RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781083|ref|YP_003065496.1| hypothetical protein CLIBASIA_04925 [Candidatus Liberibacter asiaticus str. psy62] (160 letters) >d1uaxa_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 211 Score = 26.8 bits (58), Expect = 0.86 Identities = 4/16 (25%), Positives = 10/16 (62%) Query: 28 RKSFADVHEALERYKK 43 R+++ + ER++K Sbjct: 195 RRTWETARKIEERFRK 210 >d7reqa1 c.1.19.1 (A:4-560) Methylmalonyl-CoA mutase alpha subunit, domain 1 {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 557 Score = 26.2 bits (57), Expect = 1.5 Identities = 10/48 (20%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Query: 32 ADVHEALERYKKVARVVGPHIPNSNVFSSSVR--RTYWSERGDIINAL 77 V AL++ A P+ N+ + R + G++ +AL Sbjct: 503 EKVKAALDKITWAAGNPDDKDPDRNLLKLCIDAGRAMATV-GEMSDAL 549 >d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Length = 395 Score = 24.6 bits (53), Expect = 3.9 Identities = 10/53 (18%), Positives = 15/53 (28%), Gaps = 2/53 (3%) Query: 64 RTYWSERGDIINALDQDLQDVESIEVFE-YLKTRLS-DLEAHRRSMSFYFAKY 114 L Q L D S++ L L+ + E + Y Y Sbjct: 150 GADIVRNIPAFQTLAQRLADDYSVQTLYAVLNFHLTCEPEYYHEVERPYSTLY 202 >d1ikta_ d.106.1.1 (A:) SCP2-like domain of MFE-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Score = 24.5 bits (53), Expect = 4.9 Identities = 10/46 (21%), Positives = 16/46 (34%), Gaps = 5/46 (10%) Query: 85 ESIEVFEYLKTRLSDLEAH-----RRSMSFYFAKYPKKVGPSVIDV 125 +S VFE + RL D+ ++ K ID+ Sbjct: 2 QSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNIGAKWTIDL 47 >d1u1ha2 c.1.22.2 (A:396-760) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase MetE {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 365 Score = 23.9 bits (51), Expect = 6.2 Identities = 10/49 (20%), Positives = 16/49 (32%), Gaps = 5/49 (10%) Query: 85 ESIEVFEYLKTRLSDLEAHRRSMS-----FYFAKYPKKVGPSVIDVVYP 128 + I + + +E R KY +GP V D+ P Sbjct: 260 DIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSP 308 >d1pz4a_ d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]} Length = 113 Score = 24.2 bits (52), Expect = 6.6 Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Query: 86 SIEVFEYLKTRLSDLEAHRRSMS----FYFAKYPKKVGPSVIDV 125 S EVF + RL ++ R + F + K V V+D+ Sbjct: 8 SDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDL 51 >d1jj2h_ d.41.4.1 (H:) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 167 Score = 24.0 bits (52), Expect = 6.7 Identities = 9/39 (23%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Query: 100 LEAHRRSMSFYFAKYPKKVGPSVIDVVYPHSHLVKEDKV 138 LEA R + + Y +P H+++E+K Sbjct: 61 LEAARVAANRYVQNSGAAANYKFRIRKFPF-HVIRENKA 98 >d1io2a_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Archaeon Thermococcus kodakaraensis [TaxId: 311400]} Length = 213 Score = 24.0 bits (51), Expect = 7.6 Identities = 3/16 (18%), Positives = 8/16 (50%) Query: 28 RKSFADVHEALERYKK 43 RK + + + E+ + Sbjct: 195 RKGWKTLKKIAEKVES 210 >d1ab4a_ e.11.1.1 (A:) DNA Gyrase A {Escherichia coli [TaxId: 562]} Length = 493 Score = 23.8 bits (51), Expect = 7.7 Identities = 10/28 (35%), Positives = 14/28 (50%), Gaps = 4/28 (14%) Query: 26 VQRKSFADVHE----ALERYKKVARVVG 49 V R+ ++ + YKK ARVVG Sbjct: 15 VHRRVLYAMNVLGNDWNKAYKKSARVVG 42 >d1tz9a_ c.1.15.6 (A:) Mannonate dehydratase UxuA {Enterococcus faecalis (Streptococcus faecalis) [TaxId: 1351]} Length = 353 Score = 23.8 bits (51), Expect = 7.9 Identities = 9/67 (13%), Positives = 21/67 (31%), Gaps = 16/67 (23%) Query: 44 VARVVG--PHIPNSNVFSSSVRRTYWS-----ERGDIINALDQDLQDVESIEVFEYLKTR 96 + VVG + +V W+ + L +ES+ + + +K Sbjct: 26 ITGVVGTLLNKLPGDV---------WTVAEIQALKQSVEQEGLALLGIESVAIHDAIKAG 76 Query: 97 LSDLEAH 103 + + Sbjct: 77 TDQRDHY 83 >d1h2vc3 a.118.1.14 (C:481-790) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 310 Score = 23.7 bits (51), Expect = 8.7 Identities = 9/37 (24%), Positives = 17/37 (45%) Query: 14 VSILVFCFVSHFVQRKSFADVHEALERYKKVARVVGP 50 + I VF + KSF+ AL ++ +V + + Sbjct: 62 LKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAE 98 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.318 0.133 0.386 Gapped Lambda K H 0.267 0.0522 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 581,774 Number of extensions: 24936 Number of successful extensions: 62 Number of sequences better than 10.0: 1 Number of HSP's gapped: 62 Number of HSP's successfully gapped: 16 Length of query: 160 Length of database: 2,407,596 Length adjustment: 78 Effective length of query: 82 Effective length of database: 1,336,656 Effective search space: 109605792 Effective search space used: 109605792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.1 bits)