RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781083|ref|YP_003065496.1| hypothetical protein CLIBASIA_04925 [Candidatus Liberibacter asiaticus str. psy62] (160 letters) >gnl|CDD|145066 pfam01717, Meth_synt_2, Cobalamin-independent synthase, Catalytic domain. This is a family of vitamin-B12 independent methionine synthases or 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferases, EC:2.1.1.14 from bacteria and plants. Plants are the only higher eukaryotes that have the required enzymes for methionine synthesis. This enzyme catalyses the last step in the production of methionine by transferring a methyl group from 5-methyltetrahydrofolate to homocysteine. The aligned region makes up the carboxy region of the approximately 750 amino acid protein except in some hypothetical archaeal proteins present in the family, where this region corresponds to the entire length. This domain contains the catalytic residues of the enzyme. Length = 324 Score = 30.4 bits (69), Expect = 0.24 Identities = 17/65 (26%), Positives = 25/65 (38%), Gaps = 17/65 (26%) Query: 68 SERGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSF--YFAK--YPKKVGPSVI 123 S+ DI++A+D DV +E R M + Y K VG V+ Sbjct: 220 SDFNDILDAIDALDVDV-------------LTIEFARSDMENLEALEEWGYGKGVGFGVV 266 Query: 124 DVVYP 128 D+ P Sbjct: 267 DIHSP 271 >gnl|CDD|146845 pfam04409, DUF530, Protein of unknown function (DUF530). Family of hypothetical archaeal proteins. Length = 512 Score = 28.4 bits (63), Expect = 0.83 Identities = 10/45 (22%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Query: 72 DIINALDQDLQDVES-IEVFEYLKTRLSDLEAHRRSMSFYFAKYP 115 DI + L+D + I+++ L++ L L+ M P Sbjct: 16 DISIDIGDLLKDFDGFIKIYLTLESNLEILQELEEKMERRGFDGP 60 >gnl|CDD|144201 pfam00521, DNA_topoisoIV, DNA gyrase/topoisomerase IV, subunit A. Length = 428 Score = 27.5 bits (62), Expect = 1.9 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 11/37 (29%) Query: 26 VQRK----SFADVHEALERYKKVARVVG-------PH 51 VQR+ F ++YKKVAR+VG PH Sbjct: 13 VQRRILYAMFELGLNLDKKYKKVARLVGDVMGKYHPH 49 >gnl|CDD|48146 cd03311, CIMS_C_terminal_like, CIMS - Cobalamine-independent methonine synthase, or MetE, C-terminal domain_like. Many members have been characterized as 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferases, EC:2.1.1.14, mostly from bacteria and plants. This enzyme catalyses the last step in the production of methionine by transferring a methyl group from 5-methyltetrahydrofolate to L-homocysteine without using an intermediate methyl carrier. The active enzyme has a dual (beta-alpha)8-barrel structure, and this model covers the C-terminal barrel, and a few single-barrel sequences most similar to the C-terminal barrel. It is assumed that the homologous N-terminal barrel has evolved from the C-terminus via gene duplication and has subsequently lost binding sites, and it seems as if the two barrels forming the active enzyme may sometimes reside on different polypeptides. The C-terminal domain incorporates the Zinc ion, which binds and activates homocysteine. Sidechains from both barrels contribute to the binding of the folate substrate.. Length = 332 Score = 27.1 bits (60), Expect = 2.3 Identities = 16/55 (29%), Positives = 20/55 (36%), Gaps = 9/55 (16%) Query: 71 GDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFYFAKYPKKVGPSVIDV 125 I + + DV EY +R LE Y KKVG V+DV Sbjct: 231 EPIAEYIFELDVDVFF---LEYDNSRAGGLEP------LKELPYDKKVGLGVVDV 276 >gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase. Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates Musk autophosphorylation and activation, leading to the clustering of acetylcholine receptors (AChRs). To date, there is no evidence to suggest that agrin binds directly to Musk. Mutations in AChR, Musk and other partners are responsible for diseases of the NMJ, such as the autoimmune syndrome myasthenia gravis. Length = 288 Score = 27.1 bits (60), Expect = 2.5 Identities = 7/25 (28%), Positives = 13/25 (52%) Query: 16 ILVFCFVSHFVQRKSFADVHEALER 40 ++ C+ R SFA ++ L+R Sbjct: 264 LMRLCWSKLPSDRPSFASINRILQR 288 >gnl|CDD|30965 COG0620, MetE, Methionine synthase II (cobalamin-independent) [Amino acid transport and metabolism]. Length = 330 Score = 26.8 bits (59), Expect = 3.0 Identities = 19/93 (20%), Positives = 36/93 (38%), Gaps = 12/93 (12%) Query: 36 EALERYKKVARVVGPHIPNSNVFSSSVRRTYWSERGDIINALDQDLQDVESIEVFEYLKT 95 + LE + + + + + +++ D I ALD D + E ++ Sbjct: 193 DYLEWAVEAINLAAAGVGADTQIHLHICYSEFNDIPDAIEALDAD------VIDIETSRS 246 Query: 96 RLSDLEAHRRSMSFYFAKYPKKVGPSVIDVVYP 128 R+ LE KY K++G V+D+ P Sbjct: 247 RMELLEV------LEEVKYDKEIGLGVVDIHSP 273 >gnl|CDD|30914 COG0568, RpoD, DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) [Transcription]. Length = 342 Score = 26.5 bits (58), Expect = 3.9 Identities = 8/51 (15%), Positives = 18/51 (35%) Query: 67 WSERGDIINALDQDLQDVESIEVFEYLKTRLSDLEAHRRSMSFYFAKYPKK 117 + E ++ D ++ ++ E L L++ E + F K Sbjct: 250 FLEDDKSVSPEDAVERESLKEDLNEVLAEALTERERRVIRLRFGLDDGEPK 300 >gnl|CDD|185771 cd09248, BRO1_Rhophilin_1, Protein-interacting Bro1-like domain of RhoA-binding protein Rhophilin-1. This subfamily contains the Bro1-like domain of the RhoA-binding protein, Rhophilin-1. It belongs to the BRO1_Alix_like superfamily which also includes the Bro1-like domains of mammalian Alix (apoptosis-linked gene-2 interacting protein X), His-Domain type N23 protein tyrosine phosphatase (HD-PTP, also known as PTPN23), RhoA-binding protein Rhophilin-2, Brox, Bro1 and Rim20 (also known as PalA) from Saccharomyces cerevisiae, Ustilago maydis Rim23 (also known as PalC), and related domains. Rhophilin-1 binds both GDP- and GTP-bound RhoA. Bro1-like domains are boomerang-shaped, and part of the domain is a tetratricopeptide repeat (TPR)-like structure. In addition to this Bro1-like domain, Rhophilin-1 contains an N-terminal Rho-binding domain and a C-terminal PDZ (PS.D.-95, Disc-large, ZO-1) domain. The Drosophila knockout of the Rhophilin-1 is embryonic lethal, suggesting an essential role in embryonic development. The isolated Bro1-like domain of Rhophilin-1 binds human immunodeficiency virus type 1 (HIV-1) nucleocapsid. Rhophilin-1 lacks the V-shaped (V) domain found in many members of the BRO1_Alix_ like superfamily. Length = 384 Score = 25.6 bits (56), Expect = 6.1 Identities = 11/37 (29%), Positives = 17/37 (45%) Query: 3 YLSVTWNDLVQVSILVFCFVSHFVQRKSFADVHEALE 39 Y+ +W LV V FC ++H+ + D A E Sbjct: 227 YVPFSWTALVHVKAEHFCALAHYHAAMALCDSSPASE 263 >gnl|CDD|33013 COG3200, AroG, 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism]. Length = 445 Score = 25.7 bits (56), Expect = 6.2 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Query: 43 KVARVVGPHI-PNSNVFSSSVRRTYWSERGDIINALDQD 80 KV R+ G P S+ T S RGDIIN ++ D Sbjct: 105 KVGRIAGQFAKPRSSDHEQLGGVTLPSYRGDIINGIEFD 143 >gnl|CDD|36398 KOG1184, KOG1184, KOG1184, Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism, Coenzyme transport and metabolism]. Length = 561 Score = 25.2 bits (55), Expect = 8.0 Identities = 7/65 (10%), Positives = 21/65 (32%) Query: 85 ESIEVFEYLKTRLSDLEAHRRSMSFYFAKYPKKVGPSVIDVVYPHSHLVKEDKVDEKNSS 144 ++ F + ++ + M + + K++ + V E K + Sbjct: 305 KNAIEFHSDRVKIRNATFGGVLMKDFLQELAKRIKKNKTSYENYVRIPVPEPKPLACPPN 364 Query: 145 SELKV 149 + L+ Sbjct: 365 APLRQ 369 >gnl|CDD|36244 KOG1026, KOG1026, KOG1026, Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms, Intracellular trafficking, secretion, and vesicular transport]. Length = 774 Score = 25.3 bits (55), Expect = 8.1 Identities = 7/26 (26%), Positives = 16/26 (61%) Query: 15 SILVFCFVSHFVQRKSFADVHEALER 40 S+++ C+ + +R SF ++H L+ Sbjct: 736 SLMLECWNENPKRRPSFKEIHSRLQA 761 >gnl|CDD|153133 cd01583, IPMI, 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate. Aconatase-like catalytic domain of 3-isopropylmalate dehydratase and related uncharacterized proteins. 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate 3-isopropylmalate. IPMI is involved in fungal and bacterial leucine biosynthesis and is also found in eukaryotes. Length = 382 Score = 25.2 bits (56), Expect = 8.7 Identities = 15/47 (31%), Positives = 18/47 (38%), Gaps = 10/47 (21%) Query: 96 RLSDLEAHRRSMSFYFAKYPK--KVGPSVIDVVYPHSHLVKEDKVDE 140 RL DL A A+ K KV V +V P S V + E Sbjct: 273 RLEDLRA--------AAEILKGRKVADGVRLIVVPASQRVYKQAEKE 311 >gnl|CDD|144761 pfam01282, Ribosomal_S24e, Ribosomal protein S24e. Length = 83 Score = 25.3 bits (56), Expect = 9.2 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Query: 16 ILVFCFVSHFVQRKS--FADVHEALERYKKV 44 ++VF F + F KS FA ++++LE KK Sbjct: 33 VVVFGFKTEFGGGKSTGFALIYDSLEAAKKF 63 >gnl|CDD|114015 pfam05266, DUF724, Protein of unknown function (DUF724). This family contains several uncharacterized proteins found in Arabidopsis thaliana and other plants. This region is often found associated with Agenet domains and may contain coiled-coil. Length = 190 Score = 25.1 bits (55), Expect = 9.7 Identities = 24/84 (28%), Positives = 36/84 (42%), Gaps = 9/84 (10%) Query: 25 FVQRKSFADVHEALERYKKVARVVGPHIPNSNVFSSSVRRTYWSERG---DIINALDQ-- 79 F ++ F E++E +KKV + PH +R + G I L++ Sbjct: 5 FTKKSPFWKTFESMEVFKKVPQ--SPHFSPLLETPEDLRE--GTAVGLMVTFIGLLEEVK 60 Query: 80 DLQDVESIEVFEYLKTRLSDLEAH 103 LQ +SI FE L S+LE H Sbjct: 61 KLQIDDSISEFESLSKCFSELEKH 84 >gnl|CDD|37897 KOG2686, KOG2686, KOG2686, Choline kinase [Cell wall/membrane/envelope biogenesis]. Length = 366 Score = 24.9 bits (54), Expect = 9.8 Identities = 19/78 (24%), Positives = 26/78 (33%), Gaps = 13/78 (16%) Query: 3 YLSVTWNDLVQVSILVFCFVSH---------FVQRKSFADVHEALERYKKVARVVGPHIP 53 YL W D+ I + FV S + E K + R+ G + Sbjct: 30 YLGGAWRDV----INEEQRLEVIPGGGSNLLFVVTSSASTTPIKDEPRKVLLRIYGQGVD 85 Query: 54 NSNVFSSSVRRTYWSERG 71 S + SV SERG Sbjct: 86 FSQRETESVMFAILSERG 103 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.133 0.386 Gapped Lambda K H 0.267 0.0660 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,890,440 Number of extensions: 90498 Number of successful extensions: 246 Number of sequences better than 10.0: 1 Number of HSP's gapped: 246 Number of HSP's successfully gapped: 22 Length of query: 160 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 74 Effective length of database: 4,405,363 Effective search space: 325996862 Effective search space used: 325996862 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (24.3 bits)