BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781084|ref|YP_003065497.1| hypothetical protein CLIBASIA_04930 [Candidatus Liberibacter asiaticus str. psy62] (59 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781084|ref|YP_003065497.1| hypothetical protein CLIBASIA_04930 [Candidatus Liberibacter asiaticus str. psy62] Length = 59 Score = 116 bits (291), Expect = 6e-29, Method: Compositional matrix adjust. Identities = 59/59 (100%), Positives = 59/59 (100%) Query: 1 MVSPPQFNSNSDMLVQADVDRAFSEMYGNSEQAAEKNSSSESKSKADLNKMNAPDSLPS 59 MVSPPQFNSNSDMLVQADVDRAFSEMYGNSEQAAEKNSSSESKSKADLNKMNAPDSLPS Sbjct: 1 MVSPPQFNSNSDMLVQADVDRAFSEMYGNSEQAAEKNSSSESKSKADLNKMNAPDSLPS 59 >gi|254781083|ref|YP_003065496.1| hypothetical protein CLIBASIA_04925 [Candidatus Liberibacter asiaticus str. psy62] Length = 160 Score = 29.6 bits (65), Expect = 0.011, Method: Compositional matrix adjust. Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Query: 31 EQAAEKNSSSESKSKADLNKMNAPDS 56 ++ EKNSSSE K DLNK+NAP S Sbjct: 136 DKVDEKNSSSELK--VDLNKLNAPGS 159 >gi|254780543|ref|YP_003064956.1| NADH dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 131 Score = 21.9 bits (45), Expect = 1.8, Method: Compositional matrix adjust. Identities = 9/32 (28%), Positives = 15/32 (46%) Query: 27 YGNSEQAAEKNSSSESKSKADLNKMNAPDSLP 58 +GN+ + KN + S+ N P S+P Sbjct: 35 FGNTYYESRKNINGSSRRWVIYNGYTDPSSIP 66 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.299 0.113 0.291 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,311 Number of Sequences: 1233 Number of extensions: 682 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 59 length of database: 328,796 effective HSP length: 31 effective length of query: 28 effective length of database: 290,573 effective search space: 8136044 effective search space used: 8136044 T: 11 A: 40 X1: 17 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (20.4 bits) S2: 31 (16.5 bits)