRATGIQYAFAPCIAVCRDPR--WGRCYESYSEDPKIVKAMTTI 198 >gi|171741910|ref|ZP_02917717.1| hypothetical protein BIFDEN_01009 [Bifidobacterium dentium ATCC 27678] gi|283457066|ref|YP_003361630.1| beta-glucosidase [Bifidobacterium dentium Bd1] gi|171277524|gb|EDT45185.1| hypothetical protein BIFDEN_01009 [Bifidobacterium dentium ATCC 27678] gi|283103700|gb|ADB10806.1| bgl4 Beta-glucosidase [Bifidobacterium dentium Bd1] Length = 809 Score = 34.0 bits (77), Expect = 7.7, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + K +NV P +++ P + +S P A A R N Sbjct: 86 LGKEAHDLDVNVLLGPGMNIKRNPLC--GRNFEYYSEDPVVAGRMAAGLIRGIQSN 139 >gi|312886835|ref|ZP_07746441.1| glycoside hydrolase family 3 domain protein [Mucilaginibacter paludis DSM 18603] gi|311300662|gb|EFQ77725.1| glycoside hydrolase family 3 domain protein [Mucilaginibacter paludis DSM 18603] Length = 743 Score = 34.0 bits (77), Expect = 7.8, Method: Composition-based stats. Identities = 9/46 (19%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Query: 9 GINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 GI+ F+P++D+ P + P A+ R + Sbjct: 148 GIHWTFAPMVDIARDPR--WGRIMEGAGEDPYLGSCIAEARVRGFQ 191 >gi|306824022|ref|ZP_07457395.1| beta-glucosidase [Bifidobacterium dentium ATCC 27679] gi|309800752|ref|ZP_07694887.1| putative beta-glucosidase [Bifidobacterium dentium JCVIHMP022] gi|304552675|gb|EFM40589.1| beta-glucosidase [Bifidobacterium dentium ATCC 27679] gi|308222597|gb|EFO78874.1| putative beta-glucosidase [Bifidobacterium dentium JCVIHMP022] Length = 809 Score = 34.0 bits (77), Expect = 7.8, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + K +NV P +++ P + +S P A A R N Sbjct: 86 LGKEAHDLDVNVLLGPGMNIKRNPLC--GRNFEYYSEDPVVAGRMAAGLIRGIQSN 139 >gi|169624858|ref|XP_001805834.1| hypothetical protein SNOG_15694 [Phaeosphaeria nodorum SN15] gi|160705252|gb|EAT77069.2| hypothetical protein SNOG_15694 [Phaeosphaeria nodorum SN15] Length = 1614 Score = 34.0 bits (77), Expect = 7.8, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + K GIN F+PV DL + + A E + + + Sbjct: 165 IGKESQAHGINQIFAPVADLARELR--FGRVEETYGEDGFLAGEMSYEYVKGIQ 216 >gi|328886679|emb|CCA59918.1| putative glycoside hydrolase [Streptomyces venezuelae ATCC 10712] Length = 957 Score = 33.6 bits (76), Expect = 8.1, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 26/61 (42%), Gaps = 8/61 (13%) Query: 2 AKNLVT----SGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI-KN 56 A+ + G+NV ++P ++LL P + ++ PA A F+R + Sbjct: 95 ARAMRAKDDRVGLNV-WAPTVNLLRNPL--WGRGEEGYAEDPALTAAIATAFTRGLRGDH 151 Query: 57 P 57 P Sbjct: 152 P 152 >gi|325298029|ref|YP_004257946.1| Beta-glucosidase [Bacteroides salanitronis DSM 18170] gi|324317582|gb|ADY35473.1| Beta-glucosidase [Bacteroides salanitronis DSM 18170] Length = 740 Score = 33.6 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + + + G +V P +++ P + P A E + + KN Sbjct: 129 LGEEALYRGKDVQLGPGVNIYRTPLN--GRNFEYMGEDPYLAAEMCVPYIQELQKN 182 >gi|261878665|ref|ZP_06005092.1| beta-glucosidase [Prevotella bergensis DSM 17361] gi|270334669|gb|EFA45455.1| beta-glucosidase [Prevotella bergensis DSM 17361] Length = 778 Score = 33.6 bits (76), Expect = 8.3, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + ++ G +V +P L++ P + +S P + + A + R N Sbjct: 135 IGNEVLEYGADVLLAPALNIHRNPLC--GRNFEYYSEDPVVSGKIAAAYVRGVQSN 188 >gi|297738058|emb|CBI27259.3| unnamed protein product [Vitis vinifera] Length = 533 Score = 33.6 bits (76), Expect = 8.3, Method: Composition-based stats. Identities = 8/47 (17%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQL 48 A + +GI F+P + + P + +S P + + Sbjct: 60 ALEVRATGIQYAFAPCIAVCRDPR--WGRCYESYSEDPKIVKAMTTI 104 >gi|225434674|ref|XP_002279757.1| PREDICTED: hypothetical protein [Vitis vinifera] Length = 720 Score = 33.6 bits (76), Expect = 8.8, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 17/56 (30%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A + SGI+ F+P + + P + +S + P Sbjct: 244 ALEVRASGIHYTFAPCVAVCRDPR--WGRCYESYSSDTNIVRKM-TSVITGLQGKP 296 >gi|160887865|ref|ZP_02068868.1| hypothetical protein BACUNI_00268 [Bacteroides uniformis ATCC 8492] gi|270295530|ref|ZP_06201731.1| glycoside hydrolase family 3 protein [Bacteroides sp. D20] gi|156862695|gb|EDO56126.1| hypothetical protein BACUNI_00268 [Bacteroides uniformis ATCC 8492] gi|270274777|gb|EFA20638.1| glycoside hydrolase family 3 protein [Bacteroides sp. D20] Length = 778 Score = 33.6 bits (76), Expect = 8.9, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKN 56 + ++ G +V +P L++ P + +S P + + A + R N Sbjct: 135 IGNEVLEYGADVLLAPALNIHRNPLC--GRNFEYYSEDPLVSGKIAAAYVRGIQSN 188 >gi|297153687|gb|ADI03399.1| Beta-glucosidase [Streptomyces bingchenggensis BCW-1] Length = 764 Score = 33.6 bits (76), Expect = 9.1, Method: Composition-based stats. Identities = 11/51 (21%), Positives = 15/51 (29%), Gaps = 2/51 (3%) Query: 4 NLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 L G +V LDL+ P + F P A + R Sbjct: 161 ELRARGGHVALVSALDLVRDPR--WGRAEECFGEDPYLAARLTEALVRGMR 209 >gi|255569514|ref|XP_002525724.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] gi|223535024|gb|EEF36707.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] Length = 625 Score = 33.6 bits (76), Expect = 9.4, Method: Composition-based stats. Identities = 8/48 (16%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLF 49 A + +GI F+P + + P + +S P + ++ Sbjct: 153 ALEVRATGIPYVFAPCIAVCRDPR--WGRCYESYSEDPKIVQAMTEIV 198 >gi|302910087|ref|XP_003050214.1| hypothetical protein NECHADRAFT_96422 [Nectria haematococca mpVI 77-13-4] gi|256731151|gb|EEU44501.1| hypothetical protein NECHADRAFT_96422 [Nectria haematococca mpVI 77-13-4] Length = 1174 Score = 33.6 bits (76), Expect = 9.5, Method: Composition-based stats. Identities = 8/55 (14%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIK 55 + + ++ G+N SP LD+ + P + ++ E + + Sbjct: 566 IREEQLSIGVNWVLSPPLDIAWEPRY--GRIGELYGEDSYLTGEFGHAYVQIMQD 618 >gi|297745944|emb|CBI16000.3| unnamed protein product [Vitis vinifera] Length = 586 Score = 33.6 bits (76), Expect = 9.6, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 17/56 (30%), Gaps = 3/56 (5%) Query: 2 AKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNP 57 A + SGI+ F+P + + P + +S + P Sbjct: 110 ALEVRASGIHYTFAPCVAVCRDPR--WGRCYESYSSDTNIVRKM-TSVITGLQGKP 162 >gi|150018834|ref|YP_001311088.1| glycoside hydrolase family 3 protein [Clostridium beijerinckii NCIMB 8052] gi|149905299|gb|ABR36132.1| glycoside hydrolase, family 3 domain protein [Clostridium beijerinckii NCIMB 8052] Length = 754 Score = 33.6 bits (76), Expect = 9.8, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 1 MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYI 54 + + + +N+ F P +++ P + + FS P + E F Sbjct: 85 IGEECLAENVNILFGPAVNIQRSPLS--GRNFQYFSEDPVLSGEMGAAFINGIQ 136 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.312 0.163 0.495 Lambda K H 0.267 0.0493 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 726,869,257 Number of Sequences: 14124377 Number of extensions: 25247512 Number of successful extensions: 70239 Number of sequences better than 10.0: 3355 Number of HSP's better than 10.0 without gapping: 1431 Number of HSP's successfully gapped in prelim test: 1924 Number of HSP's that attempted gapping in prelim test: 66247 Number of HSP's gapped (non-prelim): 3373 length of query: 58 length of database: 4,842,793,630 effective HSP length: 31 effective length of query: 27 effective length of database: 4,404,937,943 effective search space: 118933324461 effective search space used: 118933324461 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.1 bits) S2: 76 (33.6 bits)