RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781084|ref|YP_003065497.1| hypothetical protein CLIBASIA_04930 [Candidatus Liberibacter asiaticus str. psy62] (59 letters) >gnl|CDD|111339 pfam02433, FixO, Cytochrome C oxidase, mono-heme subunit/FixO. The bacterial oxidase complex, fixNOPQ or cytochrome cbb3, is thought to be required for respiration in endosymbiosis. FixO is a membrane bound mono-heme constituent of the fixNOPQ complex. Length = 226 Score = 26.8 bits (60), Expect = 1.4 Identities = 7/30 (23%), Positives = 15/30 (50%) Query: 8 NSNSDMLVQADVDRAFSEMYGNSEQAAEKN 37 N+ +D+ QAD D + + +A ++ Sbjct: 171 NAKADLEAQADPDADTAGLLERYPKAQVRD 200 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.299 0.113 0.291 Gapped Lambda K H 0.267 0.0778 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 568,916 Number of extensions: 16303 Number of successful extensions: 24 Number of sequences better than 10.0: 1 Number of HSP's gapped: 24 Number of HSP's successfully gapped: 3 Length of query: 59 Length of database: 6,263,737 Length adjustment: 31 Effective length of query: 28 Effective length of database: 5,593,858 Effective search space: 156628024 Effective search space used: 156628024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 17 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.7 bits) S2: 51 (23.3 bits)