RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781072|ref|YP_003065485.1| hypothetical protein CLIBASIA_04870 [Candidatus Liberibacter asiaticus str. psy62] (190 letters) >gnl|CDD|36302 KOG1086, KOG1086, KOG1086, Cytosolic sorting protein/ADP-ribosylation factor effector GGA [Intracellular trafficking, secretion, and vesicular transport]. Length = 594 Score = 30.8 bits (69), Expect = 0.25 Identities = 28/114 (24%), Positives = 45/114 (39%), Gaps = 17/114 (14%) Query: 34 NKEFVTKVEELYEKAQKAHKKRDKVYGAYDKVSSHKKSPKELSKAFYIDFRTELKYFKAL 93 NK T V+E K +K K+ + ++V+++ K +E+ +D+ E Sbjct: 194 NKLIKTLVKEEEHKLEKISKRVKAL----EEVNNNVKLLEEM----LLDYSQEGNASPDN 245 Query: 94 TKYYKSVVAE---LRE--FGLGKSAIE----IEEITKAVDTLTRAYNEYKKEIR 138 + V LR F L + + EI +A D LTR N YK Sbjct: 246 ELLLQEVYNRCEQLRPTLFRLASETEDNDPALAEILQANDNLTRVINLYKTPKE 299 >gnl|CDD|38820 KOG3614, KOG3614, KOG3614, Ca2+/Mg2+-permeable cation channels (LTRPC family) [Inorganic ion transport and metabolism, Signal transduction mechanisms]. Length = 1381 Score = 29.9 bits (67), Expect = 0.50 Identities = 22/128 (17%), Positives = 42/128 (32%), Gaps = 4/128 (3%) Query: 31 SVINKEFVTKVEELYEKAQKA-HKKRDKVYGAYDKVSSHKKSPKELSKAFYIDFRTELKY 89 S F + LY+K + + K K + +L Sbjct: 509 SYTRPRFRNLYQNLYKKGSFGVDRLGQGFGPPNVFCNDKSKRDKSEEEDLSRYPIRDLLI 568 Query: 90 FKALTKYYK--SVVAELREFGLGKSAIEIEEITKAVDTLTRAYNEYKKEIRELIEEFIEL 147 + L + E + K+ + + K++ ++E KE++ L +EF L Sbjct: 569 WAVLLNRQGMAKCLWAHGEEAVAKALVASR-LYKSLAHEAHDWHEAAKELKTLSDEFEGL 627 Query: 148 GFDQCDEC 155 + DEC Sbjct: 628 AVELFDEC 635 >gnl|CDD|36214 KOG0996, KOG0996, KOG0996, Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics, Cell cycle control, cell division, chromosome partitioning]. Length = 1293 Score = 28.8 bits (64), Expect = 1.1 Identities = 30/135 (22%), Positives = 57/135 (42%), Gaps = 11/135 (8%) Query: 25 QIRSKESVINKEFVTKVEELYEKAQKAHKKRDKVYGAYDKVSSH-KKSPKELSKA----- 78 +I+ ++ I++ KV+ +K +K +++ DK+ K++ K S + ++KA Sbjct: 886 RIKELQNKIDEIGGEKVQAQKDKVEKINEQLDKLEADIAKLTVAIKTSDRNIAKAQKKLS 945 Query: 79 ----FYIDFRTELKYFKALTKYYKSVVAELREFGLGKSAIEIEEITKAVDTLTRAYNEYK 134 D EL K + AEL + ++ ++EI K + L K Sbjct: 946 ELEREIEDTEKELDDLTEELKGLEEKAAELEK-EYKEAEESLKEIKKELRDLKSELENIK 1004 Query: 135 KEIRELIEEFIELGF 149 K EL E I++ Sbjct: 1005 KSENELKAERIDIEN 1019 >gnl|CDD|34787 COG5188, PRP9, Splicing factor 3a, subunit 3 [RNA processing and modification]. Length = 470 Score = 27.4 bits (60), Expect = 2.3 Identities = 17/79 (21%), Positives = 29/79 (36%), Gaps = 5/79 (6%) Query: 54 KRDKVYGAYDKVSSHKKSPKELSKAFYIDFRTELKYFKALTKYYKSVVAELREFGLGKSA 113 R KV+ + + H K + + Y ++ KY V+E R L A Sbjct: 249 SRSKVFEYHLEGKRHCKEGQGKEEFVYSEYV-----LHRYLKYLGDPVSETRSLVLRSLA 303 Query: 114 IEIEEITKAVDTLTRAYNE 132 I +E + L+R + Sbjct: 304 ITAKERKAEISLLSRRKKQ 322 >gnl|CDD|145275 pfam02006, DUF137, Protein of unknown function DUF137. This family of archaeal proteins has no known function. Length = 178 Score = 27.6 bits (62), Expect = 2.4 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 116 IEEITKAVDTLTRAYNEYKKEIRELIEEFIELGFD 150 ++ IT+A+ LT E KK RE +E+ ++ +D Sbjct: 133 VDNITRAIPNLTELAKELKKADREELEKIVD-NYD 166 >gnl|CDD|39919 KOG4721, KOG4721, KOG4721, Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms]. Length = 904 Score = 27.4 bits (60), Expect = 2.6 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 2/77 (2%) Query: 22 SFLQIRSKESVINKEFVTKVEELYEKAQKAHKKRDKVYGAYDKVSSHKKSPKELSKAFYI 81 SF QI + + E ++ EE Y K+Q + R++V ++K++S L + Sbjct: 357 SFRQILLHLDIASPELLSTTEETYFKSQASW--REEVKLHFEKITSEGTCIHRLEEELIR 414 Query: 82 DFRTELKYFKALTKYYK 98 R EL++ + ++Y+ Sbjct: 415 RRREELRHALDIREHYE 431 >gnl|CDD|48186 cd03377, TPP_PFOR_PNO, Thiamine pyrophosphate (TPP family), PFOR_PNO subfamily, TPP-binding module; composed of proteins similar to the single subunit pyruvate ferredoxin oxidoreductase (PFOR) of Desulfovibrio Africanus, present in bacteria and amitochondriate eukaryotes. This subfamily also includes proteins characterized as pyruvate NADP+ oxidoreductase (PNO). These enzymes are dependent on TPP and a divalent metal cation as cofactors. PFOR and PNO catalyze the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways. Archaea, anaerobic bacteria and eukaryotes that lack mitochondria (and therefore pyruvate dehydrogenase) use PFOR to oxidatively decarboxylate pyruvate, with ferredoxin or flavodoxin as the electron acceptor. The PFOR from cyanobacterium Anabaena (NifJ) is required for the transfer of electrons from pyruvate to flavodoxin, which reduces nitrogenase. The facultative anaerobic mitochondrion of the photosynthetic protist Euglena gracilis oxidizes pyruvate with PNO.. Length = 365 Score = 27.1 bits (60), Expect = 3.2 Identities = 15/48 (31%), Positives = 24/48 (50%) Query: 12 TSKIPDAKFGSFLQIRSKESVINKEFVTKVEELYEKAQKAHKKRDKVY 59 SK PD FL ++ + + K + E+L+E+ Q K+R K Y Sbjct: 313 DSKEPDGPVEEFLNNENRFAALKKANPERAEQLFEQLQADAKERYKRY 360 >gnl|CDD|35504 KOG0283, KOG0283, KOG0283, WD40 repeat-containing protein [Function unknown]. Length = 712 Score = 26.2 bits (57), Expect = 5.3 Identities = 14/48 (29%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Query: 35 KEFVTKVEELYEKAQKAHKKRDKVYGAYD--KVSSHKKSPKELSKAFY 80 + Y K+ K ++ Y KV +KKSPKELS Sbjct: 211 DSDSSSQFHNYLSEPKSSKDKEMKYNLPSRVKVRHYKKSPKELSALTV 258 >gnl|CDD|146306 pfam03598, CdhC, CO dehydrogenase/acetyl-CoA synthase complex beta subunit. Length = 412 Score = 26.1 bits (58), Expect = 6.0 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 6/34 (17%) Query: 30 ESVINKEFVT------KVEELYEKAQKAHKKRDK 57 +I+K VT KV+E+ EKA++ ++ RD+ Sbjct: 141 GPIIDKVQVTIYTDEEKVKEILEKAREIYEARDE 174 >gnl|CDD|147082 pfam04740, Transposase_30, Bacillus transposase protein. This family of putative transposases includes mostly Bacillus members. However, we have also found a Bacillus subtilis bacteriophage SPbetac2 homologue, possibly arising as a result of horizontal transfer. Length = 204 Score = 26.1 bits (58), Expect = 6.2 Identities = 8/38 (21%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Query: 114 IEIEEITKAVDTLTRAYNEYKKEIREL---IEEFIELG 148 +++ E+ A+D A E + ++ L I +L Sbjct: 3 LDVAELISAIDQTISALKELRDQLESLKKAITGVADLD 40 >gnl|CDD|153284 cd07600, BAR_Gvp36, The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Golgi vesicle protein of 36 kDa and similar proteins. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions including organelle biogenesis, membrane trafficking or remodeling, and cell division and migration. Proteomic analysis shows that Golgi vesicle protein of 36 kDa (Gvp36) may be involved in vesicular trafficking and nutritional adaptation. A Saccharomyces cerevisiae strain deficient in Gvp36 shows defects in growth, in actin cytoskeleton polarization, in endocytosis, in vacuolar biogenesis, and in the cell cycle. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. Length = 242 Score = 26.2 bits (58), Expect = 6.3 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 31 SVINKEFVTKVEE-LYEKAQKAHKKRDKVYGA---YDKVSSHKKSPKELSK 77 +I KEF K+ E L QKAHK R KV D + KS + K Sbjct: 128 QLIQKEFNAKLRETLNTSFQKAHKARKKVEDKRLQLDTARAELKSAEPAEK 178 >gnl|CDD|30356 COG0006, PepP, Xaa-Pro aminopeptidase [Amino acid transport and metabolism]. Length = 384 Score = 25.8 bits (56), Expect = 7.2 Identities = 14/45 (31%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Query: 99 SVVAELREFGLGKSAIEIEEITKAVDTLTRAYNEYKKEIRELIEE 143 +V LR KS EI +I KA + A + IR + E Sbjct: 146 DLVDRLRLI---KSPAEIAKIRKAAEIADAALEAALEAIRPGMTE 187 >gnl|CDD|146672 pfam04156, IncA, IncA protein. Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion. The inclusion is non-fusogenic with lysosomes but intercepts lipids from a host cell exocytic pathway. Initiation of chlamydial development is concurrent with modification of the inclusion membrane by a set of C. trachomatis-encoded proteins collectively designated Incs. One of these Incs, IncA, is functionally associated with the homotypic fusion of inclusions. This family probably includes members of the wider Inc family rather than just IncA. Length = 186 Score = 25.9 bits (57), Expect = 7.8 Identities = 24/126 (19%), Positives = 51/126 (40%), Gaps = 9/126 (7%) Query: 44 LYEKAQKAHKKRDKVYGAYDKVSSHKKSPKELSKAFYIDFRTELKYFKALTKYYKSVVAE 103 L KA + K+ ++S K+ EL + D + ++ + K + Sbjct: 60 LLLKAPVQSVRPQKLEELQGELSELKQQLSELQEEL-EDLEERIAELESELEDLKEDLQL 118 Query: 104 LREFGLGKSAIEIEEITKAVDTLTRAYNEYKKEIRELIEEFIELGFDQCDECDLCSEKAD 163 LRE ++ + + +++L + E KE+REL ++ E + +E + E Sbjct: 119 LRE--------LLKSLEERLESLEESIKELAKELRELRQDLREEVEELREELERLQENLQ 170 Query: 164 VIQKKR 169 +Q+ Sbjct: 171 RLQEAI 176 >gnl|CDD|35994 KOG0775, KOG0775, KOG0775, Transcription factor SIX and related HOX domain proteins [Transcription]. Length = 304 Score = 25.4 bits (55), Expect = 9.0 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Query: 35 KEFVTKVEELYEKA--QKAHKKRDKVYGAYDKVSSHKKSP 72 K++ L+ KA ++A K R + GA DK +K P Sbjct: 129 PHNHPKLQALWLKAHYKEAEKLRGRPLGAVDKYRVRRKFP 168 >gnl|CDD|31389 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]. Length = 1163 Score = 25.4 bits (55), Expect = 9.1 Identities = 16/51 (31%), Positives = 28/51 (54%) Query: 97 YKSVVAELREFGLGKSAIEIEEITKAVDTLTRAYNEYKKEIRELIEEFIEL 147 Y+ + AELRE L +++E+ K ++ L + ++E+ EL EE E Sbjct: 215 YQELKAELRELELALLLAKLKELRKELEELEEELSRLEEELEELQEELEEA 265 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.315 0.132 0.356 Gapped Lambda K H 0.267 0.0607 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,133,531 Number of extensions: 107723 Number of successful extensions: 617 Number of sequences better than 10.0: 1 Number of HSP's gapped: 611 Number of HSP's successfully gapped: 89 Length of query: 190 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 102 Effective length of database: 4,362,145 Effective search space: 444938790 Effective search space used: 444938790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 54 (24.8 bits)