HHsearch alignment for GI: 254781085 and conserved domain: COG2811

>COG2811 NtpF Archaeal/vacuolar-type H+-ATPase subunit H [Energy production and conversion].
Probab=96.34  E-value=0.066  Score=29.66  Aligned_cols=79  Identities=15%  Similarity=0.160  Sum_probs=59.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   52 EKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE  130 (173)
Q Consensus        52 ~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~  130 (173)
T Consensus        10 ~eIk~aE~~ad~~IeeAkEe~~~~i~eAr~eareiieeaE~eA~~~~~e~l~~~~ee~e~ea~eI~~~ae~~~~~~~~k   88 (108)
T COG2811          10 REIKKAEISADEEIEEAKEEAEQIIKEAREEAREIIEEAEEEAEKLAQEILEEAREEAEEEAEEILAEAEKEASAILSK   88 (108)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999988658999999998899899999988999999999999999999999889888999999998889779999888