RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781072|ref|YP_003065485.1| hypothetical protein CLIBASIA_04870 [Candidatus Liberibacter asiaticus str. psy62] (190 letters) >d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Length = 425 Score = 30.6 bits (68), Expect = 0.082 Identities = 14/72 (19%), Positives = 29/72 (40%), Gaps = 15/72 (20%) Query: 79 FYIDFRTELKYFKALTKYYKSVVAELREFGL-----GKS----------AIEIEEITKAV 123 I+ + + K K +VA R+ GL G IE +I + + Sbjct: 354 IAIELFEDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGL 413 Query: 124 DTLTRAYNEYKK 135 + +++ ++E K+ Sbjct: 414 EIISQCFDEAKQ 425 >d1j1ua_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 306 Score = 29.6 bits (65), Expect = 0.18 Identities = 15/106 (14%), Positives = 31/106 (29%), Gaps = 3/106 (2%) Query: 44 LYEKAQKAHKKRDKVYGAYDKVSSHKKSPKELSKAFYIDFRTELKYFKALTKY---YKSV 100 + K S ++ ++ KA+ E + KY Y Sbjct: 195 VLTGLDGEGKMSSSKGNFIAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLT 254 Query: 101 VAELREFGLGKSAIEIEEITKAVDTLTRAYNEYKKEIRELIEEFIE 146 + +FG + EE+ + K + E + + +E Sbjct: 255 IKRPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILE 300 >d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Length = 420 Score = 27.8 bits (60), Expect = 0.69 Identities = 8/28 (28%), Positives = 11/28 (39%) Query: 109 LGKSAIEIEEITKAVDTLTRAYNEYKKE 136 L E+I + + L EY KE Sbjct: 389 LSFCLPPDEKIVEGIKRLREVVLEYGKE 416 >d2c42a2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]} Length = 447 Score = 27.2 bits (60), Expect = 0.80 Identities = 11/47 (23%), Positives = 20/47 (42%) Query: 13 SKIPDAKFGSFLQIRSKESVINKEFVTKVEELYEKAQKAHKKRDKVY 59 SK PD FL +++ +V+++ F + L + R K Sbjct: 332 SKAPDGSVEEFLMAQNRFAVLDRSFPEDAKRLRAQVAHELDVRFKEL 378 >d1chma2 d.127.1.1 (A:157-402) Creatinase, catalytic (C-terminal) domain {Pseudomonas putida [TaxId: 303]} Length = 246 Score = 27.0 bits (58), Expect = 1.1 Identities = 6/33 (18%), Positives = 10/33 (30%) Query: 111 KSAIEIEEITKAVDTLTRAYNEYKKEIRELIEE 143 KSA E I + + + + E Sbjct: 3 KSAEEHVMIRHGARIADIGGAAVVEALGDQVPE 35 >d1rhca_ c.1.16.3 (A:) Coenzyme F420 dependent secondary alcohol dehydrogenase {Archaeon Methanoculleus thermophilicus [TaxId: 2200]} Length = 330 Score = 26.6 bits (57), Expect = 1.5 Identities = 6/16 (37%), Positives = 9/16 (56%) Query: 136 EIRELIEEFIELGFDQ 151 E+ + IE F E G + Sbjct: 289 EMIKEIERFKEAGINH 304 >d1oaoc_ e.26.1.3 (C:) Bifunctional carbon monoxide dehydrogenase/acetyl-CoA synthase (CODH/ACS) alpha (ACS) subunit {Moorella thermoacetica [TaxId: 1525]} Length = 729 Score = 26.6 bits (59), Expect = 1.6 Identities = 10/33 (30%), Positives = 20/33 (60%), Gaps = 6/33 (18%) Query: 31 SVINKEFVT------KVEELYEKAQKAHKKRDK 57 +++++ VT KV+E E A++ +K+RD Sbjct: 458 AIVDRVQVTIFTDEAKVKEYMEVAREKYKERDD 490 >d1pv9a2 d.127.1.1 (A:125-345) Aminopeptidase P, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 221 Score = 26.5 bits (57), Expect = 1.7 Identities = 12/34 (35%), Positives = 16/34 (47%) Query: 111 KSAIEIEEITKAVDTLTRAYNEYKKEIRELIEEF 144 K+ EIE I KA + +A +EI E E Sbjct: 1 KTKEEIEIIEKACEIADKAVMAAIEEITEGKRER 34 >d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Length = 426 Score = 26.3 bits (57), Expect = 1.7 Identities = 6/24 (25%), Positives = 14/24 (58%) Query: 79 FYIDFRTELKYFKALTKYYKSVVA 102 +Y+DF ++ + K +Y+ +A Sbjct: 401 YYVDFPSQRRIPKRSALWYRERIA 424 >d1n3la_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapiens) [TaxId: 9606]} Length = 339 Score = 26.4 bits (57), Expect = 1.7 Identities = 17/112 (15%), Positives = 37/112 (33%), Gaps = 2/112 (1%) Query: 37 FVTKVEELYEKAQKAHKKRDKVYGAYDKVSSHKKSPKELSKAFYIDFRTELKYFKALTKY 96 V L + ++ K+ K KK K + ++ L + K + Sbjct: 208 MNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFP 267 Query: 97 YKSVVAELR--EFGLGKSAIEIEEITKAVDTLTRAYNEYKKEIRELIEEFIE 146 KS LR ++G K+ ++ K + K + + + ++ Sbjct: 268 LKSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLD 319 >d1qxya_ d.127.1.1 (A:) Methionine aminopeptidase {Staphylococcus aureus [TaxId: 1280]} Length = 249 Score = 25.9 bits (55), Expect = 2.2 Identities = 4/33 (12%), Positives = 12/33 (36%) Query: 111 KSAIEIEEITKAVDTLTRAYNEYKKEIRELIEE 143 K+ E++ + + + N + + I Sbjct: 4 KTEEELQALKEIGYICAKVRNTMQAATKPGITT 36 >d1f07a_ c.1.16.3 (A:) Coenzyme F420 dependent tetrahydromethanopterin reductase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 321 Score = 25.8 bits (55), Expect = 2.3 Identities = 6/16 (37%), Positives = 7/16 (43%) Query: 136 EIRELIEEFIELGFDQ 151 E IE E+G Q Sbjct: 281 EFIPKIEALGEMGVTQ 296 >d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 Score = 25.9 bits (56), Expect = 2.4 Identities = 8/24 (33%), Positives = 17/24 (70%) Query: 79 FYIDFRTELKYFKALTKYYKSVVA 102 ++DFRT+++ K +Y++VV+ Sbjct: 416 IHVDFRTQVRTPKQSYYWYRNVVS 439 >d2gsva1 a.23.7.1 (A:3-69) Hypothetical protein YvfG {Bacillus subtilis [TaxId: 1423]} Length = 67 Score = 25.8 bits (56), Expect = 2.5 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 4/57 (7%) Query: 80 YIDFRTELKYFKALTKYYKSVVAELREFGLGKSAIEIEEITKAVDTLTRAYNEYKKE 136 +I+ A+ YY+SVV+ L + L K+A+ + K + L AYN+ K+ Sbjct: 15 HIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAV----VLKRIQHLDEAYNKVKRG 67 >d1o0xa_ d.127.1.1 (A:) Methionine aminopeptidase {Thermotoga maritima [TaxId: 2336]} Length = 249 Score = 25.7 bits (55), Expect = 2.6 Identities = 10/33 (30%), Positives = 15/33 (45%) Query: 111 KSAIEIEEITKAVDTLTRAYNEYKKEIRELIEE 143 K+ EIE++ KA + A E +K I Sbjct: 5 KTPSEIEKMKKAGKAVAVALREVRKVIVPGKTA 37 >d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 423 Score = 24.4 bits (52), Expect = 6.0 Identities = 6/38 (15%), Positives = 14/38 (36%), Gaps = 7/38 (18%) Query: 79 FYIDFRTELKYFKALTKYYKSVVAE-------LREFGL 109 +D++T + + Y + L+ +GL Sbjct: 381 VEVDYQTFERRPRKSAYVYGEIARSKEIKDELLKRYGL 418 >d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 Score = 24.4 bits (52), Expect = 6.1 Identities = 7/24 (29%), Positives = 13/24 (54%) Query: 79 FYIDFRTELKYFKALTKYYKSVVA 102 Y+D+ T+ + K +Y +VV Sbjct: 415 VYVDYSTQKRIVKDSGYWYSNVVK 438 >d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 489 Score = 24.5 bits (52), Expect = 6.4 Identities = 4/24 (16%), Positives = 11/24 (45%) Query: 79 FYIDFRTELKYFKALTKYYKSVVA 102 +D+ T+ Y++ Y+ + Sbjct: 444 LKVDYNTKRLYWRPSALVYREIAT 467 >d2gg2a1 d.127.1.1 (A:3-264) Methionine aminopeptidase {Escherichia coli [TaxId: 562]} Length = 262 Score = 24.5 bits (52), Expect = 6.6 Identities = 4/33 (12%), Positives = 12/33 (36%) Query: 111 KSAIEIEEITKAVDTLTRAYNEYKKEIRELIEE 143 K+ +IE++ A + ++ + Sbjct: 4 KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVST 36 >d1j5wa_ d.104.1.1 (A:) Glycyl-tRNA synthetase (GlyRS) alpha chain {Thermotoga maritima [TaxId: 2336]} Length = 281 Score = 24.3 bits (53), Expect = 6.8 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 122 AVDTLTRAYNEYKKEIRELIEEFIEL-GFDQCDEC 155 V L R ++EY+KE L+E+ + L +D +C Sbjct: 205 NVGLLFRHFDEYEKEFYRLVEKNLYLPAYDYILKC 239 >d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Length = 464 Score = 24.4 bits (52), Expect = 7.3 Identities = 7/24 (29%), Positives = 12/24 (50%) Query: 79 FYIDFRTELKYFKALTKYYKSVVA 102 Y+D+ T + KA ++Y V Sbjct: 435 VYVDYPTGTRIPKASARWYAEVAR 458 >d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Length = 468 Score = 24.0 bits (51), Expect = 8.2 Identities = 9/24 (37%), Positives = 14/24 (58%) Query: 79 FYIDFRTELKYFKALTKYYKSVVA 102 FY+DF T+ +Y K +YK + Sbjct: 440 FYVDFDTQERYPKKSAHWYKKLAE 463 >d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 449 Score = 24.0 bits (51), Expect = 8.2 Identities = 6/24 (25%), Positives = 14/24 (58%) Query: 79 FYIDFRTELKYFKALTKYYKSVVA 102 ++D+ T ++ K +YK V++ Sbjct: 420 VHVDYDTLVRTPKDSFYWYKGVIS 443 >d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 Score = 23.9 bits (51), Expect = 8.2 Identities = 10/124 (8%), Positives = 33/124 (26%), Gaps = 3/124 (2%) Query: 26 IRSKESVINKEFVTKVEELYEKAQKAHKKRDKVYGAYDKVSSHKKSPKELSKAFYIDFRT 85 + E ++ + +D + + + + + Sbjct: 99 STQLADAMMFPITQFKERDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEV 158 Query: 86 ELKYFKALTKYYKS---VVAELREFGLGKSAIEIEEITKAVDTLTRAYNEYKKEIRELIE 142 + + K +++ L K +E + + + + + E +E Sbjct: 159 TEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLE 218 Query: 143 EFIE 146 EF+ Sbjct: 219 EFLA 222 >d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Length = 481 Score = 24.0 bits (51), Expect = 9.1 Identities = 4/25 (16%), Positives = 12/25 (48%) Query: 79 FYIDFRTELKYFKALTKYYKSVVAE 103 +DF+T+ +Y + ++ + Sbjct: 443 VMVDFKTKKRYLRPSALVFREIATH 467 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.315 0.132 0.356 Gapped Lambda K H 0.267 0.0658 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 697,808 Number of extensions: 33802 Number of successful extensions: 264 Number of sequences better than 10.0: 1 Number of HSP's gapped: 261 Number of HSP's successfully gapped: 58 Length of query: 190 Length of database: 2,407,596 Length adjustment: 80 Effective length of query: 110 Effective length of database: 1,309,196 Effective search space: 144011560 Effective search space used: 144011560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 50 (23.2 bits)