RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781071|ref|YP_003065484.1| hypothetical protein CLIBASIA_04865 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) >d1x38a1 c.1.8.7 (A:1-388) Beta-D-glucan exohydrolase, N-terminal domain {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 388 Score = 33.1 bits (74), Expect = 0.006 Identities = 13/44 (29%), Positives = 19/44 (43%) Query: 26 NAGADQQDPADVIELIYAHVKSGEIKPSRIESAYQRIIYLKNKM 69 + I ++ HV G I SRI+ A RI+ +K M Sbjct: 313 DMIMVPNKYQQFISILTGHVNGGVIPMSRIDDAVTRILRVKFTM 356 >d2prda_ b.40.5.1 (A:) Inorganic pyrophosphatase {Thermus thermophilus [TaxId: 274]} Length = 174 Score = 23.7 bits (51), Expect = 4.5 Identities = 7/27 (25%), Positives = 12/27 (44%) Query: 29 ADQQDPADVIELIYAHVKSGEIKPSRI 55 A+ DP D + L + G + R+ Sbjct: 63 AEDGDPLDGLVLSTYPLLPGVVVEVRV 89 >d1m2da_ c.47.1.11 (A:) Thioredoxin-like 2Fe-2S ferredoxin {Aquifex aeolicus [TaxId: 63363]} Length = 101 Score = 23.4 bits (50), Expect = 5.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 33 DPADVIELIYAHVKSGEI 50 P DV E++ H+K GE Sbjct: 76 KPEDVDEIVEKHLKGGEP 93 >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 225 Score = 23.5 bits (50), Expect = 5.4 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Query: 41 IYAHVKSGEIKPSRIESAYQRII 63 + V++GEI SR E+ Y ++ Sbjct: 197 VKEAVENGEIAESRYEN-YVKMF 218 >d1y74a1 a.194.1.1 (A:17-73) Lin-7 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Score = 22.8 bits (49), Expect = 7.6 Identities = 10/33 (30%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 31 QQDPADVIELIYAHVKSGEIKPSRIESAYQRII 63 ++D + +EL+ +SGE+ P +++ A QR++ Sbjct: 4 ERDVSRAVELLERLQRSGELPPQKLQ-ALQRVL 35 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.323 0.134 0.400 Gapped Lambda K H 0.267 0.0605 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 263,687 Number of extensions: 9183 Number of successful extensions: 30 Number of sequences better than 10.0: 1 Number of HSP's gapped: 30 Number of HSP's successfully gapped: 13 Length of query: 71 Length of database: 2,407,596 Length adjustment: 39 Effective length of query: 32 Effective length of database: 1,872,126 Effective search space: 59908032 Effective search space used: 59908032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.2 bits)