RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781077|ref|YP_003065490.1| hypothetical protein CLIBASIA_04895 [Candidatus Liberibacter asiaticus str. psy62] (111 letters) >gnl|CDD|130336 TIGR01269, Tyr_3_monoox, tyrosine 3-monooxygenase, tetrameric. This model describes tyrosine 3-monooxygenase, a member of the family of tetrameric, biopterin-dependent aromatic amino acid hydroxylases found in metazoans. It is closely related to tetrameric phenylalanine-4-hydroxylase and tryptophan 5-monooxygenase, and more distantly related to the monomeric phenylalanine-4-hydroxylase found in some Gram-negative bacteria. Length = 457 Score = 28.0 bits (62), Expect = 0.54 Identities = 17/64 (26%), Positives = 24/64 (37%), Gaps = 5/64 (7%) Query: 25 DPLEDSSLFYHFHSTL-NLMTLHLPLRLQEEGISQSNLRTDHNVKQHVAITPILQMLDLT 83 + D S + N+ L LR IS NL + NVK+ I +L Sbjct: 79 NADVDYSCLITLEANEINMSLLIESLR-GNSFISGINLLNNQNVKEDWFPKHI---SELD 134 Query: 84 NCRH 87 C+H Sbjct: 135 KCQH 138 >gnl|CDD|178982 PRK00346, surE, 5'(3')-nucleotidase/polyphosphatase; Provisional. Length = 250 Score = 23.9 bits (53), Expect = 8.7 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 4/24 (16%) Query: 63 TD-HNVKQ-HVAITPILQMLDLTN 84 TD H V + +V+ITP+ LDLT Sbjct: 217 TDFHAVAEGYVSITPL--QLDLTA 238 >gnl|CDD|150679 pfam10033, ATG13, Autophagy-related protein 13. Members of this family of phosphoproteins are involved in cytoplasm to vacuole transport (Cvt), and more specifically in Cvt vesicle formation. They are probably involved in the switching machinery regulating the conversion between the Cvt pathway and autophagy. Finally, ATG13 is also required for glycogen storage. Length = 226 Score = 23.9 bits (52), Expect = 9.5 Identities = 5/28 (17%), Positives = 12/28 (42%) Query: 49 LRLQEEGISQSNLRTDHNVKQHVAITPI 76 L G+S+ + ++ N + P+ Sbjct: 180 LSKGRIGLSKPIIDSEENHTETYKFGPV 207 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.325 0.138 0.428 Gapped Lambda K H 0.267 0.0587 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,734,761 Number of extensions: 89677 Number of successful extensions: 189 Number of sequences better than 10.0: 1 Number of HSP's gapped: 189 Number of HSP's successfully gapped: 9 Length of query: 111 Length of database: 5,994,473 Length adjustment: 77 Effective length of query: 34 Effective length of database: 4,330,657 Effective search space: 147242338 Effective search space used: 147242338 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.4 bits)