HHsearch alignment for GI: 254781085 and conserved domain: CHL00167

>CHL00167 consensus.
Probab=99.94  E-value=1.9e-24  Score=160.38  Aligned_cols=155  Identities=15%  Similarity=0.162  Sum_probs=150.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97989999999999999999996228899999999999999999999999999999999999999999999999999999
Q gi|254781085|r    2 HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKH   81 (173)
Q Consensus         2 ~~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~   81 (173)
T Consensus        25 NtnilETNlINl~ivigiL~~f-g~~~L~~~L~~Rke~I~~~I~eAE~r~~eA~~~L~eak~~L~qA~~eA~~Ir~~a~~  103 (182)
T CHL00167         25 NPDILEANVINILILLSGLIYL-GKNFLGSSLEERQQKVLEAIQESEERLEQANSRLSESEKQLAQAQIVIEQIKKEAEK  103 (182)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7439999999999999999998-467689899999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999943399999999999999999
Q gi|254781085|r   82 RAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ  157 (173)
Q Consensus        82 ~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~  157 (173)
T Consensus       104 ~ae~~k~~i~~~a~~d~erl~~~a~~~I~~E~~ra~~qlr~qv~~lAl~ka~~~L~~~Ld~~~q~~lId~~I~~Lg  179 (182)
T CHL00167        104 TARKVKSSILAQGKLDIERLTNNGKSSIETAEKQIKKQIQQQITFLAIKRVTLQLENQMTPNLQLRIIDNNIAKLG  179 (182)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHC
T ss_conf             9999999999999999999999999899999999999999999999999999998866499999999999999867