HHsearch alignment for GI: 254781085 and conserved domain: COG4741

>COG4741 Predicted secreted endonuclease distantly related to archaeal Holliday junction resolvase [Nucleotide transport and metabolism].
Probab=90.64  E-value=1.1  Score=22.61  Aligned_cols=42  Identities=19%  Similarity=0.359  Sum_probs=19.7

Q ss_pred             HHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             899999999999999-9999622889999999999999999999
Q gi|254781085|r    5 ETFLVFMSLIIFLVI-VVYLRIPSILLSFLDAHADKIRDDIFEA   47 (173)
Q Consensus         5 ~tfw~~i~f~il~~i-l~~~~~~~~i~~~l~~R~~~I~~~l~~A   47 (173)
T Consensus         3 ~vil~~iv~il~lvl~~l~~~I-r~lq~~~e~k~~~l~e~l~~~   45 (175)
T COG4741           3 IVILILIVFILALVLYLLRAYI-RSLQGKVESKARELEETLQKA   45 (175)
T ss_pred             EEHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHH
T ss_conf             6289999999999999999999-999999998899999999999