Query         gi|254781083|ref|YP_003065496.1| hypothetical protein CLIBASIA_04925 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 160
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 23785
Date          Wed Jun  1 00:41:23 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781083.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1t7l_A 5-methyltetrahydroptero  34.1     1.5 6.3E-05   22.8  -3.4   58   65-130   651-708 (766)
  2 1u1j_A 5-methyltetrahydroptero  14.4       7  0.0003   19.0  -3.2   55   67-129   650-704 (765)
  3 2nq5_A 5-methyltetrahydroptero  14.4      17 0.00073   16.7  -1.2   54   67-129   635-688 (755)
  4 2hl0_A Threonyl-tRNA synthetas  10.4      66  0.0028   13.4   0.8   18  115-133    68-85  (143)
  5 1jy2_P Fibrinogen gamma-B chai   9.1      98  0.0041   12.5   1.3   13   75-87     34-46  (48)
  6 2iwl_X Phosphatidylinositol-4-   8.4   1E+02  0.0044   12.3   1.3   71   30-102    61-136 (140)
  7 2krt_A Conserved hypothetical    7.9      75  0.0031   13.1   0.2   25  112-136    55-79  (121)
  8 1h2v_C 80 kDa nuclear CAP bind   7.6 1.1E+02  0.0048   12.1   5.6   56   15-71    524-579 (771)
  9 3k63_A Conserved hypothetical    7.6      76  0.0032   13.1   0.1   21  112-132    50-70  (126)
 10 2pa2_A 60S ribosomal protein L   6.7 1.3E+02  0.0053   11.8   1.8   41   96-137    30-70  (151)

No 1  
>1t7l_A 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase; TIM barrel, methyltetrahydrofolate, zinc; 2.00A {Thermotoga maritima} PDB: 3bq5_A 3bq6_A 1xdj_A 1xr2_A* 1xpg_A*
Probab=34.11  E-value=1.5  Score=22.79  Aligned_cols=58  Identities=28%  Similarity=0.326  Sum_probs=32.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHCCCCCHHEECCCH
Q ss_conf             766433127888765465333225999999875677865666667986440220821010114303
Q gi|254781083|r   65 TYWSERGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFYFAKYPKKVGPSVIDVVYPHS  130 (160)
Q Consensus        65 tywsergdiinaldqdlqdvesievfeylktrlsdleahrrsmsfyfakypkkvgpsvidvvyphs  130 (160)
                      ++|++-.+|+.++..---|+-+||   |-..+...|++-+     .|.+|+|++||.|||+--|.-
T Consensus       651 ~Cygnf~~i~~~i~~l~aDvi~lE---~a~s~~~~l~~l~-----~~~~~~k~Ig~GViD~~sp~v  708 (766)
T 1t7l_A          651 MCYSDFNEIIEYIHQLEFDVISIE---ASRSKGEIISAFE-----NFKGWIKQIGVGVWDIHSPAV  708 (766)
T ss_dssp             CCCSCCTTTHHHHTTSCCSEEEEE---CTTTTTGGGHHHH-----TSTTCCSEEEEECSCTTSCSC
T ss_pred             ECCCCHHHHHHHHHHCCCCEEEEE---ECCCCCCHHHHHH-----HCCCCCCEEEEEEEECCCCCC
T ss_conf             478876999999974899989996---0699873306788-----557689879999995899998


No 2  
>1u1j_A 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase; methionine, synthase, methyltetrahydrofolate; HET: C2F; 2.40A {Arabidopsis thaliana} SCOP: c.1.22.2 c.1.22.2 PDB: 1u1h_A* 1u1u_A 1u22_A*
Probab=14.42  E-value=7  Score=18.98  Aligned_cols=55  Identities=31%  Similarity=0.391  Sum_probs=27.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHCCCCCHHEECCC
Q ss_conf             643312788876546533322599999987567786566666798644022082101011430
Q gi|254781083|r   67 WSERGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFYFAKYPKKVGPSVIDVVYPH  129 (160)
Q Consensus        67 wsergdiinaldqdlqdvesievfeylktrlsdleahrrsmsfyfakypkkvgpsvidvvyph  129 (160)
                      |++-.+|+.++..---|+-+||   +-..+...|++-+.     +..|+|.+||.|||+--|.
T Consensus       650 yg~f~~i~~~i~~l~aD~i~lE---~~~~~~~~l~~~~~-----~~~~~k~i~~GVvd~~sp~  704 (765)
T 1u1j_A          650 YSHFNDIIHSIIDMDADVITIE---NSRSDEKLLSVFRE-----GVKYGAGIGPGVYDIHSPR  704 (765)
T ss_dssp             CSCCTTTHHHHHTTCCSEEECC---BSSSCTTGGGGGTT-----TTCCCSEECCBSSCTTSSS
T ss_pred             CCCHHHHHHHHHCCCCCEEEEE---CCCCCHHHHHHHHH-----HCCCCCEEEEEEEECCCCC
T ss_conf             8772999999963999989985---48998367798886-----4789997999788489999


No 3  
>2nq5_A 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase; structural genomics, target 6426D, PSI; 1.90A {Streptococcus mutans}
Probab=14.41  E-value=17  Score=16.74  Aligned_cols=54  Identities=33%  Similarity=0.416  Sum_probs=29.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHCCCCCHHEECCC
Q ss_conf             643312788876546533322599999987567786566666798644022082101011430
Q gi|254781083|r   67 WSERGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFYFAKYPKKVGPSVIDVVYPH  129 (160)
Q Consensus        67 wsergdiinaldqdlqdvesievfeylktrlsdleahrrsmsfyfakypkkvgpsvidvvyph  129 (160)
                      |++-.+|+.++.+---|+-+||   |-..+...|++      |-...|||.+||.|||+--|.
T Consensus       635 ~gny~~i~~~i~~l~~D~i~iE---~a~~~~~~l~~------~~~~~~~k~I~lGVvd~~s~~  688 (755)
T 2nq5_A          635 YSKFDEIIDAIRALDADVISIE---TSRSHGDIIES------FETAVYPLGIGLGVYDIHSPR  688 (755)
T ss_dssp             CSCCSTTHHHHHHHCCSEEEC----------------------------CEEEEECSCTTSSC
T ss_pred             CCCHHHHHHHHHHCCCCEEEEE---ECCCCCCHHHH------HHHCCCCCEEEEEEEECCCCC
T ss_conf             8876999999984899989998---36998405688------873799986999999489999


No 4  
>2hl0_A Threonyl-tRNA synthetase; translation, editing, aminoacyl-tRNA synthetase, enzyme mechanism, enantioselectivity, ligase; HET: A3S; 1.86A {Pyrococcus abyssi} PDB: 2hkz_A 1y2q_A* 2hl2_A* 2hl1_A*
Probab=10.45  E-value=66  Score=13.43  Aligned_cols=18  Identities=33%  Similarity=0.659  Sum_probs=12.6

Q ss_pred             HHHCCCCCHHEECCCHHHH
Q ss_conf             0220821010114303431
Q gi|254781083|r  115 PKKVGPSVIDVVYPHSHLV  133 (160)
Q Consensus       115 pkkvgpsvidvvyphshlv  133 (160)
                      -+++|...| |+||..||-
T Consensus        68 a~kv~~~~i-vlYPyAHLS   85 (143)
T 2hl0_A           68 AEQVKAENV-FVYPFAHLS   85 (143)
T ss_dssp             HHHHTCCEE-EEEECGGGC
T ss_pred             HHHCCCCEE-EEECCHHCC
T ss_conf             986499879-993711116


No 5  
>1jy2_P Fibrinogen gamma-B chain; fragment E, disulfide bonds, asymmetry, coiled- coil, beta-sheet, blood clotting; 1.40A {Bos taurus} SCOP: h.1.8.1 PDB: 1jy3_P 2a45_I*
Probab=9.08  E-value=98  Score=12.46  Aligned_cols=13  Identities=38%  Similarity=0.759  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             8876546533322
Q gi|254781083|r   75 NALDQDLQDVESI   87 (160)
Q Consensus        75 naldqdlqdvesi   87 (160)
                      ...|+|||..|+|
T Consensus        34 ~~VdkDL~~lE~~   46 (48)
T 1jy2_P           34 TSVDKDLRTLEGI   46 (48)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHH
T ss_conf             0056789999997


No 6  
>2iwl_X Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide; PI3K, PX domain, transferase, polymorphism; 2.6A {Homo sapiens}
Probab=8.41  E-value=1e+02  Score=12.30  Aligned_cols=71  Identities=23%  Similarity=0.228  Sum_probs=31.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-H----HHHHHHHHHHHHHHHHHHHH
Q ss_conf             1688999999999999874666888511345667776643312788876546-5----33322599999987567786
Q gi|254781083|r   30 SFADVHEALERYKKVARVVGPHIPNSNVFSSSVRRTYWSERGDIINALDQDL-Q----DVESIEVFEYLKTRLSDLEA  102 (160)
Q Consensus        30 sfadvhealerykkvarvvgphipnsnvfsssvrrtywsergdiinaldqdl-q----dvesievfeylktrlsdlea  102 (160)
                      -|...|..|.+.  ..-..-|..|....|+.+-....--+|-..++..=+.| .    -..|-++.++|..+..|.+.
T Consensus        61 dF~~L~~~L~~~--~~~~~lp~~P~k~~~~~~~~~~~ie~R~~~L~~yL~~ll~~~~~i~~s~~v~~Fl~~~~~D~~~  136 (140)
T 2iwl_X           61 EFQELHNKLSII--FPLWKLPGFPNRMVLGRTHIKDVAAKRKIELNSYLQSLMNASTDVAECDLVCTFFHPLLRDEKA  136 (140)
T ss_dssp             HHHHHHHHHHHH--SCGGGSCCCCC----------CCCCHHHHHHHHHHHHHTTSCHHHHTSHHHHHHHSCCTTTCC-
T ss_pred             HHHHHHHHHHHH--HCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCHHHCCCHHHHHHCCCCCCCCHH
T ss_conf             999999999987--3324345588640035776358899999999999999975595231798999974999775210


No 7  
>2krt_A Conserved hypothetical membrane lipoprotein; NESG, UUR17A, structural genomics, PSI-2, protein structure initiative; NMR {Ureaplasma parvum}
Probab=7.90  E-value=75  Score=13.14  Aligned_cols=25  Identities=20%  Similarity=0.537  Sum_probs=18.6

Q ss_pred             HHCHHHCCCCCHHEECCCHHHHHHH
Q ss_conf             6440220821010114303431222
Q gi|254781083|r  112 AKYPKKVGPSVIDVVYPHSHLVKED  136 (160)
Q Consensus       112 akypkkvgpsvidvvyphshlvked  136 (160)
                      .+|..+.+-+||||.||.....-..
T Consensus        55 ~~~~d~i~i~vidvly~n~~~~~AN   79 (121)
T 2krt_A           55 HKYQNELDIKIINFLYPDGDFGSAN   79 (121)
T ss_dssp             CSCTTTEECCEEEEECSSSCHHHHH
T ss_pred             HHCCCEEEEEEEEEEEECCCCCCCC
T ss_conf             4206611159999996479832335


No 8  
>1h2v_C 80 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: a.118.1.14 a.118.1.14 a.118.1.14 PDB: 1n52_A* 1n54_A 3fex_A 3fey_A 1h6k_A 1h2t_C* 1h2u_A*
Probab=7.64  E-value=1.1e+02  Score=12.10  Aligned_cols=56  Identities=18%  Similarity=0.237  Sum_probs=34.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             999999999997112168899999999999987466688851134566777664331
Q gi|254781083|r   15 SILVFCFVSHFVQRKSFADVHEALERYKKVARVVGPHIPNSNVFSSSVRRTYWSERG   71 (160)
Q Consensus        15 silvfcfvshfvqrksfadvhealerykkvarvvgphipnsnvfsssvrrtywserg   71 (160)
                      +|-+|--.--+..-|||..+..+++||+.+-+-.++--......-.++. .||..-.
T Consensus       524 ~i~v~~q~ll~~GskS~SH~~~~i~ry~~~lk~l~~~~~~q~~il~~v~-~~W~~~~  579 (771)
T 1h2v_C          524 KIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDEGKLHVLRVMF-EVWRNHP  579 (771)
T ss_dssp             HHHHHHHHHHHHSTTCHHHHHHHHHHTHHHHHHHTSSHHHHHHHHHHHH-HHHTTCH
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHH-HHHHCCC
T ss_conf             9999999999953552999999999999999987068777999999999-9980698


No 9  
>3k63_A Conserved hypothetical membrane lipoprotein; Q9PRA0, PF04200, DUF1976, UUR17A, NESG., structural genomics, PSI-2, protein structure initiative; 2.49A {Ureaplasma parvum} PDB: 3jvc_A
Probab=7.56  E-value=76  Score=13.10  Aligned_cols=21  Identities=24%  Similarity=0.654  Sum_probs=17.5

Q ss_pred             HHCHHHCCCCCHHEECCCHHH
Q ss_conf             644022082101011430343
Q gi|254781083|r  112 AKYPKKVGPSVIDVVYPHSHL  132 (160)
Q Consensus       112 akypkkvgpsvidvvyphshl  132 (160)
                      -||..+++-+||||.||....
T Consensus        50 ~k~~dki~ikVi~Vly~~~d~   70 (126)
T 3k63_A           50 HKYQNELDIKIINFLYPDGDF   70 (126)
T ss_dssp             CSCTTTEEEEEEEEECTTSSH
T ss_pred             ECCCCCCCEEEEEEEECCCCC
T ss_conf             314352362899999537982


No 10 
>2pa2_A 60S ribosomal protein L10; QM protein, , structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Homo sapiens} SCOP: d.41.4.1
Probab=6.73  E-value=1.3e+02  Score=11.84  Aligned_cols=41  Identities=24%  Similarity=0.201  Sum_probs=27.4

Q ss_pred             HHHHHHHHHHHHHHHHHHCHHHCCCCCHHEECCCHHHHHHHH
Q ss_conf             756778656666679864402208210101143034312220
Q gi|254781083|r   96 RLSDLEAHRRSMSFYFAKYPKKVGPSVIDVVYPHSHLVKEDK  137 (160)
Q Consensus        96 rlsdleahrrsmsfyfakypkkvgpsvidvvyphshlvkedk  137 (160)
                      |-..|||-|..+.=|..|.-.|-|--+.-.+|||.-+ .|.+
T Consensus        30 ~~~alEAaR~a~nr~l~k~~gk~~~~~~IrvfP~~~l-r~~~   70 (151)
T 2pa2_A           30 SSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVI-RINK   70 (151)
T ss_dssp             EHHHHHHHHHHHHHHHHHHHCTTSEEEEECCSCC--------
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCC-CCCH
T ss_conf             6889999999999999985076774799997687120-3275


Done!