RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781081|ref|YP_003065494.1| hypothetical protein CLIBASIA_04915 [Candidatus Liberibacter asiaticus str. psy62] (93 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 28.4 bits (63), Expect = 0.38 Identities = 10/45 (22%), Positives = 16/45 (35%), Gaps = 12/45 (26%) Query: 32 DELSDLTQRYD-YLLLNKHLLVDNLKSYLDKFGSLISDFHRNSES 75 +EL DL Y Y L+ D + +S+ R + Sbjct: 171 EELRDL---YQTY----HVLVGD----LIKFSAETLSELIRTTLD 204 Score = 28.4 bits (63), Expect = 0.43 Identities = 8/53 (15%), Positives = 19/53 (35%), Gaps = 6/53 (11%) Query: 21 DFASDSDQITSDELSDLTQRYDYL-LLNKHLLVDNLKSYLDKFGSLISDFHRN 72 FA+D + T EL +L ++ + + + +++F Sbjct: 47 GFAADDEPTTPAELV-----GKFLGYVSSLVEPSKVGQFDQVLNLCLTEFENC 94 >1r1m_A Outer membrane protein class 4; 1.90A {Neisseria meningitidis} SCOP: d.79.7.1 Length = 164 Score = 27.4 bits (60), Expect = 0.82 Identities = 12/57 (21%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Query: 8 AYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGS 64 Y +E S+ F D D + ++ +L L V ++ + D GS Sbjct: 5 QYVDETISLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVR-VEGHTDFMGS 60 >2zf8_A MOTY, component of sodium-driven polar flagellar motor; beta barrel, 2-layer sandwich, flagellum, structural protein; 2.85A {Vibrio alginolyticus} Length = 278 Score = 26.0 bits (57), Expect = 1.8 Identities = 10/43 (23%), Positives = 19/43 (44%) Query: 22 FASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGS 64 + DQ+T L+Q DY+ N+ + + + +Y D Sbjct: 166 YERQGDQLTKASKKRLSQIADYIRHNQDIDLVLVATYTDSTDG 208 >3oon_A Outer membrane protein (TPN50); protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG; 1.79A {Borrelia burgdorferi} Length = 123 Score = 25.1 bits (55), Expect = 3.7 Identities = 8/42 (19%), Positives = 16/42 (38%) Query: 11 EERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLV 52 + ++ D++F +S QI E + L K + Sbjct: 10 NKGINLSFDIEFYPNSFQILQKEYKKIDLIAKLLEKFKKNNI 51 >2kgw_A Outer membrane protein A; OMPA- like, cell membrane, transmembrane; NMR {Mycobacterium tuberculosis} Length = 129 Score = 24.7 bits (54), Expect = 4.6 Identities = 10/43 (23%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Query: 22 FASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLDKFGS 64 F +D + + L + D L V + Y D GS Sbjct: 28 FGNDGASLIPADYEILNRVADKLKACPDARVT-INGYTDNTGS 69 >1gtz_A 3-dehydroquinate dehydratase; lyase, type II dehydroquinase, shikimate pathway, dodecameric quaternary structure; HET: DHK; 1.6A {Streptomyces coelicolor} SCOP: c.23.13.1 PDB: 2bt4_A* 1v1j_A* 2cjf_A* 1d0i_A 1gu0_A 1gu1_A* Length = 156 Score = 24.7 bits (54), Expect = 5.2 Identities = 6/30 (20%), Positives = 8/30 (26%) Query: 51 LVDNLKSYLDKFGSLISDFHRNSESELVRC 80 + G + N E ELV Sbjct: 36 VEALCVKAAAAHGGTVDFRQSNHEGELVDW 65 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.311 0.129 0.346 Gapped Lambda K H 0.267 0.0680 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 712,190 Number of extensions: 25766 Number of successful extensions: 85 Number of sequences better than 10.0: 1 Number of HSP's gapped: 84 Number of HSP's successfully gapped: 19 Length of query: 93 Length of database: 5,693,230 Length adjustment: 60 Effective length of query: 33 Effective length of database: 4,238,590 Effective search space: 139873470 Effective search space used: 139873470 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 50 (23.1 bits)