RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781072|ref|YP_003065485.1| hypothetical protein CLIBASIA_04870 [Candidatus Liberibacter asiaticus str. psy62] (190 letters) >3hqs_A CAI-1 autoinducer synthase; quorum sensing, CQSA, PLP, virulence, acyltransferase, aminotransferase, pyridoxal phosphate, transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A (A:) Length = 409 Score = 28.0 bits (60), Expect = 0.89 Identities = 6/26 (23%), Positives = 11/26 (42%) Query: 113 AIEIEEITKAVDTLTRAYNEYKKEIR 138 + E+I K ++ + A N R Sbjct: 384 DVNDEQIAKIIEVCSDAVNYGDFYFR 409 >2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} (B:108-241) Length = 134 Score = 27.7 bits (60), Expect = 1.1 Identities = 8/51 (15%), Positives = 13/51 (25%), Gaps = 1/51 (1%) Query: 110 GKSAIE-IEEITKAVDTLTRAYNEYKKEIRELIEEFIELGFDQCDECDLCS 159 G + + + +E E D+C EC C Sbjct: 1 GNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCI 51 >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} (A:197-542) Length = 346 Score = 27.8 bits (60), Expect = 1.1 Identities = 13/144 (9%), Positives = 35/144 (24%), Gaps = 4/144 (2%) Query: 24 LQIRSKESVINKEFVTKVEELYEKAQKAHKKRDKVYGAYDKVSSHKKSPKELSKAFYIDF 83 + I K + + ++K + + D ++ + + + Sbjct: 206 VIILKKNRTNRDVYFIDASKEFDKGKNQNIXTDAHIEKILNAYKSREDIDKFAHLASFEE 265 Query: 84 RTELKYFKALTKYYKSVVAELREFGLGKSAIEIEEITKAVDTLTRAYNEYKKEIRELIEE 143 E Y + +Y + E E + +I + T+ + +L Sbjct: 266 IVENDYNLNIPRYVDTFEEEEVE----PLTEIVAKINQTNATIESQTASLLDXLGQLHGT 321 Query: 144 FIELGFDQCDECDLCSEKADVIQK 167 E + Sbjct: 322 TPEADEELKAFVKAFKGLEHHHHH 345 >1wn1_A Dipeptidase; prolidase, cobalt(II), structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; 2.25A {Pyrococcus horikoshii OT3} PDB: 2how_A (A:128-356) Length = 229 Score = 26.8 bits (58), Expect = 2.0 Identities = 5/33 (15%), Positives = 12/33 (36%) Query: 111 KSAIEIEEITKAVDTLTRAYNEYKKEIRELIEE 143 K E++ + A + + E ++E Sbjct: 5 KDKEEVKMMEHASRIADKVFEEILTWDLIGMKE 37 >2nw5_A Methionine aminopeptidase 2; metap2, structural genomics, PSI-2, protein structure initiative; 2.18A {Encephalitozoon cuniculi} PDB: 3cmk_A* 3d0d_A* 3fm3_A 3fmq_A* 3fmr_A* (A:) Length = 360 Score = 26.8 bits (57), Expect = 2.0 Identities = 7/41 (17%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Query: 99 SVVAELREFGLGKSAIEIEEITKAVDTLTRAYNEYKKEIRE 139 S E+ F + +++ +A + RA + +R Sbjct: 33 SRNMEIENF---TESDILQDARRAAEAHRRARYRVQSIVRP 70 >1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} (A:) Length = 83 Score = 26.7 bits (59), Expect = 2.1 Identities = 13/50 (26%), Positives = 23/50 (46%) Query: 93 LTKYYKSVVAELREFGLGKSAIEIEEITKAVDTLTRAYNEYKKEIRELIE 142 + Y VAE R L ++ E E++ K ++ +KE ++L E Sbjct: 17 PSSQYWKEVAEQRRKALYEALKENEKLHKEIEQKDSEIARLRKENKDLAE 66 >1o0x_A Methionine aminopeptidase; TM1478, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.90A {Thermotoga maritima} (A:) Length = 262 Score = 26.6 bits (57), Expect = 2.2 Identities = 10/42 (23%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Query: 98 KSVVAELREFGLGKSAIEIEEITKAVDTLTRAYNEYKKEIRE 139 + K+ EIE++ KA + A E +K I Sbjct: 7 HHHHHHMIRI---KTPSEIEKMKKAGKAVAVALREVRKVIVP 45 >1qxy_A Methionyl aminopeptidase; PITA bread fold, hydrolase; HET: M2C; 1.04A {Staphylococcus aureus} (A:) Length = 252 Score = 26.6 bits (57), Expect = 2.4 Identities = 4/33 (12%), Positives = 12/33 (36%) Query: 111 KSAIEIEEITKAVDTLTRAYNEYKKEIRELIEE 143 K+ E++ + + + N + + I Sbjct: 4 KTEEELQALKEIGYICAKVRNTMQAATKPGITT 36 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006) Length = 120 Score = 26.3 bits (58), Expect = 2.4 Identities = 9/39 (23%), Positives = 11/39 (28%), Gaps = 13/39 (33%) Query: 20 FGSFLQIRSKESVINKEFVTKVEELYE--KAQKAHKKRD 56 + I S V+ F Y Q A RD Sbjct: 2 LADVMSIESLVEVV---F-------YRGMTMQVA-VPRD 29 >2v3z_A XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proline- specific enzyme, aminopeptidase P, manganese enzyme, protease, manganese; HET: CSO; 1.56A {Escherichia coli} (A:176-440) Length = 265 Score = 26.6 bits (57), Expect = 2.6 Identities = 8/33 (24%), Positives = 15/33 (45%) Query: 111 KSAIEIEEITKAVDTLTRAYNEYKKEIRELIEE 143 KS EI + +A + A+ ++ R + E Sbjct: 1 KSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFE 33 >2wqd_A Phosphoenolpyruvate-protein phosphotransferase; kinase, cytoplasm, transport, magnesium, PEP- utilising enzyme, phosphotransferase system; 2.40A {Staphylococcus aureus} PDB: 2hro_A (A:261-572) Length = 312 Score = 26.5 bits (57), Expect = 2.7 Identities = 5/35 (14%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Query: 112 SAIEIEEITKAVDTLTRAYNEYKKEIRELIEEFIE 146 + + E+T+ + + +E+ EL+ +++ Sbjct: 280 NGLSKNEMTELANRAVDCATQ--EEVIELVNNYVK 312 >3iu7_A Methionine aminopeptidase; enzyme-inhibitor complex, cobalt, hydrolase, metal-binding, protease; HET: FCD; 1.40A {Mycobacterium tuberculosis} PDB: 3iu8_A* 3iu9_A* 1y1n_A 1yj3_A (A:) Length = 288 Score = 26.2 bits (56), Expect = 3.1 Identities = 8/65 (12%), Positives = 16/65 (24%), Gaps = 13/65 (20%) Query: 99 SVVAELREFGLGKSAIEIEEITKAVDTLTRAYNEYKKEIR----------ELIEEFIELG 148 + ++ IE++ A A E K + E ++ G Sbjct: 36 AQEGSEPWV---QTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNG 92 Query: 149 FDQCD 153 Sbjct: 93 AYPST 97 >2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus HB27} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* (A:1-43,A:285-397) Length = 156 Score = 26.0 bits (57), Expect = 3.3 Identities = 7/29 (24%), Positives = 12/29 (41%) Query: 109 LGKSAIEIEEITKAVDTLTRAYNEYKKEI 137 L + ++ E I + V L RA + Sbjct: 128 LSYATLDREGIAEGVRRLGRALKGLLALV 156 >2b3h_A Methionine aminopeptidase 1; hydrolase, metalloprotease, pitabread fold; HET: GOL; 1.10A {Homo sapiens} PDB: 2b3k_A 2b3l_A 2gz5_A* 2nq6_A* 2nq7_A* 2g6p_A* (A:74-329) Length = 256 Score = 26.2 bits (56), Expect = 3.3 Identities = 4/33 (12%), Positives = 10/33 (30%) Query: 111 KSAIEIEEITKAVDTLTRAYNEYKKEIRELIEE 143 S+ +IE + + I+ + Sbjct: 3 LSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTT 35 >3l24_A XAA-Pro dipeptidase; PITA-bread, detoxification, hydrolase, manganese, metal-binding, metalloprotease, protease; 2.30A {Alteromonas SP} (A:160-517) Length = 358 Score = 26.1 bits (56), Expect = 3.4 Identities = 4/33 (12%), Positives = 12/33 (36%) Query: 111 KSAIEIEEITKAVDTLTRAYNEYKKEIRELIEE 143 K+ E+ + +A + + + + E Sbjct: 1 KTQYELACMREANKIAVQGHKAARDAFFQGKSE 33 >3ig4_A XAA-Pro aminopeptidase; csgid, hydrolase, structural genomics, center for structural genomics of infectious diseases; HET: SO4; 2.89A {Bacillus anthracis} (A:172-427) Length = 256 Score = 26.1 bits (56), Expect = 3.4 Identities = 7/29 (24%), Positives = 11/29 (37%) Query: 111 KSAIEIEEITKAVDTLTRAYNEYKKEIRE 139 K+ EIE I +A+ K + Sbjct: 1 KTDEEIEIIKEAIAVTKDGIYNVLKHAKA 29 >1aop_A Sirhp, sulfite reductase hemoprotein; oxidoreductase, siroheme, [4Fe-4S], snirr, six-electron reduction, phosphate complex; HET: SRM; 1.60A {Escherichia coli} (A:352-497) Length = 146 Score = 25.9 bits (56), Expect = 3.7 Identities = 8/38 (21%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Query: 114 IEIEEITKAVDTLTRAYNEYKKEIRELIEEFIE-LGFD 150 I EI ++D L + + ++ E +F G Sbjct: 98 ITEPEILASLDELIGRWAKEREA-GEGFGDFTVRAGII 134 >2iw2_A XAA-Pro dipeptidase; metallocarboxypeptidase, disease mutation, acetylation, peptidase D, polymorphism, collagen degradation, metalloaminopeptidase; 1.82A {Homo sapiens} PDB: 2okn_A (A:188-494) Length = 307 Score = 25.8 bits (55), Expect = 3.8 Identities = 7/34 (20%), Positives = 18/34 (52%) Query: 111 KSAIEIEEITKAVDTLTRAYNEYKKEIRELIEEF 144 K+ +E+E + + A+ E K ++ ++E+ Sbjct: 1 KTDMELEVLRYTNKISSEAHREVMKAVKVGMKEY 34 >2gg2_A Methionine aminopeptidase; PITA-bread fold, MAP inhibitor, antibacterial, hydrolase; HET: U12; 1.00A {Escherichia coli K12} (A:) Length = 263 Score = 25.4 bits (54), Expect = 4.4 Identities = 4/33 (12%), Positives = 12/33 (36%) Query: 111 KSAIEIEEITKAVDTLTRAYNEYKKEIRELIEE 143 K+ +IE++ A + ++ + Sbjct: 5 KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVST 37 >1chm_A Creatine amidinohydrolase; creatinase; 1.90A {Pseudomonas putida} (A:158-401) Length = 244 Score = 25.7 bits (55), Expect = 4.5 Identities = 6/33 (18%), Positives = 10/33 (30%) Query: 111 KSAIEIEEITKAVDTLTRAYNEYKKEIRELIEE 143 KSA E I + + + + E Sbjct: 1 KSAEEHVMIRHGARIADIGGAAVVEALGDQVPE 33 >2gsv_A Hypothetical protein YVFG; alpha-helical protein, structural genomics, PSI, protein structure initiative; 1.90A {Bacillus subtilis} (A:) Length = 80 Score = 25.4 bits (55), Expect = 4.5 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Query: 80 YIDFRTELKYFKALTKYYKSVVAELREFGLGKSAIEIEEITKAVDTLTRAYNEYKKE 136 +I+ A YY+SVV+ L + L K+A+ + K + L AYN+ K+ Sbjct: 17 HIEXNQSEDKIHAXNSYYRSVVSTLVQDQLTKNAV----VLKRIQHLDEAYNKVKRG 69 >1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} (A:) Length = 83 Score = 25.2 bits (55), Expect = 5.6 Identities = 15/49 (30%), Positives = 23/49 (46%) Query: 94 TKYYKSVVAELREFGLGKSAIEIEEITKAVDTLTRAYNEYKKEIRELIE 142 + Y VAE R L ++ E E++ K ++ KKE +EL E Sbjct: 26 SSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAE 74 >3de8_A Soluble cytochrome B562; Cu-stabilized dimeric superstructure, electron transport, heme, iron, metal-binding, periplasm, transport; HET: HEM; 1.72A {Escherichia coli} PDB: 2qla_A* 3de9_A* 3c62_A* 3c63_A* 2bc5_A* 1qq3_A* 1apc_A 1qpu_A* 256b_A* 3foo_A* 3fop_A* 1lm3_B* 1m6t_A 1yyj_A 1yyx_A 1yza_A 1yzc_A (A:) Length = 106 Score = 25.1 bits (55), Expect = 5.7 Identities = 6/49 (12%), Positives = 17/49 (34%) Query: 105 REFGLGKSAIEIEEITKAVDTLTRAYNEYKKEIRELIEEFIELGFDQCD 153 + + A ++ A+ + A + +K +E+ + D Sbjct: 12 DNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMHD 60 >2q8k_A Proliferation-associated protein 2G4; EBP1, PA2G4, methionine aminopeptidase, PITA-bread, transcription; 1.60A {Homo sapiens} PDB: 2v6c_A (A:1-245,A:313-401) Length = 334 Score = 25.2 bits (54), Expect = 6.2 Identities = 2/41 (4%), Positives = 8/41 (19%), Gaps = 3/41 (7%) Query: 99 SVVAELREFGLGKSAIEIEEITKAVDTLTRAYNEYKKEIRE 139 + + + + + D R + Sbjct: 11 EDEQQEQTI---AEDLVVTKYKMGGDIANRVLRSLVEASSS 48 >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} (A:1-375,A:446-478) Length = 408 Score = 25.0 bits (53), Expect = 6.4 Identities = 14/128 (10%), Positives = 32/128 (25%) Query: 18 AKFGSFLQIRSKESVINKEFVTKVEELYEKAQKAHKKRDKVYGAYDKVSSHKKSPKELSK 77 A+ + KE + E + +K KK+ + S + Sbjct: 68 ARQLERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNG 127 Query: 78 AFYIDFRTELKYFKALTKYYKSVVAELREFGLGKSAIEIEEITKAVDTLTRAYNEYKKEI 137 F E + +E ++ S + +A + + I Sbjct: 128 VFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWI 187 Query: 138 RELIEEFI 145 + + Sbjct: 188 KPGMTMIE 195 >2zyo_A Solute-binding protein; open form, sugar binding protein; HET: GLC; 1.55A {Thermoactinomyces vulgaris} PDB: 2zyk_A* 2zym_A* 2zyn_A* 2dfz_A* (A:130-173,A:226-271) Length = 90 Score = 25.0 bits (55), Expect = 6.7 Identities = 9/31 (29%), Positives = 19/31 (61%), Gaps = 4/31 (12%) Query: 34 NKEFVTKV----EELYEKAQKAHKKRDKVYG 60 NK+ + +V +EL++ A+ +K ++ YG Sbjct: 7 NKKLMGQVPATYDELFQYAKANNKPDEQKYG 37 >3jxe_A Tryptophanyl-tRNA synthetase; adenosine triphosphate, rossmann fold, crystallography, X-RAY, P. horikoshii, aminoacyl-tRNA synthetase; HET: TYM; 3.00A {Pyrococcus horikoshii} (A:) Length = 392 Score = 24.9 bits (53), Expect = 7.0 Identities = 20/117 (17%), Positives = 36/117 (30%), Gaps = 11/117 (9%) Query: 67 SHKKSPKELSKAFYIDFRTELKYFKALTKY-YKSVVAELREFGLGKSAIEIEEITKAVDT 125 S + K++ K R LK + K VV + E + +++E A Sbjct: 268 SPEDVEKKVWKFTLTGGRPTLKEQREKGGEPEKCVVFKWLEIFFEEDDKKLKERYYACKN 327 Query: 126 LTRAYNEYKKEIRELIEEFIELGFDQCDECDLCSEKADVIQKKRIAFEMVEREFAEK 182 E K+ + I+EF + +K F+ + E Sbjct: 328 GELTCGECKRYLISKIQEF----------LKEHQRRRKKAEKLVEKFKYTGKLAQEM 374 >2asy_A Protein YDHR precursor; dimeric APHA+beta barrel, homodimer, structural genomics, ontario centre for structural proteomics, OCSP; NMR {Escherichia coli} (A:) Length = 123 Score = 24.4 bits (53), Expect = 9.1 Identities = 8/48 (16%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Query: 83 FRTELKYFKALTKYYKSVVAELREFGLGKSAIEIEEITKAVDTLTRAY 130 F E K+ Y + A L+ G+ + ++ ++ + + + +A Sbjct: 78 FTDE----KSALAYLEKHTARLKNLGVEEVVAKVFDVNEPLSQINQAK 121 >1gv3_A Manganese superoxide dismutase; anabaena PCC 7120,; 2.0A {Anabaena SP} (A:129-248) Length = 120 Score = 24.5 bits (53), Expect = 9.3 Identities = 2/29 (6%), Positives = 12/29 (41%), Gaps = 3/29 (10%) Query: 31 SVINKEFVTKVEELYEKAQKAHKKRDKVY 59 +V+N + + +++++ + Sbjct: 95 NVVNWSEI---NRRTQASRQSNSHHHHHH 120 >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ ATPase, DNA polymerase; HET: ATG ADP; 2.85A {Saccharomyces cerevisiae} (A:395-516) Length = 122 Score = 24.3 bits (53), Expect = 9.4 Identities = 6/20 (30%), Positives = 7/20 (35%), Gaps = 5/20 (25%) Query: 117 EEITKAVDT-----LTRAYN 131 I K + TR YN Sbjct: 93 TAIIKKIPATVKSGFTRKYN 112 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.315 0.132 0.356 Gapped Lambda K H 0.267 0.0390 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,372,821 Number of extensions: 63193 Number of successful extensions: 428 Number of sequences better than 10.0: 1 Number of HSP's gapped: 428 Number of HSP's successfully gapped: 92 Length of query: 190 Length of database: 4,956,049 Length adjustment: 84 Effective length of query: 106 Effective length of database: 2,116,429 Effective search space: 224341474 Effective search space used: 224341474 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 52 (24.7 bits)