RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254781084|ref|YP_003065497.1| hypothetical protein
CLIBASIA_04930 [Candidatus Liberibacter asiaticus str. psy62]
         (59 letters)



>gnl|CDD|111339 pfam02433, FixO, Cytochrome C oxidase, mono-heme subunit/FixO.  The
           bacterial oxidase complex, fixNOPQ or cytochrome cbb3,
           is thought to be required for respiration in
           endosymbiosis. FixO is a membrane bound mono-heme
           constituent of the fixNOPQ complex.
          Length = 226

 Score = 26.8 bits (60), Expect = 1.4
 Identities = 7/30 (23%), Positives = 15/30 (50%)

Query: 8   NSNSDMLVQADVDRAFSEMYGNSEQAAEKN 37
           N+ +D+  QAD D   + +     +A  ++
Sbjct: 171 NAKADLEAQADPDADTAGLLERYPKAQVRD 200


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.299    0.113    0.291 

Gapped
Lambda     K      H
   0.267   0.0778    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 568,916
Number of extensions: 16303
Number of successful extensions: 24
Number of sequences better than 10.0: 1
Number of HSP's gapped: 24
Number of HSP's successfully gapped: 3
Length of query: 59
Length of database: 6,263,737
Length adjustment: 31
Effective length of query: 28
Effective length of database: 5,593,858
Effective search space: 156628024
Effective search space used: 156628024
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 17 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.7 bits)
S2: 51 (23.3 bits)