BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781081|ref|YP_003065494.1| hypothetical protein CLIBASIA_04915 [Candidatus Liberibacter asiaticus str. psy62] (93 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781081|ref|YP_003065494.1| hypothetical protein CLIBASIA_04915 [Candidatus Liberibacter asiaticus str. psy62] Length = 93 Score = 183 bits (464), Expect = 5e-49, Method: Compositional matrix adjust. Identities = 93/93 (100%), Positives = 93/93 (100%) Query: 1 MSEIMCEAYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLD 60 MSEIMCEAYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLD Sbjct: 1 MSEIMCEAYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNKHLLVDNLKSYLD 60 Query: 61 KFGSLISDFHRNSESELVRCSDSESEEAKEGTE 93 KFGSLISDFHRNSESELVRCSDSESEEAKEGTE Sbjct: 61 KFGSLISDFHRNSESELVRCSDSESEEAKEGTE 93 >gi|254780900|ref|YP_003065313.1| homoserine dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Score = 21.9 bits (45), Expect = 2.3, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Query: 50 LLVDNLKSYLDKFGSLISDFHRNSESELVRCSDSESEEAKE 90 L + N + LDK S +SDF N L C E E ++E Sbjct: 358 LTIRNFEGILDKITSQMSDF--NISLRLFSCPHQE-ENSQE 395 >gi|254780421|ref|YP_003064834.1| hypothetical protein CLIBASIA_01530 [Candidatus Liberibacter asiaticus str. psy62] Length = 218 Score = 20.8 bits (42), Expect = 4.7, Method: Compositional matrix adjust. Identities = 9/26 (34%), Positives = 15/26 (57%) Query: 28 QITSDELSDLTQRYDYLLLNKHLLVD 53 ++ +D+L+ L RY L +LVD Sbjct: 114 KVANDDLAPLAVRYAATLQAASILVD 139 >gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Score = 20.8 bits (42), Expect = 5.0, Method: Compositional matrix adjust. Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 15/61 (24%) Query: 3 EIMCEAYAEERYSVLLDLDFASDSDQITSDELSDLTQRYDYLLLNK-HLLVDNLKSYLDK 61 E++C +A+ S + + L+D +++ L+N+ HLL+D L S + K Sbjct: 814 ELLCTTFAQRNDSFV--------------NALADNQSKFENNLVNQSHLLLDKLSSDIQK 859 Query: 62 F 62 Sbjct: 860 L 860 >gi|254780531|ref|YP_003064944.1| flagellin domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 452 Score = 20.0 bits (40), Expect = 9.1, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 20 LDFASDSDQITSDELSDLTQRYDYLLLNKHLLVD 53 +D+ D + + D +D T+RY L N + V+ Sbjct: 166 IDYYLDPETVLLDSSTDGTERYGLLDRNHKIKVE 199 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.311 0.129 0.346 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,321 Number of Sequences: 1233 Number of extensions: 2022 Number of successful extensions: 10 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 93 length of database: 328,796 effective HSP length: 60 effective length of query: 33 effective length of database: 254,816 effective search space: 8408928 effective search space used: 8408928 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (20.9 bits) S2: 31 (16.5 bits)