Query         gi|254781081|ref|YP_003065494.1| hypothetical protein CLIBASIA_04915 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 93
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 33803
Date          Wed Jun  1 21:38:42 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781081.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >1zxa_A CGMP-dependent protein  47.9      12 0.00037   18.4   2.3   26   42-67     31-56  (67)
  2 >3fse_A Two-domain protein con  22.4      56  0.0016   14.8   2.1   55    7-67     11-65  (159)
  3 >2wx4_A DCP1, decapping protei  20.0      66  0.0019   14.4   2.1   33   35-67     12-45  (46)
  4 >1pu1_A Hypothetical protein M  19.5      38  0.0011   15.7   0.8   34   27-62     59-92  (94)
  5 >1dcu_A Fructose-1,6-bisphosph  13.1      38  0.0011   15.7  -0.5   23   51-73     16-53  (129)
  6 >1nhk_R Nucleoside diphosphate  12.3      93  0.0027   13.6   1.2   30   61-90     98-127 (144)
  7 >3jsz_A LGT1, putative unchara  11.6      89  0.0026   13.7   1.0   31   30-60      5-40  (109)
  8 >1l6j_A Matrix metalloproteina  11.3      60  0.0018   14.6   0.0   13   53-65     24-36  (88)
  9 >1k44_A Nucleoside diphosphate  10.8 1.2E+02  0.0035   13.0   1.4   45   46-90     76-128 (136)
 10 >2hur_A NDK, nucleoside diphos  10.8 1.2E+02  0.0034   13.1   1.3   29   62-90     99-127 (142)

No 1  
>>1zxa_A CGMP-dependent protein kinase 1, alpha isozyme; parallel coiled coil dimer, transferase; NMR {Homo sapiens} (A:)
Probab=47.89  E-value=12  Score=18.36  Aligned_cols=26  Identities=27%  Similarity=0.284  Sum_probs=21.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             67786366889879999999998987
Q gi|254781081|r   42 DYLLLNKHLLVDNLKSYLDKFGSLIS   67 (93)
Q Consensus        42 dylllnkhllvdnlksyldkfgslis   67 (93)
                      .-+|-.|+-.+..|+|-||||-|.+.
T Consensus        31 E~~L~~kd~EI~eLrs~LDK~qSVlp   56 (67)
T 1zxa_A           31 EKRLSEKEEEIQELKRKLHKCQSVLP   56 (67)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHC----
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99987338999999999985111168


No 2  
>>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI- like and ferritin-like domains; YP_324989.1, structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} (A:207-365)
Probab=22.38  E-value=56  Score=14.82  Aligned_cols=55  Identities=27%  Similarity=0.376  Sum_probs=34.7

Q ss_pred             HHHHHHHEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7764100024677420466332015778878864367786366889879999999998987
Q gi|254781081|r    7 EAYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGSLIS   67 (93)
Q Consensus         7 eayaeerysvlldldfasdsdqitsdelsdltqrydylllnkhllvdnlksyldkfgslis   67 (93)
                      .|.+.|||+.-   -|---+.+....++..+-|   -..-|||--+.-|.+||+.||-..|
T Consensus        11 TAi~GErYtle---afe~Y~~k~sd~~l~~l~q---eii~~Kq~HIq~Le~rL~~~gE~~s   65 (159)
T 3fse_A           11 TALGGERYSLE---ALEKYTEKESDVEAKALFQ---EXITNKQRHIEYLETYLTRLGEKPS   65 (159)
T ss_dssp             HHHHHHHHHHH---HHHHHHHHCCCHHHHHHHH---HHHHHHHHHHHHHHHHHHHTTCCGG
T ss_pred             CCCCCCCCCHH---HHHHHHHHCCCHHHHHHHH---HHHCCHHHHHHHHHHHHHHHCCCCC
T ss_conf             33467754189---9999874423826789999---9700789999999999986314567


No 3  
>>2wx4_A DCP1, decapping protein 1; asymmetric assembly, trimerization module, mRNA decapping, P-BODY component, structural protein; 2.80A {Drosophila melanogaster} (A:)
Probab=20.03  E-value=66  Score=14.42  Aligned_cols=33  Identities=27%  Similarity=0.588  Sum_probs=23.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHH
Q ss_conf             878864367786366889879-999999998987
Q gi|254781081|r   35 SDLTQRYDYLLLNKHLLVDNL-KSYLDKFGSLIS   67 (93)
Q Consensus        35 sdltqrydylllnkhllvdnl-ksyldkfgslis   67 (93)
                      ..+.|.+.||+-|..-.|..| +.|+..|+.++-
T Consensus        12 ~Q~vQAf~YLi~nD~eFvnKlH~aY~ks~~~~ll   45 (46)
T 2wx4_A           12 TQFVQAFTYLIQNDKEFANKLHKAYLNGCSNLLL   45 (46)
T ss_dssp             HHHHHHHHHHHHHCTTHHHHHHHHHHC-------
T ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             8999999999974899999999999987888722


No 4  
>>1pu1_A Hypothetical protein MTH677; structural genomics, alpha and beta protein (A+B), unknown function; NMR {Methanothermobacterthermautotrophicus} (A:)
Probab=19.55  E-value=38  Score=15.72  Aligned_cols=34  Identities=29%  Similarity=0.365  Sum_probs=18.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             320157788788643677863668898799999999
Q gi|254781081|r   27 DQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKF   62 (93)
Q Consensus        27 dqitsdelsdltqrydylllnkhllvdnlksyldkf   62 (93)
                      -.+|-||||+++|.----+.....  -.|.||+|.|
T Consensus        59 v~it~DeLS~~~~~~V~~aid~aY--~~ldsyiDny   92 (94)
T 1pu1_A           59 AELYLDELSDADPGIVDEAVDAAY--RSLESFLDGF   92 (94)
T ss_dssp             EEEEECTTCCCCTTHHHHHHHHHH--HHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHHH--HHHHHHHHHC
T ss_conf             766454431379842788999999--9899998650


No 5  
>>1dcu_A Fructose-1,6-bisphosphatase; chloroplast, photosynthesis, redox regulation, thioredoxin, allostery; 2.20A {Pisum sativum} (A:229-357)
Probab=13.13  E-value=38  Score=15.71  Aligned_cols=23  Identities=52%  Similarity=0.943  Sum_probs=15.6

Q ss_pred             HHHHHHHHHHHH---------------HHHHHHHHCCC
Q ss_conf             898799999999---------------98987862077
Q gi|254781081|r   51 LVDNLKSYLDKF---------------GSLISDFHRNS   73 (93)
Q Consensus        51 lvdnlksyldkf---------------gslisdfhrns   73 (93)
                      ..+..+.|++.+               ||++.||||+-
T Consensus        16 w~~~~~~~i~~~~~~~~~~~~y~~RY~GsmVaD~Hr~L   53 (129)
T 1dcu_A           16 WDENLKKYIDDLKEPGPSGKPYSARYIGSLVGDFHRTL   53 (129)
T ss_dssp             SCHHHHHHHHHHHSCCTTSCCCEECBCSCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHH
T ss_conf             42889999999605366686300256132244699999


No 6  
>>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} (R:)
Probab=12.26  E-value=93  Score=13.61  Aligned_cols=30  Identities=27%  Similarity=0.302  Sum_probs=24.4

Q ss_pred             HHHHHHHHHHCCCCHHEEEECCCCHHHHHH
Q ss_conf             999898786207701323204542056652
Q gi|254781081|r   61 KFGSLISDFHRNSESELVRCSDSESEEAKE   90 (93)
Q Consensus        61 kfgslisdfhrnseselvrcsdseseeake   90 (93)
                      +.|+|-++|-.+.....|.||||..+-.+|
T Consensus        98 ~p~~lR~~~g~~~~~N~vH~Sds~~~a~rE  127 (144)
T 1nhk_R           98 AEGTIRKDFATSIDKNTVHGSDSLENAKIE  127 (144)
T ss_dssp             CTTSHHHHHCCSSSSCSEEECSSHHHHHHH
T ss_pred             CCCCCHHHHCCCCCCCCEECCCCHHHHHHH
T ss_conf             999950564578777695888999999999


No 7  
>>3jsz_A LGT1, putative uncharacterized protein; glucosyltransferase, legionnaire'S disease; HET: MSE UPG; 1.70A {Legionella pneumophila} PDB: 2wzg_A* 3jt1_A* 2wzf_A* (A:1-109)
Probab=11.56  E-value=89  Score=13.69  Aligned_cols=31  Identities=48%  Similarity=0.610  Sum_probs=22.3

Q ss_pred             CHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHH
Q ss_conf             1577887886436778-----636688987999999
Q gi|254781081|r   30 TSDELSDLTQRYDYLL-----LNKHLLVDNLKSYLD   60 (93)
Q Consensus        30 tsdelsdltqrydyll-----lnkhllvdnlksyld   60 (93)
                      .+.+||.|..|+---|     ..-|.|.+||||-|.
T Consensus         5 r~~~lsklrmrffsalnhtseidlh~lf~~lks~lt   40 (109)
T 3jsz_A            5 RSNELSKLRXRFFSALNHTSEIDLHTLFDNLKSNLT   40 (109)
T ss_dssp             -CHHHHHHHHHHHHHTTTCSSSCHHHHHHHHGGGCC
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC
T ss_conf             354889999999987356430009999877775334


No 8  
>>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} (A:1-88)
Probab=11.27  E-value=60  Score=14.63  Aligned_cols=13  Identities=23%  Similarity=0.470  Sum_probs=5.7

Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             8799999999989
Q gi|254781081|r   53 DNLKSYLDKFGSL   65 (93)
Q Consensus        53 dnlksyldkfgsl   65 (93)
                      +-.+.||.+||-+
T Consensus        24 ~~a~~yL~~fGYl   36 (88)
T 1l6j_A           24 QLAEEYLYRYGYT   36 (88)
T ss_dssp             HHHHHHHHHTTCC
T ss_pred             HHHHHHHHHCCCC
T ss_conf             9999999974999


No 9  
>>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} (A:)
Probab=10.79  E-value=1.2e+02  Score=13.04  Aligned_cols=45  Identities=20%  Similarity=0.307  Sum_probs=31.3

Q ss_pred             HHHHHHHHHHHHHHH--------HHHHHHHHHHCCCCHHEEEECCCCHHHHHH
Q ss_conf             636688987999999--------999898786207701323204542056652
Q gi|254781081|r   46 LNKHLLVDNLKSYLD--------KFGSLISDFHRNSESELVRCSDSESEEAKE   90 (93)
Q Consensus        46 lnkhllvdnlksyld--------kfgslisdfhrnseselvrcsdseseeake   90 (93)
                      +.++-.|.-++..+.        +-++|...|--+.....|.|||+..+-.+|
T Consensus        76 l~g~naV~~~r~l~Gp~dp~~a~~p~slR~~~g~~~~~N~vH~Sd~~~~a~rE  128 (136)
T 1k44_A           76 VEGTRAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLVHGSDSAESAQRE  128 (136)
T ss_dssp             EEETTHHHHHHHHHCCSSTTTTSCTTSHHHHHCCCSTTCCEEECSSHHHHHHH
T ss_pred             CCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHCCCCCCCCEECCCCHHHHHHH
T ss_conf             27863899999984789953126999805665187675096889999999999


No 10 
>>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} (A:)
Probab=10.77  E-value=1.2e+02  Score=13.08  Aligned_cols=29  Identities=28%  Similarity=0.318  Sum_probs=24.1

Q ss_pred             HHHHHHHHHCCCCHHEEEECCCCHHHHHH
Q ss_conf             99898786207701323204542056652
Q gi|254781081|r   62 FGSLISDFHRNSESELVRCSDSESEEAKE   90 (93)
Q Consensus        62 fgslisdfhrnseselvrcsdseseeake   90 (93)
                      -+++-..|-.+.....|.||||..+-.+|
T Consensus        99 p~slR~~fg~~~~~N~vH~Sds~e~a~rE  127 (142)
T 2hur_A           99 AGTLRADYADSLTENGTHGSDSVESAARE  127 (142)
T ss_dssp             TTSHHHHHCSSSTTCSEEECSSHHHHHHH
T ss_pred             CCCCHHHHCCCCCCCCEECCCCHHHHHHH
T ss_conf             99826552478777086888999999999


Done!