RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781082|ref|YP_003065495.1| hypothetical protein CLIBASIA_04920 [Candidatus Liberibacter asiaticus str. psy62] (108 letters) >d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Length = 414 Score = 31.6 bits (70), Expect = 0.021 Identities = 5/39 (12%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Query: 20 NSIVEALRKAKPSMSDLAMLSVEERDAIL----DDLEKN 54 + ++E +K + + L + E++ + + L++ Sbjct: 1 DELLEKAKKVREAWDVLRNATTREKNKAIKKIAEKLDER 39 >d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 436 Score = 29.4 bits (65), Expect = 0.074 Identities = 10/39 (25%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Query: 20 NSIVEALRKAKPSMSDLAMLSVEERDAILDD----LEKN 54 +S + + A+ + + L +S E R IL L+ N Sbjct: 3 SSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKAN 41 >d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494 Score = 26.1 bits (57), Expect = 0.75 Identities = 9/39 (23%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Query: 20 NSIVEALRKAKPSMSDLAMLSVEERDAIL----DDLEKN 54 + V+A R A S + R +L D +E++ Sbjct: 54 DKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERD 92 >d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Length = 494 Score = 26.1 bits (57), Expect = 0.88 Identities = 9/29 (31%), Positives = 14/29 (48%) Query: 23 VEALRKAKPSMSDLAMLSVEERDAILDDL 51 V+A R+A S + ER +L+ L Sbjct: 57 VKAARQAFQIGSPWRTMDASERGRLLNKL 85 >d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 404 Score = 26.1 bits (57), Expect = 0.93 Identities = 9/36 (25%), Positives = 15/36 (41%), Gaps = 5/36 (13%) Query: 9 REFIEYWRLER----NSIVEALRKAKPSMSDLAMLS 40 R F +WRL R +++ L S L ++ Sbjct: 305 RRFF-FWRLRRRLNEEYLIKRLSHQVGEASRLEKIA 339 >d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Length = 474 Score = 24.8 bits (53), Expect = 2.0 Identities = 11/39 (28%), Positives = 19/39 (48%), Gaps = 7/39 (17%) Query: 20 NSIVEALRKAKPSMSDLAMLSVEERDAIL----DDLEKN 54 + + + +KA+P+ L S ER A L D L ++ Sbjct: 42 DYVYASAKKAQPAWRAL---SYIERAAYLHKVADILMRD 77 >d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Length = 504 Score = 24.3 bits (51), Expect = 2.8 Identities = 8/39 (20%), Positives = 13/39 (33%), Gaps = 7/39 (17%) Query: 20 NSIVEALRKAKPSMSDLAMLSVEERDAIL----DDLEKN 54 N A K L + +R ++L +LE Sbjct: 29 NQAATAAAKVARDFRRL---NNSKRASLLRTIASELEAR 64 >d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 446 Score = 24.1 bits (51), Expect = 3.6 Identities = 7/31 (22%), Positives = 17/31 (54%) Query: 21 SIVEALRKAKPSMSDLAMLSVEERDAILDDL 51 SI + +++A+ + + S++ R L+ L Sbjct: 1 SISDTVKRAREAFNSGKTRSLQFRIQQLEAL 31 >d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Length = 544 Score = 23.9 bits (50), Expect = 4.0 Identities = 9/69 (13%), Positives = 22/69 (31%), Gaps = 5/69 (7%) Query: 24 EALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYSFVNDLWERLKYLRDLPVYNFSLD 83 + L P + + + + L SD F + L +D+ + + Sbjct: 396 QTLSVGSPFRTGILNALTPQFKRVAAIL-----SDMLFQSPRRVMLSATKDVNRWTYLST 450 Query: 84 YVSRFHSFV 92 ++ F+ Sbjct: 451 HLHNLVPFL 459 >d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Length = 388 Score = 23.6 bits (50), Expect = 4.3 Identities = 10/51 (19%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Query: 12 IEYWRLERNSIVEALRK--AKPSMSDL-AMLSVEERDAILDDLEKNGSSDY 59 +YW R I + L + + + S +R G+ DY Sbjct: 27 FKYWGGVRGDIEQWLNDNGYRTYTLAVGPLSSNWDRACEAYAQLVGGTVDY 77 >d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Length = 474 Score = 23.6 bits (50), Expect = 4.9 Identities = 9/40 (22%), Positives = 15/40 (37%), Gaps = 7/40 (17%) Query: 20 NSIVEALRKAKPSMSDLAMLSVEERDAIL----DDLEKNG 55 ++ V A A + + R L D +E+NG Sbjct: 42 DAAVRAADAAFAEWGQT---TPKVRAECLLKLADVIEENG 78 >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Score = 23.0 bits (48), Expect = 7.8 Identities = 8/37 (21%), Positives = 12/37 (32%) Query: 16 RLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLE 52 ++ I L + + M E AI LE Sbjct: 232 KVSGKEIQPTLERIEQKMVLNKHQETPEFKAIQQKLE 268 >d1vbga1 c.1.12.2 (A:521-876) Pyruvate phosphate dikinase, C-terminal domain {Maize (Zea mays) [TaxId: 4577]} Length = 356 Score = 22.5 bits (47), Expect = 9.6 Identities = 19/97 (19%), Positives = 31/97 (31%), Gaps = 15/97 (15%) Query: 10 EFIEYWRLERNSIVEALRKAKPSMSDLAMLSVEERDAILDDLEKNGSSDYSFVNDLWERL 69 E + + ER V + A ++E R LD L SD+ + Sbjct: 46 EHMFFASDERIKAVRQMIMAP---------TLELRQQALDRLLPYQRSDFEGI------F 90 Query: 70 KYLRDLPVYNFSLDYVSRFHSFVSDEVAVWYEVTKEK 106 + + LPV LD + + E+ E Sbjct: 91 RAMDGLPVTIRLLDPPLHEFLPEGNIEDIVSELCAET 127 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.317 0.132 0.383 Gapped Lambda K H 0.267 0.0576 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 421,586 Number of extensions: 18119 Number of successful extensions: 93 Number of sequences better than 10.0: 1 Number of HSP's gapped: 93 Number of HSP's successfully gapped: 29 Length of query: 108 Length of database: 2,407,596 Length adjustment: 68 Effective length of query: 40 Effective length of database: 1,473,956 Effective search space: 58958240 Effective search space used: 58958240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.2 bits)