RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781070|ref|YP_003065483.1| hypothetical protein CLIBASIA_04860 [Candidatus Liberibacter asiaticus str. psy62] (58 letters) >gnl|CDD|180024 PRK05337, PRK05337, beta-hexosaminidase; Provisional. Length = 337 Score = 29.7 bits (68), Expect = 0.17 Identities = 11/20 (55%), Positives = 15/20 (75%) Query: 1 MAKNLVTSGINVNFSPVLDL 20 MA L GI+++F+PVLDL Sbjct: 106 MAAELRACGIDLSFAPVLDL 125 >gnl|CDD|148509 pfam06934, CTI, Fatty acid cis/trans isomerase (CTI). This family consists of several fatty acid cis/trans isomerase proteins which appear to be found exclusively in bacteria of the orders Vibrionales and Pseudomonadales. Cis/trans isomerase (CTI) catalyses the cis-trans isomerisation of esterified fatty acids in phospholipids, mainly cis-oleic acid (C(16:1,9)) and cis-vaccenic acid (C(18:1,11)), in response to solvents. The CTI protein has been shown to be involved in solvent resistance in Pseudomonas putida. Length = 688 Score = 28.3 bits (64), Expect = 0.50 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 14/45 (31%) Query: 22 YGPET----FIAQKRSIFSRIPAKAE-----ESAQLFSRTYIKNP 57 Y PE F F IPA+A ++AQ T+IK P Sbjct: 248 YEPEVAANPFKT-----FEAIPARARYQFMLDNAQYTIMTFIKGP 287 >gnl|CDD|179276 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional. Length = 475 Score = 26.0 bits (57), Expect = 2.3 Identities = 12/27 (44%), Positives = 14/27 (51%) Query: 27 FIAQKRSIFSRIPAKAEESAQLFSRTY 53 FI Q R I + P K E LFS T+ Sbjct: 254 FIPQVRQIIRQTPRKEERQTLLFSATF 280 >gnl|CDD|179671 PRK03906, PRK03906, mannonate dehydratase; Provisional. Length = 385 Score = 25.2 bits (56), Expect = 3.8 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 3/20 (15%) Query: 3 KNLVTSGINV---NFSPVLD 19 +NL +GI V NF PV D Sbjct: 90 RNLAAAGIKVVCYNFMPVFD 109 >gnl|CDD|185215 PRK15315, PRK15315, outer membrane protein RatA; Provisional. Length = 1865 Score = 24.6 bits (53), Expect = 6.6 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 8/56 (14%) Query: 6 VTSGINVNF----SPVLDL--LYG--PETFIAQKRSIFSRIPAKAEESAQLFSRTY 53 TS + V F SP D +YG PETF A + F R E S++ + TY Sbjct: 1417 ATSSLPVVFTVLTSPDSDKANMYGHMPETFTASNGAEFKRPLVYGEPSSEAHTDTY 1472 >gnl|CDD|179884 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional. Length = 423 Score = 24.2 bits (53), Expect = 9.1 Identities = 10/26 (38%), Positives = 13/26 (50%) Query: 27 FIAQKRSIFSRIPAKAEESAQLFSRT 52 FI R +F R+P + LFS T Sbjct: 174 FIKDIRWLFRRMPPANQRLNMLFSAT 199 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.318 0.133 0.364 Gapped Lambda K H 0.267 0.0608 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 904,569 Number of extensions: 39412 Number of successful extensions: 91 Number of sequences better than 10.0: 1 Number of HSP's gapped: 91 Number of HSP's successfully gapped: 10 Length of query: 58 Length of database: 5,994,473 Length adjustment: 30 Effective length of query: 28 Effective length of database: 5,346,233 Effective search space: 149694524 Effective search space used: 149694524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.3 bits)